BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CIRT_01234 cimm2 CIRG_01232 Broad_Institute ""
         (388 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ALKBH_SCHPO RecName: Full=Alkylated DNA repair protein alkB homo...   159   5e-41
ALKB_DICDI RecName: Full=Alpha-ketoglutarate-dependent dioxygena...    98   1e-22
ALKB1_HUMAN RecName: Full=Alkylated DNA repair protein alkB homo...    90   4e-20
ALKB1_MOUSE RecName: Full=Alkylated DNA repair protein alkB homo...    88   1e-19
ALKBH_ARATH RecName: Full=Alkylated DNA repair protein alkB homo...    80   2e-17
ALKB_CAUCR RecName: Full=Alpha-ketoglutarate-dependent dioxygena...    59   5e-11
ALKB_CAUCN RecName: Full=Alpha-ketoglutarate-dependent dioxygena...    59   5e-11
ALKB_ECOLI RecName: Full=Alpha-ketoglutarate-dependent dioxygena...    50   3e-08
YLW2_SCHPO RecName: Full=Uncharacterized protein P8A3.02c;             45   1e-06
ALKB_SALTY RecName: Full=Alpha-ketoglutarate-dependent dioxygena...    44   2e-06
ALKB8_XENTR RecName: Full=Alkylated DNA repair protein alkB homo...    42   1e-05
ALKB8_MOUSE RecName: Full=Alkylated DNA repair protein alkB homo...    42   1e-05
ALKB8_MACFA RecName: Full=Alkylated DNA repair protein alkB homo...    41   2e-05
ALKB8_BOVIN RecName: Full=Alkylated DNA repair protein alkB homo...    41   2e-05
ZN750_HUMAN RecName: Full=Protein ZNF750;                              38   1e-04
ALKB8_HUMAN RecName: Full=Alkylated DNA repair protein alkB homo...    37   2e-04

>ALKBH_SCHPO RecName: Full=Alkylated DNA repair protein alkB
           homolog;
          Length = 297

 Score =  159 bits (401), Expect = 5e-41
 Identities = 86/181 (47%), Positives = 116/181 (64%), Gaps = 19/181 (10%)

Query: 202 RPLSIQAALNSKLRWITLGGQYNWTTKEYP-PGPPPAFPSDISTLLHSIFPETT------ 254
           +PL++   ++ KLRW+TLG QY+WTTKEYP P   P FP D+   +  +  E+T      
Sbjct: 123 KPLTVDRLVHKKLRWVTLGEQYDWTTKEYPDPSKSPGFPKDLGDFVEKVVKESTDFLHWK 182

Query: 255 AEAAIVNLYSPGDTLNPHRDVSEECDT-GLISISLGCHALFLVG-HGNGDSCAVIRLRSG 312
           AEAAIVN YSPGDTL+ H D SEE  T  LIS+S+G   ++L+G     +  + +RL SG
Sbjct: 183 AEAAIVNFYSPGDTLSAHIDESEEDLTLPLISLSMGLDCIYLIGTESRSEKPSALRLHSG 242

Query: 313 DAVYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVPDEDSQRWWGWMAGKRVNLNVRQ 372
           D V MTG SR A+HAVPKIIP++ P++L T           ++ W GW++ KRVN NVRQ
Sbjct: 243 DVVIMTGTSRKAFHAVPKIIPNSTPNYLLT----------GNKAWDGWISRKRVNFNVRQ 292

Query: 373 M 373
           +
Sbjct: 293 V 293


>ALKB_DICDI RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
           alkB;         EC=1.14.11.-;AltName: Full=Alkylated DNA
           repair protein alkB;
          Length = 393

 Score = 98.2 bits (243), Expect = 1e-22
 Identities = 73/211 (34%), Positives = 100/211 (47%), Gaps = 18/211 (8%)

Query: 187 DDPTRTFSPKDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLL 246
           + PTR           PL     L  KL W TLG QY WT + Y       FP D+  L+
Sbjct: 192 EQPTRPLDKNG----EPLPTYRQLLDKLAWSTLGYQYQWTPRLYSEEFYEEFPDDLQELV 247

Query: 247 HSI-----FPETTAEAAIVNLYSPGDTLNPHRDVSE-ECDTGLISISLGCHALFLVGHGN 300
             I     F    AEAA VN YS    +  H D +E E +  +ISIS G  A+FL+G   
Sbjct: 248 QKIAIATKFDPYVAEAATVNFYSEDSIMGGHLDDAEQEMEKPIISISFGSTAVFLMGAET 307

Query: 301 GDSCAV-IRLRSGDAVYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVPDEDSQRWWG 359
            D   V + +RSGD V M G SR+ +H V KI+ ++    L       +  D+D +    
Sbjct: 308 RDIAPVPLFIRSGDIVIMGGRSRYCYHGVAKIVENSFDLGLI-----DENDDQDLKYKIQ 362

Query: 360 WMAGK--RVNLNVRQMFQSPPTNPAALGEND 388
           W+  K  RVN+N RQ+F+ P      + +N+
Sbjct: 363 WLKEKNRRVNINTRQVFKVPKLGGKLINKNE 393


>ALKB1_HUMAN RecName: Full=Alkylated DNA repair protein alkB homolog
           1;
          Length = 389

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 71/206 (34%), Positives = 99/206 (48%), Gaps = 25/206 (12%)

Query: 196 KDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLLHSI-----F 250
           K+AT  RP S    L  KLRW+T+G  YNW +K+Y       FPSD+  L   +     F
Sbjct: 154 KEATKRRPRS----LLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGF 209

Query: 251 PETTAEAAIVNLYSPGDTLNPHRDVSE-ECDTGLISISLGCHALFLVGHGNGDSC-AVIR 308
            +  AEA I+N Y    TL  H D SE +    L+S S G  A+FL+G    D     + 
Sbjct: 210 EDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMF 269

Query: 309 LRSGDAVYMTGASRFAWHAVPKIIPST----CPDWLKTWPGGGDVPD---------EDSQ 355
           + SGD + M+G SR   HAVP+++P+      P  L+  P    +P          ED Q
Sbjct: 270 MHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEA-PLPAVLPRDSMVEPCSMEDWQ 328

Query: 356 RWWGWMAGKRVNLNVRQMFQSPPTNP 381
               ++   RVN+ VRQ+  +    P
Sbjct: 329 VCASYLKTARVNMTVRQVLATDQNFP 354


>ALKB1_MOUSE RecName: Full=Alkylated DNA repair protein alkB homolog
           1;
          Length = 389

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 74/216 (34%), Positives = 101/216 (46%), Gaps = 28/216 (12%)

Query: 196 KDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLLHSI-----F 250
           K+ T  RP S    L  +LRW+TLG  YNW +K+Y       FPSD++ L   +     F
Sbjct: 154 KEVTKRRPRS----LLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGF 209

Query: 251 PETTAEAAIVNLYSPGDTLNPHRDVSE-ECDTGLISISLGCHALFLVGHGNGDSC-AVIR 308
               AEA I+N Y    TL  H D SE +    L+S S G  A+FL+G    D     + 
Sbjct: 210 QGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMF 269

Query: 309 LRSGDAVYMTGASRFAWHAVPKIIP----STCPDWLKTWPGGGDVPD---------EDSQ 355
           + SGD + M+G SR   HAVP+++P       P  L+T P    +P          ED Q
Sbjct: 270 MHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLET-PLPAVLPSNSLVEPCSVEDWQ 328

Query: 356 RWWGWMAGKRVNLNVRQMF---QSPPTNPAALGEND 388
               ++   RVN+ VRQ+    Q  P  P    + D
Sbjct: 329 VCATYLRTARVNMTVRQVLATGQDFPLEPVEETKRD 364


>ALKBH_ARATH RecName: Full=Alkylated DNA repair protein alkB
           homolog;
          Length = 345

 Score = 80.5 bits (197), Expect = 2e-17
 Identities = 58/177 (32%), Positives = 87/177 (49%), Gaps = 12/177 (6%)

Query: 208 AALNSKLRWITLGGQYNWTTKEYPPG-PPPAFPSDISTLL--HSIFP-----ETTAEAAI 259
           + L  KLRW TLG Q++W+ + Y    P    P  +  L   H+        E   E AI
Sbjct: 171 SVLLRKLRWSTLGLQFDWSKRNYDVSLPHNNIPDALCQLAKTHAAIAMPDGEEFRPEGAI 230

Query: 260 VNLYSPGDTLNPHRDVSE-ECDTGLISISLGCHALFLVG-HGNGDSCAVIRLRSGDAVYM 317
           VN +  GDTL  H D  E +    ++S+SLGC A+FL+G     D    + LRSGD V M
Sbjct: 231 VNYFGIGDTLGGHLDDMEADWSKPIVSMSLGCKAIFLLGGKSKDDPPHAMYLRSGDVVLM 290

Query: 318 TGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVPDEDSQRWWGWMAGKRVNLNVRQMF 374
            G +R  +H +P+I   T  +         ++  E    +  ++   R+N+N+RQ+F
Sbjct: 291 AGEARECFHGIPRIF--TGEENADIGALESELSHESGHFFAEYIKTSRININIRQVF 345


>ALKB_CAUCR RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
           alkB homolog;         EC=1.14.11.-;
          Length = 220

 Score = 59.3 bits (142), Expect = 5e-11
 Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 10/146 (6%)

Query: 193 FSPKDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPP-PAFPS---DISTLLHS 248
           FS       +P+S+       L W +    Y +  +    G P P  P    D+ T+L  
Sbjct: 54  FSNYRTAYGKPMSVAMTALGSLGWTSDARGYRYVDRHPETGRPWPDMPPALLDLWTVLGD 113

Query: 249 IFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTG--LISISLGCHALFLVGHGNG-DSCA 305
             PET  ++ +VNLY  G  +  H+D  +E D    ++SISLG  A+F +G  N  D   
Sbjct: 114 --PETPPDSCLVNLYRDGARMGLHQD-RDEADPRFPVLSISLGDTAVFRIGGVNRKDPTR 170

Query: 306 VIRLRSGDAVYMTGASRFAWHAVPKI 331
            +RL SGD   + G +R A+H V +I
Sbjct: 171 SLRLASGDVCRLLGPARLAFHGVDRI 196


>ALKB_CAUCN RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
           alkB homolog;         EC=1.14.11.-;
          Length = 220

 Score = 59.3 bits (142), Expect = 5e-11
 Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 10/146 (6%)

Query: 193 FSPKDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPP-PAFPS---DISTLLHS 248
           FS       +P+S+       L W +    Y +  +    G P P  P    D+ T+L  
Sbjct: 54  FSNYRTAYGKPMSVAMTALGSLGWTSDARGYRYVDRHPETGRPWPDMPPALLDLWTVLGD 113

Query: 249 IFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTG--LISISLGCHALFLVGHGNG-DSCA 305
             PET  ++ +VNLY  G  +  H+D  +E D    ++SISLG  A+F +G  N  D   
Sbjct: 114 --PETPPDSCLVNLYRDGARMGLHQD-RDEADPRFPVLSISLGDTAVFRIGGVNRKDPTR 170

Query: 306 VIRLRSGDAVYMTGASRFAWHAVPKI 331
            +RL SGD   + G +R A+H V +I
Sbjct: 171 SLRLASGDVCRLLGPARLAFHGVDRI 196


>ALKB_ECOLI RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
           alkB;         EC=1.14.11.-;AltName: Full=Alkylated DNA
           repair protein alkB;
          Length = 216

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 37/125 (29%), Positives = 53/125 (42%), Gaps = 17/125 (13%)

Query: 221 GQYNWTTKE----YPPGPP------PAFPSDISTLLHSI-----FPETTAEAAIVNLYSP 265
           G   WTT      Y P  P      PA P     L         +P+   +A ++N Y+P
Sbjct: 65  GHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAP 124

Query: 266 GDTLNPHRDVSE-ECDTGLISISLGCHALFLVGH-GNGDSCAVIRLRSGDAVYMTGASRF 323
           G  L+ H+D  E +    ++S+SLG  A+F  G     D    + L  GD V   G SR 
Sbjct: 125 GAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRL 184

Query: 324 AWHAV 328
            +H +
Sbjct: 185 FYHGI 189


>YLW2_SCHPO RecName: Full=Uncharacterized protein P8A3.02c;
          Length = 225

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 15/122 (12%)

Query: 255 AEAAIVNLYSPGDTLNPHRDVSEECDTGLISISLGCHALFLVGHGNGDSCAVIRLRSGDA 314
           AEA I+ +Y+PGD + PH+D+ E    G+   S   +   +  H      + IRL  G  
Sbjct: 115 AEAIIMQVYNPGDGIIPHKDL-EMFGDGVAIFSFLSNTTMIFTHPELKLKSKIRLEKGSL 173

Query: 315 VYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVPDEDSQRWWGWMAGKRVNLNVRQMF 374
           + M+G +R+ W      IP    DW         V ++  ++W      +R+++ +R++ 
Sbjct: 174 LLMSGTARYDWF---HEIPFRAGDW---------VMNDGEEKWVS--RSQRLSVTMRRII 219

Query: 375 QS 376
           ++
Sbjct: 220 EN 221


>ALKB_SALTY RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
           alkB;         EC=1.14.11.-;AltName: Full=Alkylated DNA
           repair protein alkB;
          Length = 216

 Score = 44.3 bits (103), Expect = 2e-06
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 17/125 (13%)

Query: 221 GQYNWTTKEY----------PPGPPPAFPSDISTLLHSI-----FPETTAEAAIVNLYSP 265
           G   WTT  +             P PA P   +++         +     +A ++N Y+P
Sbjct: 65  GALGWTTDRHGYCYAVRDPLTDKPWPALPLSFASVCRQAAIAAGYASFQPDACLINRYAP 124

Query: 266 GDTLNPHRDVSE-ECDTGLISISLGCHALFLVGH-GNGDSCAVIRLRSGDAVYMTGASRF 323
           G  L+ H+D  E +    ++S+SLG  A+F  G     D    I L  GD V   G SR 
Sbjct: 125 GAKLSLHQDKDEPDLRAPIVSVSLGVPAVFQFGGLRRSDPIQRILLEHGDIVVWGGESRL 184

Query: 324 AWHAV 328
            +H +
Sbjct: 185 FYHGI 189


>ALKB8_XENTR RecName: Full=Alkylated DNA repair protein alkB homolog
           8;
          Length = 628

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 260 VNLYSPGDTLNPHRDVSEECDTGLISISLGCHALFLVGHGNGDSCAVIRLRSGDAVYMTG 319
           +N Y PG  + PH D     +  ++S+SLG   +    H NG S   + L     + M+G
Sbjct: 224 INQYEPGQGIPPHVDTHSAFEDEILSLSLGAEIVMDFKHPNG-SVVPVMLPQRSLLIMSG 282

Query: 320 ASRFAW 325
            SR+ W
Sbjct: 283 ESRYLW 288


>ALKB8_MOUSE RecName: Full=Alkylated DNA repair protein alkB homolog
           8;
          Length = 664

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 1/98 (1%)

Query: 228 KEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTGLISIS 287
           K  P G P    S +  LL   + +   +   +N Y PG  +  H D     +  +IS+S
Sbjct: 194 KPLPGGLPEVCSSILEKLLKEGYIKHKPDQLTINQYEPGHGIPAHIDTHSAFEDEIISLS 253

Query: 288 LGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAW 325
           LG   +    H  G +  V+ L     + MTG SR+ W
Sbjct: 254 LGSAIVMDFKHPEGVTVQVM-LPRRSLLVMTGESRYLW 290


>ALKB8_MACFA RecName: Full=Alkylated DNA repair protein alkB homolog
           8;
          Length = 664

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 1/98 (1%)

Query: 228 KEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTGLISIS 287
           K  P G P    S +   L   + +   +   +N Y PG  +  H D     +  ++S+S
Sbjct: 194 KPLPGGLPDICDSFLEKWLREGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLS 253

Query: 288 LGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAW 325
           LG   +    H +G +  V+ L     + MTG SR+ W
Sbjct: 254 LGSEIVMDFKHPDGTAVPVM-LPRRSLLVMTGESRYLW 290


>ALKB8_BOVIN RecName: Full=Alkylated DNA repair protein alkB homolog
           8;
          Length = 664

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 1/98 (1%)

Query: 228 KEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTGLISIS 287
           K  P G P    S +   L   F +   +   +N Y PG  +  H D     +  +IS+S
Sbjct: 194 KPLPGGLPDICESILEKWLKEGFIKHKPDQLTINQYEPGHGIPAHIDTHSAFEDEIISLS 253

Query: 288 LGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAW 325
           LG   +    H +G +  V+ L     + MTG SR+ W
Sbjct: 254 LGSEIVMDFKHPDGMTVPVM-LPCRSLLVMTGESRYLW 290


>ZN750_HUMAN RecName: Full=Protein ZNF750;
          Length = 723

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 37/152 (24%), Positives = 57/152 (37%), Gaps = 21/152 (13%)

Query: 148 LHLHYDVSYPSPSSDANGASALKGTQQEACWSTNSSFFRDDPTRTFSPKDATVHRPLSIQ 207
           LH       P+P +      AL+G  + + +          P    +P+   +H P +  
Sbjct: 132 LHRASPCKSPAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNPTAKA 191

Query: 208 AALNSKLRWITLGGQYNWTTKEYPPGPPPAFPSDIST---------LLHSIFPETT---- 254
            + ++K  + T G  Y W  K   P  PP FP  IS+          +H   PE      
Sbjct: 192 VSFHTKSAFHTPG--YPW--KAGSPFLPPEFPHKISSTKGLGAISPYMHPTIPEYPPHFY 247

Query: 255 AEAAIVNLYSPGDTLNPHRDVSEECDTGLISI 286
            E  +  +YSP          S ECD  L+S+
Sbjct: 248 TEHGLATIYSPYLLAGS----SPECDAPLLSV 275


>ALKB8_HUMAN RecName: Full=Alkylated DNA repair protein alkB homolog
           8;
          Length = 664

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 1/93 (1%)

Query: 233 GPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTGLISISLGCHA 292
           G P    S +   L   + +   +   +N Y PG  +  H D     +  ++S+SLG   
Sbjct: 199 GLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEI 258

Query: 293 LFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAW 325
           +    H +G +  V+ L     + MTG SR+ W
Sbjct: 259 VMDFKHPDGIAVPVM-LPRRSLLVMTGESRYLW 290


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.325    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 13,886,376,990
Number of extensions: 555354028
Number of successful extensions: 1188594
Number of sequences better than 1.0e-03: 14726
Number of HSP's gapped: 1163231
Number of HSP's successfully gapped: 22136
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)