BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CIRT_01668 cimm2 CIRG_01665 Broad_Institute ""
         (628 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2vn4A [x.x.x] GLUCOAMYLASE                                            583   e-169
1gaiA [x.x.x] GLUCOAMYLASE-471                                        568   e-164
1gahA [x.x.x] GLUCOAMYLASE-471                                        568   e-164
1agmA [x.x.x] GLUCOAMYLASE-471                                        568   e-164
3eqaA [x.x.x] GLUCOAMYLASE                                            566   e-164
1ayxA [x.x.x] GLUCOAMYLASE                                            215   2e-58
1ac0A [x.x.x] GLUCOAMYLASE                                            103   1e-24
1cygA [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE                          70   1e-14
1pj9A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    59   5e-11
1ot2A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    59   5e-11
1ot1A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    59   5e-11
1kclA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLYCOSYLTRA...    59   5e-11
1kckA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLYCOSYLTRA...    59   5e-11
1eo5A [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN GL...    59   5e-11
1dtuA [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN GL...    59   5e-11
1d3cA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLYCOSYLTRA...    59   5e-11
1cxlA [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN-GL...    59   5e-11
1cgyA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE                     59   5e-11
1cgxA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE                     59   5e-11
1cgwA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE                     59   5e-11
1cgvA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE                     59   5e-11
1cdgA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE                        59   5e-11
3bmvA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE                     59   5e-11
1a47A [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE                         59   5e-11
1v3kA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    58   7e-11
1v3jA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    58   7e-11
1uktA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    58   7e-11
1uksA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    58   7e-11
1pamA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLUCANOTRAN...    58   7e-11
1d7fA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLUCANOTRAN...    58   7e-11
1pezA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN GLUCAN...    57   1e-10
1qhoA [c.1.8 - b.71.1 - b.1.18 - b.3.1] ALPHA-AMYLASE                  56   2e-10
1tcmA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN GLYCOSYLTRA...    53   2e-09
6cgtA [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE                         50   1e-08
4cgtA [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE                         50   1e-08
3cgtA [c.1.8 - b.71.1 - b.1.18 - b.3.1 (8cgtA)] CYCLODEXTRIN GLY...    50   1e-08
1cguA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE                        50   1e-08
1cgtA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE                        50   1e-08

>2vn4A [x.x.x] GLUCOAMYLASE
          Length = 599

 Score =  583 bits (1504), Expect = e-169
 Identities = 299/574 (52%), Positives = 361/574 (62%), Gaps = 17/574 (2%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           AL ++L N+G DG +  G  AG V+ASPS  DPDY+Y WTRD+ALVFK+LID F    +D
Sbjct: 13  ALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTE-TYD 71

Query: 105 S--QDRIHEYITAQSYLQTVSNPSGTLSTG-GLGEPKFHVDQSAFTGSWGRPQADGPALR 161
           +  Q RI +YITAQ  LQ +SNPSG+L+ G GLGEPKF +    FTG+WGRPQ DGPALR
Sbjct: 72  AGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALR 131

Query: 162 ATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIA 221
           A A+I Y+KWLI N ++    +++WP+V+NDL+YV Q+WN TGFDLWEEV GSSFFT   
Sbjct: 132 AIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVAN 191

Query: 222 QHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGS------NIIANFGGDRSGLD 275
           QHRAL EG  LA  LG       S APQ+LCFLQ FW  S      NI  N G  R+G D
Sbjct: 192 QHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEG--RTGKD 249

Query: 276 ANSLLGIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGR 335
            NS+L  IH FDP   CD  TFQPCS +AL+N K V DSFR IY +N G+    AVA+GR
Sbjct: 250 VNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGR 309

Query: 336 YAEDVYYGGQPWYLATFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSS 395
           YAEDVYY G PWYLATFA+AE LYDAIY W  TG IT+T  SL FFQ +      GTY  
Sbjct: 310 YAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYXX 369

Query: 396 STNVFSEIIANVGSYADGYLNVARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTA 455
               F+ II  V +YADG+L+ A KY P  G+LAEQF RN GTPLSA  LTWSYA+ LTA
Sbjct: 370 XXXTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTA 429

Query: 456 KERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQTATI-----XXXXXXXXXXXXXXXXX 510
             RR  +VP SW   SA  +P TC   S  GSY   T                       
Sbjct: 430 TARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPL 489

Query: 511 XXXXXSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQI 570
                +SV +TF  +  T++G+ + + G+   LG+W  SAA  L A  Y  + PLW   +
Sbjct: 490 PCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIATV 549

Query: 571 DLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVP 604
           +L AG   +Y+YI    DG V WESDPN +YTVP
Sbjct: 550 NLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVP 583


>1gaiA [x.x.x] GLUCOAMYLASE-471
          Length = 472

 Score =  568 bits (1464), Expect = e-164
 Identities = 270/449 (60%), Positives = 333/449 (74%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           A  +IL+NIG DGA V GA +GIVVASPS  +PDYFYTWTRD+ LV K L+D F  G+ D
Sbjct: 14  ARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTD 73

Query: 105 SQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATA 164
               I  YI++Q+ +Q VSNPSG LS+GGLGEPKF+VD++A+TGSWGRPQ DGPALRATA
Sbjct: 74  LLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFNVDETAYTGSWGRPQRDGPALRATA 133

Query: 165 MITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHR 224
           MI + +WL+ NG+  AA  IVWP+V+NDLSYV Q+WN TG+DLWEEV GSSFFT   QHR
Sbjct: 134 MIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHR 193

Query: 225 ALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIH 284
           AL EG+  A  +G+ C  C+SQAPQILC+LQSFWTGS I+ANF   RSG D N+LLG IH
Sbjct: 194 ALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLLGSIH 253

Query: 285 NFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGG 344
            FDPEA CDD+TFQPCS RALANHK+V DSFR IY +N G+   +AVAVGRY ED YY G
Sbjct: 254 TFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNG 313

Query: 345 QPWYLATFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEII 404
            PW+L T A+AE LYDA+YQW+  G + ITDVSL FF+++                  I+
Sbjct: 314 NPWFLCTLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIV 373

Query: 405 ANVGSYADGYLNVARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVP 464
           + V ++ADG++++   +   +G+L+EQF ++DG  LSA DLTWSYAALLTA  RR SVVP
Sbjct: 374 SAVKTFADGFVSIVETHAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVP 433

Query: 465 GSWGQKSAHDVPPTCLATSAAGSYQTATI 493
            SWG+ SA  VP TC ATSA+G+Y + T+
Sbjct: 434 PSWGETSASSVPGTCAATSASGTYSSVTV 462


>1gahA [x.x.x] GLUCOAMYLASE-471
          Length = 471

 Score =  568 bits (1464), Expect = e-164
 Identities = 270/449 (60%), Positives = 333/449 (74%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           A  +IL+NIG DGA V GA +GIVVASPS  +PDYFYTWTRD+ LV K L+D F  G+ D
Sbjct: 14  ARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTD 73

Query: 105 SQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATA 164
               I  YI++Q+ +Q VSNPSG LS+GGLGEPKF+VD++A+TGSWGRPQ DGPALRATA
Sbjct: 74  LLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFNVDETAYTGSWGRPQRDGPALRATA 133

Query: 165 MITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHR 224
           MI + +WL+ NG+  AA  IVWP+V+NDLSYV Q+WN TG+DLWEEV GSSFFT   QHR
Sbjct: 134 MIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHR 193

Query: 225 ALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIH 284
           AL EG+  A  +G+ C  C+SQAPQILC+LQSFWTGS I+ANF   RSG D N+LLG IH
Sbjct: 194 ALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLLGSIH 253

Query: 285 NFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGG 344
            FDPEA CDD+TFQPCS RALANHK+V DSFR IY +N G+   +AVAVGRY ED YY G
Sbjct: 254 TFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNG 313

Query: 345 QPWYLATFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEII 404
            PW+L T A+AE LYDA+YQW+  G + ITDVSL FF+++                  I+
Sbjct: 314 NPWFLCTLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIV 373

Query: 405 ANVGSYADGYLNVARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVP 464
           + V ++ADG++++   +   +G+L+EQF ++DG  LSA DLTWSYAALLTA  RR SVVP
Sbjct: 374 SAVKTFADGFVSIVETHAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVP 433

Query: 465 GSWGQKSAHDVPPTCLATSAAGSYQTATI 493
            SWG+ SA  VP TC ATSA+G+Y + T+
Sbjct: 434 PSWGETSASSVPGTCAATSASGTYSSVTV 462


>1agmA [x.x.x] GLUCOAMYLASE-471
          Length = 470

 Score =  568 bits (1464), Expect = e-164
 Identities = 270/449 (60%), Positives = 333/449 (74%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           A  +IL+NIG DGA V GA +GIVVASPS  +PDYFYTWTRD+ LV K L+D F  G+ D
Sbjct: 14  ARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTD 73

Query: 105 SQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATA 164
               I  YI++Q+ +Q VSNPSG LS+GGLGEPKF+VD++A+TGSWGRPQ DGPALRATA
Sbjct: 74  LLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFNVDETAYTGSWGRPQRDGPALRATA 133

Query: 165 MITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHR 224
           MI + +WL+ NG+  AA  IVWP+V+NDLSYV Q+WN TG+DLWEEV GSSFFT   QHR
Sbjct: 134 MIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHR 193

Query: 225 ALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIH 284
           AL EG+  A  +G+ C  C+SQAPQILC+LQSFWTGS I+ANF   RSG D N+LLG IH
Sbjct: 194 ALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLLGSIH 253

Query: 285 NFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGG 344
            FDPEA CDD+TFQPCS RALANHK+V DSFR IY +N G+   +AVAVGRY ED YY G
Sbjct: 254 TFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNG 313

Query: 345 QPWYLATFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEII 404
            PW+L T A+AE LYDA+YQW+  G + ITDVSL FF+++                  I+
Sbjct: 314 NPWFLCTLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIV 373

Query: 405 ANVGSYADGYLNVARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVP 464
           + V ++ADG++++   +   +G+L+EQF ++DG  LSA DLTWSYAALLTA  RR SVVP
Sbjct: 374 SAVKTFADGFVSIVETHAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVP 433

Query: 465 GSWGQKSAHDVPPTCLATSAAGSYQTATI 493
            SWG+ SA  VP TC ATSA+G+Y + T+
Sbjct: 434 PSWGETSASSVPGTCAATSASGTYSSVTV 462


>3eqaA [x.x.x] GLUCOAMYLASE
          Length = 458

 Score =  566 bits (1458), Expect = e-164
 Identities = 268/450 (59%), Positives = 333/450 (74%), Gaps = 1/450 (0%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           A  +IL+NIG DGA V GA +GIVVASPS  +PDYFYTWTRD+ LV K L+D F  G+  
Sbjct: 9   ARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVLKTLVDLFRNGDTS 68

Query: 105 SQDRIHEYITAQSYLQTVSNPSGTLSTG-GLGEPKFHVDQSAFTGSWGRPQADGPALRAT 163
               I  YI+AQ+ +Q +SNPSG LS+G GLGEPKF+VD++A+TGSWGRPQ DGPALRAT
Sbjct: 69  LLSTIENYISAQAIVQGISNPSGDLSSGAGLGEPKFNVDETAYTGSWGRPQRDGPALRAT 128

Query: 164 AMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQH 223
           AMI + +WL+ NG+   A  IVWP+V+NDLSYV Q+WN TG+DLWEEV GSSFFT   QH
Sbjct: 129 AMIGFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQH 188

Query: 224 RALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGII 283
           RAL EG+  A  +G+ C  C+SQAP+ILC+LQSFWTGS I+ANF   RSG DAN+LLG I
Sbjct: 189 RALVEGSAFATAVGSSCSWCDSQAPEILCYLQSFWTGSFILANFDSSRSGKDANTLLGSI 248

Query: 284 HNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYG 343
           H FDPEA CDD+TFQPCS RALANHK+V DSFR IY +N G+   +AVAVGRY ED YY 
Sbjct: 249 HTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYN 308

Query: 344 GQPWYLATFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEI 403
           G PW+L T A+AE LYDA+YQW+  G + +TDVSL FF+++Y  A  G           I
Sbjct: 309 GNPWFLCTLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGXXXXXXXXXXXI 368

Query: 404 IANVGSYADGYLNVARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVV 463
           +  V ++ADG++++   +   +G+++EQ+ ++DG  LSA DLTWSYAALLTA  RR SVV
Sbjct: 369 VDAVKTFADGFVSIVETHAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSVV 428

Query: 464 PGSWGQKSAHDVPPTCLATSAAGSYQTATI 493
           P SWG+ SA  VP TC ATSA G+Y + T+
Sbjct: 429 PASWGETSASSVPGTCAATSAIGTYSSVTV 458


>1ayxA [x.x.x] GLUCOAMYLASE
          Length = 492

 Score =  215 bits (548), Expect = 2e-58
 Identities = 150/465 (32%), Positives = 227/465 (48%), Gaps = 52/465 (11%)

Query: 45  ALQSILDNIGDDGAKVQGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHD 104
           +L  +L NI     +      G V+ASPS ++PDY+Y WTRD+A+ F  ++      N +
Sbjct: 29  SLYYLLQNIAYPEGQFNNGVPGTVIASPSTSNPDYYYQWTRDSAITFLTVLSELEDNNFN 88

Query: 105 SQ--DRIHEYITAQSYLQTVSNPSGTLSTG---GLGEPKFHVDQSAFTGSWGRPQADGPA 159
           +     +  YI     LQ  SNPSG+       GLGEPKF+ D SA+TG+WGRPQ DGPA
Sbjct: 89  TTLAKAVEYYINTSYNLQRTSNPSGSFDDENHKGLGEPKFNTDGSAYTGAWGRPQNDGPA 148

Query: 160 LRATAMITY---------AKWLIANGHE---DAAKSIVWPVVQNDLSYVGQFWNSTGFDL 207
           LRA A+  Y          K ++ +  +    + + I   +++ DL YV  +W+STGFDL
Sbjct: 149 LRAYAISRYLNDVNSLNEGKLVLTDSGDINFSSTEDIYKNIIKPDLEYVIGYWDSTGFDL 208

Query: 208 WEEVQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGS------ 261
           WEE QG  FFT++ Q +ALA   ++A+    D     +        L+S+ +GS      
Sbjct: 209 WEENQGRHFFTSLVQQKALAYAVDIAKSF--DDGDFANTLSSTASTLESYLSGSDGGFVN 266

Query: 262 ----NIIAN----FGGDRSGLDANSLLGIIHNFDPEADCDDNTFQPCSSRALANHKKVTD 313
               +I+ N        R GLD+ + +G +   D   +     F   +   L ++  + +
Sbjct: 267 TDVNHIVENPDLLQQNSRQGLDSATYIGPLLTHD-IGESSSTPFDVDNEYVLQSYYLLLE 325

Query: 314 SFREIYPINSGMEGDQAVAVGRYAEDVYYG-----GQPWYLATFASAELLYDAIYQ-WNH 367
             ++ Y +NS        A+GRY EDVY G     G PW+LAT  +A++ Y   Y   + 
Sbjct: 326 DNKDRYSVNSAYSA--GAAIGRYPEDVYNGDGSSEGNPWFLATAYAAQVPYKLAYDAKSA 383

Query: 368 TGKITITDVSLPFF----------QSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNV 417
           +  ITI  ++  FF           S Y+S+   T  S ++ F+ +  N+ ++ D +L V
Sbjct: 384 SNDITINKINYDFFNKYIVDLSTINSAYQSSDSVTIKSGSDEFNTVADNLVTFGDSFLQV 443

Query: 418 ARKYTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESV 462
              +    G+L EQ +R  G    A  LTWS  ALL A   R  V
Sbjct: 444 ILDHINDDGSLNEQLNRYTGYSTGAYSLTWSSGALLEAIRLRNKV 488


>1ac0A [x.x.x] GLUCOAMYLASE
          Length = 108

 Score =  103 bits (257), Expect = 1e-24
 Identities = 47/90 (52%), Positives = 61/90 (67%)

Query: 516 SSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAG 575
           ++V +TF     T +GENI+LVGSI +LG WE S    L ADKY +S PLW + + L AG
Sbjct: 5   TAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAG 64

Query: 576 KKFDYRYIRKSDDGRVVWESDPNRSYTVPK 605
           + F+Y++IR   D  V WESDPNR YTVP+
Sbjct: 65  ESFEYKFIRIESDDSVEWESDPNREYTVPQ 94


>1cygA [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
          Length = 680

 Score = 70.5 bits (171), Expect = 1e-14
 Identities = 33/90 (36%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+NI++VG++ ELG+W+ S A     ++   S P W I + +  GK
Sbjct: 581 SVRFVVNNAT-TNLGQNIYIVGNVYELGNWDTSKAIGPMFNQVVYSYPTWYIDVSVPEGK 639

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++I+K   G V WES  N  YT P N
Sbjct: 640 TIEFKFIKKDSQGNVTWESGSNHVYTTPTN 669


>1pj9A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1ot2A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1ot1A [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1kclA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLYCOSYLTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1kckA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLYCOSYLTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1eo5A [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
           GLYCOSYLTRANSFERASE)
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1dtuA [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
           GLYCOSYLTRANSFERASE)
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1d3cA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLYCOSYLTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cxlA [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
           (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cgyA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cgxA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cgwA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cgvA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>1cdgA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
          Length = 686

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>3bmvA [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
          Length = 683

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 528 TKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKSD 587
           T +GEN++L G++ ELG+W+ S A     ++     P W   + + AG    +++I+K+ 
Sbjct: 595 TVYGENVYLTGNVAELGNWDTSKAIGPMFNQVVYQYPTWYYDVSVPAGTTIQFKFIKKNG 654

Query: 588 DGRVVWESDPNRSYTVPKN 606
           +  + WE   N +YTVP +
Sbjct: 655 N-TITWEGGSNHTYTVPSS 672


>1a47A [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
          Length = 683

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 528 TKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKSD 587
           T +GEN++L G++ ELG+W+ S A     ++     P W   + + AG    +++I+K+ 
Sbjct: 595 TVYGENVYLTGNVAELGNWDTSKAIGPMFNQVVYQYPTWYYDVSVPAGTTIQFKFIKKNG 654

Query: 588 DGRVVWESDPNRSYTVPKN 606
           +  + WE   N +YTVP +
Sbjct: 655 N-TITWEGGSNHTYTVPSS 672


>1v3kA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1v3jA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1uktA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1uksA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1pamA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1d7fA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 58.2 bits (139), Expect = 7e-11
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           +V+    + T T  G+N+FL G++ ELG+W+P+ A     ++     P W   + + AG+
Sbjct: 588 TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVVYQYPTWYYDVSVPAGQ 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVP 604
             ++++++K     V WE   NR++T P
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGANRTFTTP 673


>1pezA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
           GLUCANOTRANSFERASE
          Length = 686

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+W+P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K       WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTATWEGGSNHTFTAPSS 675


>1qhoA [c.1.8 - b.71.1 - b.1.18 - b.3.1] ALPHA-AMYLASE
          Length = 686

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 516 SSVKITFQSVTDTKWGENIFLVGSIPELGSWE---PSAAKQLKADKYEASCPLWSIQIDL 572
           +SV  T +S   T  G+ I+L G+IPELG+W      A    +      + P W     +
Sbjct: 582 TSVVFTVKSAPPTNLGDKIYLTGNIPELGNWSTDTSGAVNNAQGPLLAPNYPDWFYVFSV 641

Query: 573 AAGKKFDYRYIRKSDDGRVVWESDPNRSYTVP 604
            AGK   +++  K  DG + WE+  N   T P
Sbjct: 642 PAGKTIQFKFFIKRADGTIQWENGSNHVATTP 673


>1tcmA [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
           GLYCOSYLTRANSFERASE
          Length = 686

 Score = 53.1 bits (126), Expect = 2e-09
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 517 SVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGK 576
           SV+    + T T  G+N++L GS+ ELG+ +P+ A     ++     P W   + + AGK
Sbjct: 588 SVRFVVNNAT-TALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGK 646

Query: 577 KFDYRYIRKSDDGRVVWESDPNRSYTVPKN 606
             ++++++K     V WE   N ++T P +
Sbjct: 647 TIEFKFLKK-QGSTVTWEGGSNHTFTAPSS 675


>6cgtA [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
          Length = 684

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 528 TKWGENIFLVGSIPELGSWEP-SAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKS 586
           T  G+N++L G++ ELG+W   S A     ++     P W   + + AGK+ ++++ +K 
Sbjct: 596 TTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKK- 654

Query: 587 DDGRVVWESDPNRSYTVP 604
           +   + WES  N ++T P
Sbjct: 655 NGSTITWESGSNHTFTTP 672


>4cgtA [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
          Length = 678

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 528 TKWGENIFLVGSIPELGSWEP-SAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKS 586
           T  G+N++L G++ ELG+W   S A     ++     P W   + + AGK+ ++++ +K 
Sbjct: 590 TTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKK- 648

Query: 587 DDGRVVWESDPNRSYTVP 604
           +   + WES  N ++T P
Sbjct: 649 NGSTITWESGSNHTFTTP 666


>3cgtA [c.1.8 - b.71.1 - b.1.18 - b.3.1 (8cgtA)] CYCLODEXTRIN
           GLYCOSYLTRANSFERASE
          Length = 684

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 528 TKWGENIFLVGSIPELGSWEP-SAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKS 586
           T  G+N++L G++ ELG+W   S A     ++     P W   + + AGK+ ++++ +K 
Sbjct: 596 TTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKK- 654

Query: 587 DDGRVVWESDPNRSYTVP 604
           +   + WES  N ++T P
Sbjct: 655 NGSTITWESGSNHTFTTP 672


>1cguA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
          Length = 684

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 528 TKWGENIFLVGSIPELGSWEP-SAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKS 586
           T  G+N++L G++ ELG+W   S A     ++     P W   + + AGK+ ++++ +K 
Sbjct: 596 TTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKK- 654

Query: 587 DDGRVVWESDPNRSYTVP 604
           +   + WES  N ++T P
Sbjct: 655 NGSTITWESGSNHTFTTP 672


>1cgtA [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
          Length = 684

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 528 TKWGENIFLVGSIPELGSWEP-SAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKS 586
           T  G+N++L G++ ELG+W   S A     ++     P W   + + AGK+ ++++ +K 
Sbjct: 596 TTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKK- 654

Query: 587 DDGRVVWESDPNRSYTVP 604
           +   + WES  N ++T P
Sbjct: 655 NGSTITWESGSNHTFTTP 672


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,200,266,926
Number of extensions: 47742191
Number of successful extensions: 101908
Number of sequences better than 1.0e-03: 2836
Number of HSP's gapped: 98563
Number of HSP's successfully gapped: 3595
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)