RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAF54487.1 cglu2 BAF54487.1 GIB00498CH01 "hypothetical protein"
         (268 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02535 Zip "ZIP Zinc transporter"                                     81   2e-18

>PF02535 Zip "ZIP Zinc transporter"
          Length = 299

 Score = 81.2 bits (200), Expect = 2e-18
 Identities = 59/144 (40%), Positives = 81/144 (56%), Gaps = 5/144 (3%)

Query: 124 MGVLTALAIAIHNFPEGFATFLAGLSDPTXXXXXXXXXXXHNIPEGIAVAVPLREATGSR 183
           +G+L  L I++HNFPEG A   +  + PT           HNIPEG A+  PL +A  S+
Sbjct: 157 IGLLLLLGISLHNFPEGLALGASFSASPTLGLSLFIAIFIHNIPEGFALGAPLLQAGFSK 216

Query: 184 RKALGWATLSGLAEPAGALIGFLLLMPFIGPEAL--GLCFAAVAGVMVFISVDELLPTAI 241
           RKAL  A L GL+ P GA +G LL+    G   L  G+  A  AG  +++++ ELLP A+
Sbjct: 217 RKALLLALLFGLSAPLGAALG-LLINGSSGTSLLVTGILLAFAAGTFLYVALVELLPEAL 275

Query: 242 SSG--KHHTAIYGLIAGMAVMAIS 263
            SG  K   A  GL+ G  +MA+S
Sbjct: 276 ESGHSKRLLAFLGLLLGFGLMALS 299


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.318    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0517    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,767,723
Number of extensions: 736933
Number of successful extensions: 112310
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2034
Number of HSP's successfully gapped: 259
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)