RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAF54269.1 cglu2 BAF54269.1 GIB00498CH01 "hypothetical protein"
         (325 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1e79G [c.49.2.1] ATP SYNTHASE GAMMA CHAIN                             198   7e-54
1fs0G [c.49.2.1] ATP SYNTHASE GAMMA SUBUNIT                           188   1e-50
1w0jG [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL              164   1e-43
1bmfG [c.49.2.1] BOVINE MITOCHONDRIAL F1-ATPASE                       127   2e-32
1ohhG [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL              107   1e-26
1t0hB [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A          64   3e-13
2pk8A1 [d.274.1.1] UNCHARACTERIZED PROTEIN PF0899 A:2 -- 95            51   2e-09

>1e79G [c.49.2.1] ATP SYNTHASE GAMMA CHAIN
          Length = 263

 Score =  198 bits (505), Expect = 7e-54
 Identities = 52/319 (16%), Positives = 114/319 (35%), Gaps = 58/319 (18%)

Query: 2   ATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASS 61
           AT++++  R++S+ + +KITK+ +++A ++  +A+  +  A  Y                
Sbjct: 1   ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVG------------- 47

Query: 62  LDHPMLREREGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKK 121
               +  + +      ++ V+SDRG+ G  + +V             +  EV     G K
Sbjct: 48  -SLALYEKADIKTPELIIGVSSDRGLCGAIHSSVAKQMKSEAA----NLKEVKIIGVGDK 102

Query: 122 GVDYYK--FRAEDVAGAWTGFSQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEG 179
                      + +        + P +     +   L++                     
Sbjct: 103 IRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYE----------------- 145

Query: 180 QDIQGFDQVHVVYTEFISMLTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEF 239
                FD+  +++  F S+++       +  ++ +   E                    +
Sbjct: 146 -----FDEGSIIFNRFRSVISYKTEEKPIFSLDTISSAE----------------SMSIY 184

Query: 240 EPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKSATDNASELVKDLSRVANQA 299
           +     +L       ++  ++                AM +A+ NASE++  L+   N+ 
Sbjct: 185 DDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRT 244

Query: 300 RQAQITQEITEIVGGAGAL 318
           RQA IT+E+ EI+ GA AL
Sbjct: 245 RQAVITKELIEIISGAAAL 263


>1fs0G [c.49.2.1] ATP SYNTHASE GAMMA SUBUNIT
          Length = 219

 Score =  188 bits (478), Expect = 1e-50
 Identities = 70/261 (26%), Positives = 115/261 (44%), Gaps = 42/261 (16%)

Query: 19  KITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLREREGGKRAAV 78
           KITKA E++A S++ K+Q R+AA+ PYAE +++V+  LA      HP L +R+  KR   
Sbjct: 1   KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYK---HPYLEDRDV-KRVGY 56

Query: 79  LVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWT 138
           LVV++DRG+ GG N N+              G +    + G KGV ++     +V    T
Sbjct: 57  LVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT 116

Query: 139 GFSQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISM 198
           G   +P  +      + ++  +                    D    D++++V  +FI+ 
Sbjct: 117 GMGDNPSLSELIGPVKVMLQAY--------------------DEGRLDKLYIVSNKFINT 156

Query: 199 LTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRR 258
           ++Q P + QLLP+                        DY +EPD   LL+ LL +YV  +
Sbjct: 157 MSQVPTISQLLPLPKHK------------------SWDYLYEPDPKALLDTLLRRYVESQ 198

Query: 259 LFSIFLXXXXXXXXXXXNAMK 279
           ++   +            AMK
Sbjct: 199 VYQGVVENLASEQAARMVAMK 219


>1w0jG [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
          Length = 192

 Score =  164 bits (417), Expect = 1e-43
 Identities = 48/317 (15%), Positives = 98/317 (30%), Gaps = 125/317 (39%)

Query: 2   ATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASS 61
           AT++++  R++S+ + +KITK+ +++A ++  +A+  +  A  Y                
Sbjct: 1   ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY---------------- 44

Query: 62  LDHPMLREREGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKK 121
                           ++ V+SDRG+ G  + +V                ++     G K
Sbjct: 45  ------------GVGLIIGVSSDRGLCGAIHSSVAK--------------QMKIIGVGDK 78

Query: 122 GVDYYKFRAEDVAGAWTGFSQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQD 181
                 F+            + P                                 +   
Sbjct: 79  IRSILTFK---------EVGRRP-----------------------------PTFGDASV 100

Query: 182 IQGFDQVHVVYTEFISMLTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEFEP 241
           I    ++ +++  F S+++                                         
Sbjct: 101 I--ALELSIIFNRFRSVISYKT-------------------------------------- 120

Query: 242 DADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKSATDNASELVKDLSRVANQARQ 301
                L       ++  ++                AM +A+ NASE++  L+   N+ RQ
Sbjct: 121 -----LRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQ 175

Query: 302 AQITQEITEIVGGAGAL 318
           A IT+E+ EI+ GA AL
Sbjct: 176 AVITKELIEIISGAAAL 192


>1bmfG [c.49.2.1] BOVINE MITOCHONDRIAL F1-ATPASE
          Length = 122

 Score =  127 bits (320), Expect = 2e-32
 Identities = 23/133 (17%), Positives = 44/133 (33%), Gaps = 15/133 (11%)

Query: 188 VHVVYT--EFISMLTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADT 245
           +  +    + I  + +     +++           E                        
Sbjct: 3   LKDITRRLKSIKNIQKITKSMKMVAAAKY-ARAEREL------------KPARVYLCGAI 49

Query: 246 LLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKSATDNASELVKDLSRVANQARQAQIT 305
                    ++  ++                AM +A+ NASE++  L+   N+ RQA IT
Sbjct: 50  HSSVAKQMKLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVIT 109

Query: 306 QEITEIVGGAGAL 318
           +E+ EI+ GA AL
Sbjct: 110 KELIEIISGAAAL 122


>1ohhG [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
          Length = 94

 Score =  107 bits (270), Expect = 1e-26
 Identities = 22/85 (25%), Positives = 37/85 (43%)

Query: 234 EPDYEFEPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKSATDNASELVKDLS 293
               +        ++ +    +   + S               AM +A+ NASE++  L+
Sbjct: 10  LKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDNASKNASEMIDKLT 69

Query: 294 RVANQARQAQITQEITEIVGGAGAL 318
              N+ RQA IT+E+ EI+ GA AL
Sbjct: 70  LTFNRTRQAVITKELIEIISGAAAL 94


>1t0hB [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
          Length = 187

 Score = 63.6 bits (154), Expect = 3e-13
 Identities = 13/94 (13%), Positives = 29/94 (30%), Gaps = 2/94 (2%)

Query: 4   IRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLD 63
                 RI     T  I+ A+ +I  S    +   V +      E+ R L+ +   +   
Sbjct: 42  KHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTI 101

Query: 64  HP--MLREREGGKRAAVLVVTSDRGMAGGYNHNV 95
           +    L +         + ++S + +        
Sbjct: 102 NHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRH 135


>2pk8A1 [d.274.1.1] UNCHARACTERIZED PROTEIN PF0899 A:2 -- 95
          Length = 94

 Score = 51.0 bits (122), Expect = 2e-09
 Identities = 5/104 (4%), Positives = 22/104 (21%), Gaps = 12/104 (11%)

Query: 88  AGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGFSQDPDWA 147
             G    +              G+     + G++  ++     +        F+   +  
Sbjct: 2   TRGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPFTHVSN-- 59

Query: 148 ATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVV 191
                   +        +         +   G       ++ ++
Sbjct: 60  ------IKIEILEELGGDAVVI----DSKVLGLVPGAAKRIKII 93


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0676    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,125,035
Number of extensions: 778017
Number of successful extensions: 2804
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 2736
Number of HSP's successfully gapped: 53
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)