RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAF55467.1 cglu2 BAF55467.1 GIB00498CH01 "hypothetical protein"
         (282 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3c0lA [x.x.x] UV ENDONUCLEASE                                          50   1e-08
3dx5A [x.x.x] UNCHARACTERIZED PROTEIN ASBF                             48   3e-08
3bzgA [x.x.x] UV ENDONUCLEASE                                          45   3e-07
3cqjA [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE                  45   3e-07
3cqiB [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE                  42   2e-06
3cqiA [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE                  39   2e-05
3cqjB [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE                  38   4e-05
1a0cA [c.1.15] XYLOSE ISOMERASE                                        36   2e-04
1dxiA [c.1.15] D-XYLOSE ISOMERASE                                      34   7e-04
3bzjA [x.x.x] UV ENDONUCLEASE                                          33   8e-04
1a0dA [c.1.15] XYLOSE ISOMERASE                                        33   8e-04

>3c0lA [x.x.x] UV ENDONUCLEASE
          Length = 277

 Score = 49.7 bits (118), Expect = 1e-08
 Identities = 20/232 (8%), Positives = 44/232 (18%), Gaps = 47/232 (20%)

Query: 41  PMNEENTAALERGISELGIEVGALSVAFGPS-----------AAPGVDSLENDFDKIVAD 89
             +       E    E    +GAL+ AFG              +P  + +E    ++   
Sbjct: 67  ASHPLFPYDWEGAYEEELARLGALARAFGQRLSMHPGQYVNPGSPDPEVVERSLAELRYS 126

Query: 90  CKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNHHVDLHKFGN 149
            + L +     G++      +         +              L   N       +  
Sbjct: 127 ARLLSLIGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALENDE---RLWNV 183

Query: 150 ERIFDIVRRVAPSLFFEVDLHWVQRGG-----MAPLDMLKEYAGVCKLIHVKDFRVTELP 204
           E +          +   VD                L +          +H+         
Sbjct: 184 EEVLKAAEA--LGVPVVVDTLHHALNPGRLPLEEALRLAFPTWRGRPRVHLASQDP---- 237

Query: 205 EEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFI 256
                                  +        +   +      A       +
Sbjct: 238 ----------------------KKRPGAHAFRVTREDWERLLSALPGPADVM 267


>3dx5A [x.x.x] UNCHARACTERIZED PROTEIN ASBF
          Length = 267

 Score = 48.1 bits (113), Expect = 3e-08
 Identities = 24/239 (10%), Positives = 67/239 (28%), Gaps = 17/239 (7%)

Query: 24  LEKLKELNIASVEVS-----QIPMNEENTAALERGISELGIEVGALSVAFGPSAAPGVDS 78
           ++   E     +E+       +    E T      + +  +E+         S +   + 
Sbjct: 20  VQFAYENGFEGIELWGTHAQNLYQEYETTERELNCLKDKTLEITISD-YLDISLSADFEK 78

Query: 79  LENDFDKIVADCKRLGVKYTRIGMM-PFQAMTSKEATETWAAQVEPYAARLAVEGITLCY 137
                +++            R        A  S++  + +  ++           + L  
Sbjct: 79  TIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRICELFAQHNYVLLET 138

Query: 138 HNHHVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKD 197
           H + +         +   V    P+L   +D   +   G  P+D  ++     +  H K+
Sbjct: 139 HPNTLTDTLPSTLELLGEVD--HPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKN 196

Query: 198 FRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFI 256
                   + + +F   +                + +G +N+ E++   +         
Sbjct: 197 ISS----ADYLHVFEPNNVYAAAGNRT----GVPLFEGIVNYDEIIQEVRDTDHFASLE 247


>3bzgA [x.x.x] UV ENDONUCLEASE
          Length = 277

 Score = 45.0 bits (106), Expect = 3e-07
 Identities = 20/232 (8%), Positives = 44/232 (18%), Gaps = 47/232 (20%)

Query: 41  PMNEENTAALERGISELGIEVGALSVAFGPS-----------AAPGVDSLENDFDKIVAD 89
             +       E    E    +GAL+ AFG              +P  + +E    ++   
Sbjct: 67  ASHPLFPYDWEGAYEEELARLGALARAFGQRLSMHPGQYVNPGSPDPEVVERSLAELRYS 126

Query: 90  CKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNHHVDLHKFGN 149
            + L +     G++      +         +              L   N       +  
Sbjct: 127 ARLLSLLGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALENDE---RLWNV 183

Query: 150 ERIFDIVRRVAPSLFFEVDLHWVQRGG-----MAPLDMLKEYAGVCKLIHVKDFRVTELP 204
           E +          +   VD                L +          +H+         
Sbjct: 184 EEVLKAAEA--LGVPVVVDTLHHALNPGRLPLEEALRLAFPTWRGRPKVHLASQDP---- 237

Query: 205 EEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFI 256
                                  +        +   +      A       +
Sbjct: 238 ----------------------KKRPGAHAFRVTREDWERLLSALPGPADVM 267


>3cqjA [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
          Length = 276

 Score = 44.9 bits (105), Expect = 3e-07
 Identities = 24/198 (12%), Positives = 55/198 (27%), Gaps = 26/198 (13%)

Query: 82  DFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVE-GITLCYHNH 140
              K +   + +G++  ++         +   T          +  +A    +TL     
Sbjct: 94  IMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIM 153

Query: 141 HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRV 200
              L    ++ +        P      D+  +          L+   G    +HVKD + 
Sbjct: 154 DYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKP 213

Query: 201 TELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAE-YFFIEQD 259
                                      +    G+G +++       K +G    + IE  
Sbjct: 214 GV------------------------FKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMW 249

Query: 260 MTYGRDPFDCIKDSREYL 277
                DP   +  +R+++
Sbjct: 250 SETAEDPAAEVAKARDWV 267


>3cqiB [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
          Length = 273

 Score = 41.9 bits (97), Expect = 2e-06
 Identities = 41/292 (14%), Positives = 84/292 (28%), Gaps = 50/292 (17%)

Query: 4   IGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPM---------NEENTAALERGI 54
           +G+    L     E      L+  K L    VE+S             + E   AL   I
Sbjct: 4   LGIYEKALPACWLER-----LQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAI 58

Query: 55  SELGIEVGALSVAFGPSAAPG------VDSLENDFDKIVADCKRLGVKYTRI--GMMPFQ 106
            E G+ V ++ ++       G               K +   + +G++  ++    + +Q
Sbjct: 59  VETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQ 118

Query: 107 AMTSKEATETWAAQVEPYAARLAVEGITLCYHNHHVDLHKFGNERIFDIVRRVAPSLFFE 166
                E    +   ++      +   +TL        L    ++ +        P     
Sbjct: 119 EAN-NETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLY 177

Query: 167 VDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNI 226
            D+  +          L+   G    +HVKD +                           
Sbjct: 178 PDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTK------------------------PFK 213

Query: 227 VEFAEVGQGNMNWPELLPASKAAGAE-YFFIEQDMTYGRDPFDCIKDSREYL 277
                 G+G +++       K +G    + IE       DP   +  +R+++
Sbjct: 214 NVP--FGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWV 263


>3cqiA [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
          Length = 277

 Score = 39.1 bits (90), Expect = 2e-05
 Identities = 24/197 (12%), Positives = 57/197 (28%), Gaps = 26/197 (13%)

Query: 83  FDKIVADCKRLGVKYTRI-GMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNHH 141
             K +   + +G++  ++ G   +    + E    +   ++      +   +TL      
Sbjct: 96  MRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMD 155

Query: 142 VDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVT 201
             L    ++ +        P      D+  +          L+   G    +HVKD +  
Sbjct: 156 YPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPG 215

Query: 202 ELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAE-YFFIEQDM 260
                                          G+G +++       K +G    + IE   
Sbjct: 216 V----------------------FKNVP--FGEGVVDFERCFETLKQSGYCGPYLIEMWS 251

Query: 261 TYGRDPFDCIKDSREYL 277
               DP   +  +R+++
Sbjct: 252 ETAEDPAAEVAKARDWV 268


>3cqjB [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
          Length = 275

 Score = 37.6 bits (86), Expect = 4e-05
 Identities = 42/292 (14%), Positives = 86/292 (29%), Gaps = 47/292 (16%)

Query: 4   IGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVS---------QIPMNEENTAALERGI 54
           +G+    L            L+  K L    VE+S         ++  + E   AL   I
Sbjct: 4   LGIYEKAL----PAGCWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAI 59

Query: 55  SELGIEVGALSV-------AFGPSAAPGVDSLENDFDKIVADCKRLGVKYTRI-GMMPFQ 106
            E G+ V ++ +             A     LE    K +   + +G++  ++ G   + 
Sbjct: 60  VETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEI-MRKAIQFAQDVGIRVIQLAGYDVYY 118

Query: 107 AMTSKEATETWAAQVEPYAARLAVEGITLCYHNHHVDLHKFGNERIFDIVRRVAPSLFFE 166
              + E    +   ++      +   +TL        L    ++ +        P     
Sbjct: 119 QEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLY 178

Query: 167 VDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNI 226
            D+  +          L+   G    +HVKD +                           
Sbjct: 179 PDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGV----------------------FK 216

Query: 227 VEFAEVGQGNMNWPELLPASKAAGAE-YFFIEQDMTYGRDPFDCIKDSREYL 277
                 G+G +++       K +G    + IE       DP   +  +R+++
Sbjct: 217 NVP--FGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWV 266


>1a0cA [c.1.15] XYLOSE ISOMERASE
          Length = 437

 Score = 35.7 bits (81), Expect = 2e-04
 Identities = 23/245 (9%), Positives = 56/245 (22%), Gaps = 27/245 (11%)

Query: 41  PMNEENTAALERGISELGIEVGALSVAFGPSAAPGVDSLENDFD------------KIVA 88
              +   A ++  +     +V   + A   S    V       +            K + 
Sbjct: 116 KNLDTIVAMIKDYLKTSKTKVLWGT-ANLFSNPRFVHGASTSCNADVFAYSAAQVKKALE 174

Query: 89  DCKRLGVKYT-----RIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNHHVD 143
             K LG +       R G         +   + +A  +          G    +      
Sbjct: 175 ITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKP 234

Query: 144 LHKFGN------ERIFDIVRRVAPSLFFEVDLHWVQ--RGGMAPLDMLKEYAGVCKLIHV 195
                +        +   +R+     +F+V++               L+       L  +
Sbjct: 235 KEPTKHQYDFDVANVLAFLRKYDLDKYFKVNIEANHATLAFHDFQHELRYARINGVLGSI 294

Query: 196 KDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFF 255
                  L           D          +++     +G +N+   +  +     + F 
Sbjct: 295 DANTGDMLLGW-DTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFL 353

Query: 256 IEQDM 260
                
Sbjct: 354 GHIAG 358


>1dxiA [c.1.15] D-XYLOSE ISOMERASE
          Length = 388

 Score = 33.7 bits (76), Expect = 7e-04
 Identities = 20/213 (9%), Positives = 47/213 (22%), Gaps = 34/213 (15%)

Query: 82  DFDKIVADCKRLGVKYTRIGMMPFQAMTS-----KEATETWAAQVEPYAARLAVEGIT-- 134
                +     LG K          A +      ++A +      +     +  +G    
Sbjct: 118 KTIGNIDLAAELGAKTYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTAQGYDLR 177

Query: 135 LCYHNHHV----DLHKFGNERIFDIVRRVAPSLFFEV--DLHWVQRGGMAPLDMLKEYAG 188
                       D+           + R+     + V  ++   Q  G+     + +   
Sbjct: 178 FAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALW 237

Query: 189 VCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKA 248
             KL H+     + +  +    F                              L+   + 
Sbjct: 238 AGKLFHIDLNGQSGIKYDQDLRF--------------------GAGDLRAAFWLVDLLET 277

Query: 249 AGAE-YFFIEQDMTYGRDPFDCIKDSREYLTSI 280
           AG E     +       D       +   + + 
Sbjct: 278 AGYEGPRHFDFKPPRTEDFDGVWASAAGCMRNY 310


>3bzjA [x.x.x] UV ENDONUCLEASE
          Length = 278

 Score = 33.5 bits (76), Expect = 8e-04
 Identities = 11/179 (6%), Positives = 31/179 (17%), Gaps = 35/179 (19%)

Query: 81  NDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH 140
            +          LG +      +      +         +              L   N 
Sbjct: 121 AELRYSARLLSLLGAEDGV---LVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALEND 177

Query: 141 HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKE---YAGVCKLIHVKD 197
                 +  E +      +   +  +   H +  G +   + L+          L+H+  
Sbjct: 178 E---RLWNVEEVLKAAEALGVPVVVDTLHHALNPGRLPLEEALRLAFPTWRGRPLVHLAS 234

Query: 198 FRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFI 256
                                         +        +   +      A       +
Sbjct: 235 QDPK--------------------------KRPGAHAFRVTREDWERLLSALPGPADVM 267


>1a0dA [c.1.15] XYLOSE ISOMERASE
          Length = 437

 Score = 33.4 bits (75), Expect = 8e-04
 Identities = 14/165 (8%), Positives = 37/165 (22%), Gaps = 7/165 (4%)

Query: 75  GVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGIT 134
           G ++      +   +          +  +      + +  +      +        E   
Sbjct: 178 GAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTK 237

Query: 135 LCYHNHHVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIH 194
             Y         F           +     F ++ +     G      L+       L  
Sbjct: 238 HQYDFDVATALAFLQTY------GLKDYFKFNIEANHATLAGHTFEHELRVARIHGMLGS 291

Query: 195 VKDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNW 239
           V   +   +           D          I++   +G+G +N+
Sbjct: 292 VDANQGD-MLLGWDTDEFPTDLYSTTLAMYEILKNGGLGRGGLNF 335


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.130    0.350 

Gapped
Lambda     K      H
   0.267   0.0557    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,157,051
Number of extensions: 1635506
Number of successful extensions: 19138
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8234
Number of HSP's successfully gapped: 693
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)