RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAF55454.1 cglu2 BAF55454.1 GIB00498CH01 "hypothetical protein"
         (335 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o89A2 [c.2.1.1] YHDH A:116 -- 292                                    110   2e-27
1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A...    71   1e-15
1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294                       70   4e-15
1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323                         67   3e-14
1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294                   66   8e-14
1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326                    62   1e-12
2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185                     58   1e-11
1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339              57   2e-11
1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309                    57   4e-11
1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 -...    57   4e-11
1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269                    55   1e-10
1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312       55   2e-10
1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A...    49   7e-09
1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302        49   8e-09
1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383                         49   1e-08
1pqwA [c.2.1.1] POLYKETIDE SYNTHASE                                    47   2e-08
1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --...    46   6e-08
1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE- A...    46   7e-08
1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A...    45   1e-07
1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329           45   2e-07
1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --...    45   2e-07
1o8cA2 [c.2.1.1] YHDH A:116 -- 192                                     45   2e-07
1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --...    44   3e-07
1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313     43   5e-07
1gv8A [c.94.1.2] OVOTRANSFERRIN                                        41   3e-06
1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 13...    38   2e-05
1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 ...    36   9e-05
1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1            36   9e-05
1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 -...    35   1e-04
1ujmA [c.2.1.2] ALDEHYDE REDUCTASE II                                  34   3e-04
1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- ...    34   3e-04
1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355               34   4e-04
1snyA [c.2.1.2] SNIFFER CG10964-PA                                     33   4e-04
2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915           33   4e-04
1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 -...    33   4e-04
2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11...    33   5e-04
2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336         33   5e-04
1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1                   33   7e-04
2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236              32   8e-04
1bxkA [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)                 32   8e-04
1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327       32   8e-04
1xq6A [c.2.1.2] UNKNOWN PROTEIN                                        32   8e-04
2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:...    32   8e-04

>1o89A2 [c.2.1.1] YHDH A:116 -- 292
          Length = 177

 Score =  110 bits (277), Expect = 2e-27
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 2/159 (1%)

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGAS 203
           V AL D G++P+DGEI+VTG++GGVGS A+ LL+KLGY  VAV+GR E+  EYL SLGAS
Sbjct: 20  VMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSGR-ESTHEYLKSLGAS 78

Query: 204 DIIDRAELSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTV 263
            ++ R E   + RPL+K  WAG +D+VG   L   +AQ  +GG V ACG+A G  LP TV
Sbjct: 79  RVLPRDE-FAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTV 137

Query: 264 LPFILRGVHLVGINSVDAPRELRRRAWALLSEHLDTAVL 302
           +PFILR V L G++SV  P E R +AW  L   L  +  
Sbjct: 138 MPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFY 176


>1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
           -- 250
          Length = 228

 Score = 71.4 bits (174), Expect = 1e-15
 Identities = 13/191 (6%), Positives = 34/191 (17%), Gaps = 8/191 (4%)

Query: 67  PLIPGIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFS 126
              P  ++   +      ++           G   +   G+         P         
Sbjct: 27  RTTPATELDAWL-----AKYPPSQVTRYGDPGSPNSEPVGWIAVYGQGYSPNSGDVQGLQ 81

Query: 127 AQQVXXXXXXXXXXXXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAV 186
           A               ++  L           +        +      +   +    + V
Sbjct: 82  AAWEALQTSGRPITPGTLRQLAITHHVLSGKWLXHLAPGFKLDHAWAGIARAVVEGRLQV 141

Query: 187 TGRREAHAEYLTSLGASDIIDRAELSEKGRPLQKGRWAGV---VDSVGSHTLVNAIAQTK 243
                   E    +      D  +           R AG+   +           I +  
Sbjct: 142 AKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTYLGIYRAN 201

Query: 244 WGGIVTACGMA 254
              +      +
Sbjct: 202 RWHLCPTLYES 212


>1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
          Length = 182

 Score = 70.1 bits (171), Expect = 4e-15
 Identities = 28/164 (17%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGAS 203
              L++         +LV+ + G VGS+   +    G   V      +    YL  +G  
Sbjct: 18  YFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAA-GSDEKIAYLKQIGFD 76

Query: 204 DIIDRAE---LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPD-- 258
              +      L E  +      +    D+VG   L   ++Q K  G +  CG     +  
Sbjct: 77  AAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRM 136

Query: 259 ----LPGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSEHLD 298
                  +    I + + + G        ++R +A   L + + 
Sbjct: 137 DQLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVL 180


>1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
          Length = 143

 Score = 67.1 bits (163), Expect = 3e-14
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVV 93
           L EGDV ++V WSSLNYKDA+A+ G   ++R  P+IPGID  GTV  S DPRF  G EV+
Sbjct: 22  LPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVRTSEDPRFHAGQEVL 81

Query: 94  LNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQV 130
           L G G+GEN  GG  ++ +V  + L+ +P   +A+++
Sbjct: 82  LTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEI 118


>1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
          Length = 174

 Score = 65.5 bits (159), Expect = 8e-14
 Identities = 24/156 (15%), Positives = 62/156 (39%), Gaps = 6/156 (3%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
           AL+          +LV G++GGVG  A  +  +     +  T   E   + +   GA ++
Sbjct: 19  ALIHSACVKAGESVLVHGASGGVGLAACQIA-RAYGLKILGTAGTEEGQKIVLQNGAHEV 77

Query: 206 IDRAELS---EKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGT 262
            +  E++   +  + + +     +++ + +  L   ++    GG V   G     ++   
Sbjct: 78  FNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN-- 135

Query: 263 VLPFILRGVHLVGINSVDAPRELRRRAWALLSEHLD 298
               + +   ++G+    + +E  ++  A L   ++
Sbjct: 136 PRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGME 171


>1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
          Length = 172

 Score = 62.0 bits (150), Expect = 1e-12
 Identities = 29/154 (18%), Positives = 47/154 (30%), Gaps = 7/154 (4%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
           A+         G  +     GG+G IA+ LL  +   TV     +E   +    LGA  +
Sbjct: 22  AVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHV 81

Query: 206 IDRAE--LSEKGRPLQKGRWAGVVDSVGS-HTLVNAIAQTKWGGIVTACGMAQGPDLPGT 262
           +D     + +     +       +D VGS  T+          G +   G       P  
Sbjct: 82  VDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFP-- 139

Query: 263 VLPFILRGVHLVGINSVDAPRELRRRAWALLSEH 296
            +  I   V   G  S+            L  + 
Sbjct: 140 TIRVISSEVSFEG--SLVGNYVELHELVTLALQG 171


>2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
          Length = 181

 Score = 58.2 bits (140), Expect = 1e-11
 Identities = 16/143 (11%), Positives = 30/143 (20%), Gaps = 8/143 (5%)

Query: 48  LNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGF 107
           +N  +   L      ++  P I       T         G            G       
Sbjct: 4   VNGVNVDQLXATIEQIKAKPEIAQFKFRATNQ-----WXGGTHNQATIKDFYGAXAEDDT 58

Query: 108 TQRLKVPSEPLLHIPFN---FSAQQVXXXXXXXXXXXXSVNALVDQGIKPEDGEILVTGS 164
            +      +    +       +  +              V     +GI     +    G 
Sbjct: 59  RKPXVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGD 118

Query: 165 TGGVGSIALHLLNKLGYTTVAVT 187
               G + L     +GY  + V 
Sbjct: 119 IDLRGFLGLSEEVPVGYREIRVF 141


>1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
          Length = 176

 Score = 57.5 bits (138), Expect = 2e-11
 Identities = 17/159 (10%), Positives = 40/159 (25%), Gaps = 10/159 (6%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
           + V      +     V G  G   S+ +          + V   ++        +GA++ 
Sbjct: 19  SAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKD-KFAKAKEVGATEC 77

Query: 206 IDRAELSEKGRPLQKGRWAGVVD------SVGSHTLVNAIAQTKWGGIVTACGMAQGPDL 259
           ++  +  +  + +      G VD            +       +  G+    G+      
Sbjct: 78  VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQN 137

Query: 260 PGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSEHLD 298
                  +L G    G           + +   L     
Sbjct: 138 LSMNPMLLLSGRTWKGAIFGGFK---SKDSVPKLVADFM 173


>1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
          Length = 166

 Score = 56.7 bits (136), Expect = 4e-11
 Identities = 33/152 (21%), Positives = 58/152 (38%), Gaps = 8/152 (5%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
            L     +P    + ++G  GG+G +A+     +G    A+        E    LGAS  
Sbjct: 19  GLKQTNARPGQW-VAISG-IGGLGHVAVQYARAMGLHVAAIDIDDA-KLELARKLGASLT 75

Query: 206 IDRAELSEKGRPLQKGRWAGVV--DSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTV 263
           ++  +        +    A  V   +V +     AI   + GG +   G+  G D P  +
Sbjct: 76  VNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPG-DFPTPI 134

Query: 264 LPFILRGVHLVGINSVDAPRELRRRAWALLSE 295
              +L+G+H+ G  S+   R   + A     E
Sbjct: 135 FDVVLKGLHIAG--SIVGTRADLQEALDFAGE 164


>1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
           124 A:312 -- 351
          Length = 166

 Score = 56.6 bits (136), Expect = 4e-11
 Identities = 22/155 (14%), Positives = 38/155 (24%), Gaps = 25/155 (16%)

Query: 30  DPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDV----VGTVIESADPR 85
               L EG V +   + S++         D G     P           +G V ES   +
Sbjct: 32  LLDALNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAQVADGGGIGIVEESKHQK 91

Query: 86  FGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXXXXSVN 145
             +GD V                   KV  + +  +                        
Sbjct: 92  LAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGLKV---------------------K 130

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLG 180
             V +G++          + G VG   + +     
Sbjct: 131 ETVAKGLENXGVAFQSXXTGGNVGKQIVCISEDSS 165


>1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
          Length = 168

 Score = 55.0 bits (132), Expect = 1e-10
 Identities = 31/155 (20%), Positives = 57/155 (36%), Gaps = 10/155 (6%)

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGAS 203
             AL     +P + ++LV  + G +G+ A+ +   +G   +A   R E  A  L +LGA 
Sbjct: 17  YLALKRAQARPGE-KVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPL-ALGAE 74

Query: 204 DIIDRAELSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTV 263
           +    AE+ E+    +      +V  V    +  ++     GG +   G     + P   
Sbjct: 75  EAATYAEVPER---AKAWGGLDLVLEVRGKEVEESLGLLAHGGRLVYIGA---AEAPIPP 128

Query: 264 LPFILRGVHLVGINSVDAPRELRRRAWALLSEHLD 298
           L  + R + ++G      P              L 
Sbjct: 129 LRLMRRNLAVLG--FWLTPLLREGALVEEALGFLL 161


>1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
          Length = 170

 Score = 54.6 bits (131), Expect = 2e-10
 Identities = 23/159 (14%), Positives = 47/159 (29%), Gaps = 15/159 (9%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
           A    G++   G  ++    G +G +++      G   V  T R     E   + GA   
Sbjct: 18  ACRRAGVQL--GTTVLVIGAGPIGLVSVLAAKAYGAF-VVCTARSPRRLEVAKNCGADVT 74

Query: 206 IDRAELS-------EKGRPLQKGRWAGVVDSVGSHTLVN-AIAQTKWGGIVTACGMAQGP 257
           +             E+ R          +D  G+   +   I  T+ GG +         
Sbjct: 75  LVVDPAKEEESSIIERIRSAIGDLPNVTIDCSGNEKCITIGINITRTGGTLM-LVGMGSQ 133

Query: 258 DLPGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSEH 296
            +   ++    R + +     V         A  +++  
Sbjct: 134 MVTVPLVNACAREIDIKS---VFRYCNDYPIALEMVASG 169


>1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
           -- 127
          Length = 127

 Score = 49.3 bits (117), Expect = 7e-09
 Identities = 18/122 (14%), Positives = 38/122 (31%), Gaps = 12/122 (9%)

Query: 153 KPEDGE-ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAEL 211
           K  D + IL+ G+ G +        +  G                + S  A+ + D    
Sbjct: 3   KRTDIKSILILGA-GPIVIGQACEFDYSGAQACKALREEGYRVINVNSNPATIMTDPEMA 61

Query: 212 SEKGRP----------LQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPG 261
                           ++K R   V+ ++G  T +N   + +  G++   G+        
Sbjct: 62  DATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATAD 121

Query: 262 TV 263
            +
Sbjct: 122 AI 123


>1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
          Length = 131

 Score = 49.0 bits (117), Expect = 8e-09
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 15/88 (17%)

Query: 35  GEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVVL 94
            EG+V++ V    LN+ D +   G        P IPG++VVG V          G     
Sbjct: 24  EEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEVVGVV---------EGRRY-- 72

Query: 95  NGAGLGENRHGGFTQRLKVPSEPLLHIP 122
             A +     GG  +R+ VP   LL +P
Sbjct: 73  -AALVP---QGGLAERVAVPKGALLPLP 96


>1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
          Length = 382

 Score = 48.6 bits (115), Expect = 1e-08
 Identities = 16/166 (9%), Positives = 35/166 (21%), Gaps = 19/166 (11%)

Query: 37  GDVLIEVGWSSLNYKDAMA--LKGDKGVV---------RTVPLIPGIDVVGTVIESADP- 84
           G   +E     L   +A        +              +P+  G       +   D  
Sbjct: 17  GFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIPVGDGCSHTLEELGVFDIS 76

Query: 85  -RFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXXXXS 143
                     L+    G         R ++     + +                     +
Sbjct: 77  VPGEMVFPSPLDFFERG---KPTPLVRSRLQLPNGVRVWLKLEWYNPFSLSVKDRP---A 130

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGR 189
           V  +     + E G ++   ++   G     +    GY        
Sbjct: 131 VEIISRLSRRVEKGSLVADATSSNFGVALSAVARLYGYRARVYLPG 176


>1pqwA [c.2.1.1] POLYKETIDE SYNTHASE
          Length = 183

 Score = 47.4 bits (112), Expect = 2e-08
 Identities = 26/164 (15%), Positives = 53/164 (32%), Gaps = 7/164 (4%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDI 205
           +L + G       +L+  +TGGVG  A+ +   +G       G      E L+ LG   +
Sbjct: 16  SLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKR-EMLSRLGVEYV 74

Query: 206 IDRAEL---SEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGT 262
            D   +    E            V++S+    +   +     GG     G          
Sbjct: 75  GDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASL 134

Query: 263 VLPFILRGVHLVGIN---SVDAPRELRRRAWALLSEHLDTAVLD 303
            L  + +      ++   ++       R+    + +H+    L+
Sbjct: 135 GLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLE 178


>1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
           386
          Length = 175

 Score = 46.0 bits (108), Expect = 6e-08
 Identities = 21/151 (13%), Positives = 40/151 (26%), Gaps = 19/151 (12%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGV---------VRTVPLIPGIDVVGTVIESAD- 83
           L   +V+++   S +N  D   ++G                     G + +  VI+    
Sbjct: 31  LAPNEVIVKTLGSPVNPSDINQIQGVYPSKPAKTTGFGTTEPAAPCGNEGLFEVIKVGSN 90

Query: 84  -PRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXXXX 142
                 GD V+ +         G +        +  + +P                    
Sbjct: 91  VSSLEAGDWVIPSHV-----NFGTWRTHALGNDDDFIKLPNPAQ--SKANGKPNGLTDAK 143

Query: 143 SVNALVDQGIKPEDGEILVTGSTGGVGSIAL 173
           S+  L D G KP         +    G   +
Sbjct: 144 SIETLYD-GTKPLHELYQDGVANSKDGKQLI 173


>1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
           A:153 -- 320
          Length = 168

 Score = 45.9 bits (109), Expect = 7e-08
 Identities = 29/145 (20%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 145 NALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASD 204
           + LV  G  P  G+ +     GG+GS+   +   +G  T  ++ R     E    +GA  
Sbjct: 18  SPLVRNGCGP--GKKVGIVGLGGIGSMGTLISKAMGAETYVIS-RSSRKREDAMKMGADH 74

Query: 205 IIDRAELSEKGRPLQKGRWAGVVDSVGSHTLVN---AIAQTKWGGIVTACGMAQGPDLPG 261
            I   E  + G       +  +V    S T ++        K GG + +  + +  ++  
Sbjct: 75  YIATLEEGDWGEKY-FDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEML- 132

Query: 262 TVLPFILRGVHLVGINSVDAPRELR 286
           ++ P+ L+ V +   +++ + +EL 
Sbjct: 133 SLKPYGLKAVSISY-SALGSIKELN 156


>1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
           -- 144 A:313 -- 349
          Length = 178

 Score = 44.8 bits (105), Expect = 1e-07
 Identities = 22/123 (17%), Positives = 40/123 (32%), Gaps = 33/123 (26%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGR--GDE 91
            G  DV IE+ +  + + D   ++ +       P +PG ++VG V+   D       GD 
Sbjct: 23  PGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVY-PCVPGHEIVGRVVAVGDQVEKYAPGDL 81

Query: 92  VVLN------------------------------GAGLGENRHGGFTQRLKVPSEPLLHI 121
           V +                                     +  GG++Q++ V    +L I
Sbjct: 82  VGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRI 141

Query: 122 PFN 124
              
Sbjct: 142 RVA 144


>1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
          Length = 147

 Score = 44.8 bits (105), Expect = 2e-07
 Identities = 20/96 (20%), Positives = 35/96 (36%), Gaps = 11/96 (11%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVV 93
           L  G+VL+E  + S++    +A K      +   ++ G  V   V+ES +  F  G  V+
Sbjct: 32  LKNGEVLLEALFLSVDPYMRIASKRL----KEGAVMMGQQVAR-VVESKNSAFPAGSIVL 86

Query: 94  LNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQ 129
                  ++             E LL    +   Q 
Sbjct: 87  ------AQSGWTTHFISDGKGLEKLLTEWPDKKIQY 116


>1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
           337
          Length = 182

 Score = 44.7 bits (105), Expect = 2e-07
 Identities = 25/164 (15%), Positives = 53/164 (32%), Gaps = 14/164 (8%)

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGAS 203
            +A  +   +   G+ +V    G +G   + +   LG   V V        +    +GA 
Sbjct: 17  YHAFDEYP-ESFAGKTVVIQGAGPLGLFGVVIARSLGAENVIVIAGSPNRLKLAEEIGAD 75

Query: 204 DIID-----RAELSEKGRPLQKGRWAGV-VDSVG-SHTLVNAIAQTKWGGIVTACGMAQG 256
             ++       E  +    +  GR A   +++ G S  L+      + GG  +       
Sbjct: 76  LTLNRRETSVEERRKAIMDITHGRGADFILEATGDSRALLEGSELLRRGGFYS-VAGVAV 134

Query: 257 PDLPGTVLPF---ILRGVHLVGINSVDAPRELRRRAWALLSEHL 297
           P  P     +   +L+     G     +      +  ++ S + 
Sbjct: 135 PQDPVPFKVYEWLVLKNATFKG--IWVSDTSHFVKTVSITSRNY 176


>1o8cA2 [c.2.1.1] YHDH A:116 -- 192
          Length = 77

 Score = 44.5 bits (105), Expect = 2e-07
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 1/59 (1%)

Query: 144 VNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGA 202
           V AL D G++P+DGEI+VTG++GGVGS A+ LL+KLGY  VAV+G RE+  EYL SLGA
Sbjct: 20  VMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSG-RESTHEYLKSLGA 77


>1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
           397
          Length = 201

 Score = 43.7 bits (102), Expect = 3e-07
 Identities = 26/182 (14%), Positives = 44/182 (24%), Gaps = 46/182 (25%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIE--SADPRFGRGDE 91
             E  V+++V  +++   D   ++G       V L+ G ++ G VIE          GD 
Sbjct: 30  KIEHGVILKVVSTNICGSDQHMVRGRTTA--QVGLVLGHEITGEVIEKGRDVENLQIGDL 87

Query: 92  VVLN-------------------------------GAGLGENRHGG--FTQRLKVPSEPL 118
           V +                                G     +  GG      +      L
Sbjct: 88  VSVPFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNL 147

Query: 119 LHIPFNFSAQQVXXXXXXXXXXXXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNK 178
           L +P    A +              V +L D                G      +     
Sbjct: 148 LKLPDRDKAMEK---INIAEVVGVQVISLDDAPRGY-----GEFD-AGVPKKFVIDPHKT 198

Query: 179 LG 180
             
Sbjct: 199 FS 200


>1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
          Length = 174

 Score = 43.1 bits (101), Expect = 5e-07
 Identities = 23/132 (17%), Positives = 46/132 (34%), Gaps = 9/132 (6%)

Query: 151 GIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE 210
            I+     + V G  G VG +A+      G   +   G R    +     GA+DI++  +
Sbjct: 24  DIELGA-TVAVLGI-GPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKD 81

Query: 211 --LSEKGRPLQKGRW--AGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGP---DLPGTV 263
             +  +   L +G+   A ++    +  +  A+   K GG +             +P   
Sbjct: 82  GPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLE 141

Query: 264 LPFILRGVHLVG 275
               +    + G
Sbjct: 142 WGCGMAHKTIKG 153


>1gv8A [c.94.1.2] OVOTRANSFERRIN
          Length = 160

 Score = 40.6 bits (94), Expect = 3e-06
 Identities = 8/162 (4%), Positives = 23/162 (14%), Gaps = 22/162 (13%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIE--SADPRFGRGDE 91
            G   ++ ++   +  +       G          I  +   G +           +   
Sbjct: 10  KGTDFMIKDLRGKTSCHTGLGRSAGWN------IPIGTLIHRGDIEWEGIESGSVEQAVA 63

Query: 92  VVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXXXXSVNALVDQG 151
                               +               +                       
Sbjct: 64  KF------FSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCL---KDGKGD 114

Query: 152 IKPEDGEILVTGSTGGVGSIALHLLNKLG-----YTTVAVTG 188
           +       +   +        L  L+        Y T     
Sbjct: 115 VAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDSYKTCNWAR 156


>1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
           A:314 -- 352
          Length = 178

 Score = 38.1 bits (88), Expect = 2e-05
 Identities = 23/124 (18%), Positives = 36/124 (29%), Gaps = 29/124 (23%)

Query: 35  GEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIE--SADPRFGRGDEV 92
           G  D ++     +    D   +       R   +I G + VG V+E  S    F  GD V
Sbjct: 23  GPFDAIVRPLAVAPCTSDIHTVFEGAIGERH-NMILGHEAVGEVVEVGSEVKDFKPGDRV 81

Query: 93  ------------------------VLNGAGLGENRHGGFTQRLKVPSEP--LLHIPFNFS 126
                                   +L G      + G F +   V      L H+P    
Sbjct: 82  VVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEVD 141

Query: 127 AQQV 130
             ++
Sbjct: 142 PSKL 145


>1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337
          -- 371
          Length = 188

 Score = 35.6 bits (81), Expect = 9e-05
 Identities = 8/47 (17%), Positives = 19/47 (40%), Gaps = 2/47 (4%)

Query: 34 LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIE 80
              +VL++V  + + + D +       V   +P + G +  G +  
Sbjct: 26 PQGDEVLVKVVATGMCHTDLIVRDQKYPV--PLPAVLGHEGSGIIEA 70


>1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
          Length = 307

 Score = 35.6 bits (80), Expect = 9e-05
 Identities = 10/38 (26%), Positives = 16/38 (42%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEY 196
           IL+ G+TG +G         LG+ T  +     A +  
Sbjct: 6   ILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNS 43


>1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
           374
          Length = 198

 Score = 35.2 bits (80), Expect = 1e-04
 Identities = 15/120 (12%), Positives = 28/120 (23%), Gaps = 26/120 (21%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADPRFGR----- 88
               +V I++  + +   D   + G       +P+I G +  G V    +          
Sbjct: 31  PKAHEVRIKMVATGICRSDDHVVSGTLV--TPLPVIAGHEAAGIVESIGEGVTTVRPGDK 88

Query: 89  ------------------GDEVVLNGAGLG-ENRHGGFTQRLKVPSEPLLHIPFNFSAQQ 129
                                  L              T R     +P+ H     +  Q
Sbjct: 89  VIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQ 148


>1ujmA [c.2.1.2] ALDEHYDE REDUCTASE II
          Length = 342

 Score = 33.8 bits (75), Expect = 3e-04
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 146 ALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHA 194
           A +D  + PE   +LVTG+ G V S  +  L + GY  V  T R  +  
Sbjct: 1   AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGY-KVRGTARSASKL 48


>1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 --
          155 A:338 -- 367
          Length = 184

 Score = 33.8 bits (76), Expect = 3e-04
 Identities = 11/45 (24%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 34 LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTV 78
          +  G +L+E+  + +   D    +G+   V   P+I G +  G V
Sbjct: 27 IPRGSILVEILSAGVCGSDVHMFRGEDPRVPL-PIILGHEGAGRV 70


>1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
          Length = 195

 Score = 33.6 bits (76), Expect = 4e-04
 Identities = 22/148 (14%), Positives = 38/148 (25%), Gaps = 21/148 (14%)

Query: 145 NALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASD 204
           +  V  G+ P  G  +     G VG  A      LG   V V     A   +  + G   
Sbjct: 16  HGAVTAGVGP--GSTVYVAGAGPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEI 73

Query: 205 IIDRAE--LSEKGRPLQKGRWAGVV-----------------DSVGSHTLVNAIAQTKWG 245
                +  L E+   L                              +  L + +  T+  
Sbjct: 74  ADLSLDTPLHEQIAALLGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVA 133

Query: 246 GIVTACGMAQGPDLPGTVLPFILRGVHL 273
           G +   G+    D         +  + +
Sbjct: 134 GKIGIPGLYVTEDPGAVDAAAKIGSLSI 161


>1snyA [c.2.1.2] SNIFFER CG10964-PA
          Length = 248

 Score = 33.4 bits (75), Expect = 4e-04
 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 159 ILVTGSTGGVG-SIALHLLN--KLGYTTVAVTGRREAHAE 195
           IL+TG   G+G  +   LLN  +     +  T R    A+
Sbjct: 5   ILITGCNRGLGLGLVKALLNLPQPPQ-HLFTTCRNREQAK 43


>2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
          Length = 259

 Score = 33.3 bits (75), Expect = 4e-04
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%)

Query: 157 GEILVTGSTGGVGS-IALHLLNKLGYTTVAVTGRREAHAE 195
           G +LVTG TGGVG  IA  L  + G     +   R     
Sbjct: 10  GTVLVTGGTGGVGGQIARWLA-RRGA-PHLLLVSRSGPDA 47


>1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
           214
          Length = 128

 Score = 33.3 bits (75), Expect = 4e-04
 Identities = 5/35 (14%), Positives = 12/35 (34%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAH 193
             + G +G +G     + ++ G+  V         
Sbjct: 3   YGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVE 37


>2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
           278
          Length = 267

 Score = 33.2 bits (74), Expect = 5e-04
 Identities = 9/36 (25%), Positives = 16/36 (44%), Gaps = 1/36 (2%)

Query: 160 LVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAE 195
           ++TG  GG+G     L  + G   V +    + H +
Sbjct: 10  IITGGAGGIGETTAKLFVRYGA-KVVIADIADDHGQ 44


>2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
          Length = 144

 Score = 33.0 bits (75), Expect = 5e-04
 Identities = 8/37 (21%), Positives = 16/37 (43%), Gaps = 1/37 (2%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAE 195
           + V G+TG VG   + LL++  +  +       +   
Sbjct: 5   VAVVGATGSVGEALVGLLDERDF-PLHRLHLLASAES 40


>1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
          Length = 392

 Score = 32.6 bits (72), Expect = 7e-04
 Identities = 7/39 (17%), Positives = 10/39 (25%), Gaps = 1/39 (2%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYL 197
           ++V G  G  G  A  L        V +           
Sbjct: 4   VMVIGGDGYCGW-ATALHLSKKNYEVCIVDNLVRRLFDH 41


>2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
          Length = 231

 Score = 32.5 bits (72), Expect = 8e-04
 Identities = 5/28 (17%), Positives = 13/28 (46%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAV 186
           + + G++G  G + L  + + G  +   
Sbjct: 17  VFILGASGETGRVLLKEILEQGLFSKVT 44


>1bxkA [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
          Length = 341

 Score = 32.5 bits (73), Expect = 8e-04
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 159 ILVTGSTGGVGS-IALHLLNKLGYTTVAV-----TGRREAHAEYLTSLGAS----DIIDR 208
           IL+TG  G +GS +  +++N+     V V      G   + A    S   +    DI DR
Sbjct: 4   ILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDR 63

Query: 209 AELSE 213
           AEL+ 
Sbjct: 64  AELAR 68


>1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
          Length = 147

 Score = 32.4 bits (73), Expect = 8e-04
 Identities = 17/102 (16%), Positives = 34/102 (33%), Gaps = 14/102 (13%)

Query: 34  LGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP---GIDVVGTVIE--SADPRFGR 88
             E ++ +E     +N+ D     G    +   P +P   G +  G V +  S       
Sbjct: 25  PAENEIQVENKAIGINFIDTYIRSG----LYPPPSLPSGLGTEAAGIVSKVGSGVKHIKA 80

Query: 89  GDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQV 130
           GD VV       ++  G ++    + ++    +P        
Sbjct: 81  GDRVV-----YAQSALGAYSSVHNIIADKAAILPAAIKVDVA 117


>1xq6A [c.2.1.2] UNKNOWN PROTEIN
          Length = 253

 Score = 32.3 bits (73), Expect = 8e-04
 Identities = 12/36 (33%), Positives = 16/36 (44%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHA 194
           +LVTG++G  G I    L +     VA    R A  
Sbjct: 7   VLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQG 42


>2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
           -- 158
          Length = 142

 Score = 32.3 bits (73), Expect = 8e-04
 Identities = 5/96 (5%), Positives = 11/96 (11%), Gaps = 12/96 (12%)

Query: 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAELSEKGRPL 218
                 +         L+                               R   +      
Sbjct: 22  YGYGIVSALSPPGVNFLVADALK-QHRHRRDDVIVMLSA----------RGVTAPIAAA- 69

Query: 219 QKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMA 254
                  V  +  +  L   +              A
Sbjct: 70  GYQLPMQVSSAADAARLAVRMENDGATAWRAVVEHA 105


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.140    0.454 

Gapped
Lambda     K      H
   0.267   0.0660    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,634,202
Number of extensions: 773798
Number of successful extensions: 2873
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 2795
Number of HSP's successfully gapped: 100
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)