RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAF53744.1 cglu2 BAF53744.1 GIB00498CH01 "hypothetical protein"
         (106 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2imhA1 [d.153.1.7] HYPOTHETICAL PROTEIN UNP Q5LQD5_SILPO A:1 -- 229    42   9e-07

>2imhA1 [d.153.1.7] HYPOTHETICAL PROTEIN UNP Q5LQD5_SILPO A:1 -- 229
          Length = 225

 Score = 41.7 bits (98), Expect = 9e-07
 Identities = 20/90 (22%), Positives = 28/90 (31%), Gaps = 8/90 (8%)

Query: 2   LKDPVVIEKMIQAFESSEGELETRXXXXXXXXXXXXXXXXPVHSAGIAVARSSGWAETDL 61
           L D  V+    +AF +S+   E R                    +   +          L
Sbjct: 120 LGDNSVLGAXTEAFVASDLTFERRLLAALIAAEGAGGLL-----SAAXLVLHPDRPPVTL 174

Query: 62  RIDW-SDQPIEDLSKLLQEWLIQRDDYVIR 90
           RID+  D PI  L +L Q       DY   
Sbjct: 175 RIDYHPDNPIGALEQLYQ--KATTGDYADW 202


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0424    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 18,312,481
Number of extensions: 1324086
Number of successful extensions: 5583
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5389
Number of HSP's successfully gapped: 244
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)