RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAF53422.1 cglu2 BAF53422.1 GIB00498CH01 "hypothetical protein"
         (100 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02583 DUF156 "Uncharacterised BCR, COG1937"                          74   1e-16

>PF02583 DUF156 "Uncharacterised BCR, COG1937"
          Length = 84

 Score = 73.9 bits (181), Expect = 1e-16
 Identities = 46/79 (58%), Positives = 60/79 (75%), Gaps = 2/79 (2%)

Query: 12 IEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAHC 71
          IEEK++ L RLKRIEGQ RGI RMI+E++YCIDILTQI+AV SAL      +L++HL HC
Sbjct: 1  IEEKKKLLNRLKRIEGQVRGIERMIEEDRYCIDILTQIAAVRSALDRAGKEVLEEHLRHC 60

Query: 72 VKEAADLGGDELDAKLKEV 90
          V EA + G  E + K++E+
Sbjct: 61 VVEAIESG--EREEKIEEL 77


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0517    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,220,012
Number of extensions: 731805
Number of successful extensions: 121480
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1840
Number of HSP's successfully gapped: 251
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)