# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/broad_1730.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CIRT_00395  [L=141]
Description: cimm2 CIRG_00395 Broad_Institute ""
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
      0.071   15.3   1.3       0.56   12.5   0.1    2.6  2  PF01286  XPA protein N-terminal
        4.1   10.0   0.0          7    9.3   0.0    1.3  1  PF04365  Protein of unknown function (DUF497)
        4.4    8.1   0.0        5.3    7.8   0.0    1.0  1  PF04738  Lantibiotic dehydratase, C terminus
         10    8.7   0.1    2.3e+02    4.4   0.0    2.5  2  PF09076  Streptomyces killer toxin-like
         11    8.5   0.0         21    7.6   0.0    1.4  1  PF01412  Putative GTPase activating protein for Arf
         13    8.4   0.1         53    6.4   0.0    1.8  2  PF09250  Bifunctional DNA primase/polymerase, N-terminal
         22    7.2   0.4         41    6.4   0.3    1.4  1  PF11781  RNA polymerase I-specific transcription initiation 
         36    7.0   0.0         73    6.0   0.0    1.5  1  PF09180  Prolyl-tRNA synthetase, C-terminal
         57    5.7   0.0         90    5.1   0.0    1.3  1  PF08271  TFIIB zinc-binding
         70    6.0   0.0    1.2e+02    5.2   0.0    1.3  1  PF05254  Uncharacterised protein family (UPF0203)
         71    5.6   0.3    1.8e+02    4.3   0.2    1.6  1  PF03604  DNA directed RNA polymerase, 7 kDa subunit
         77    6.0   0.1    1.6e+02    5.0   0.1    1.5  1  PF01194  RNA polymerases N / 8 kDa subunit
         78    6.0   0.3    1.6e+02    5.0   0.2    1.6  1  PF00098  Zinc knuckle
         86    5.7   0.6    6.5e+02    2.9   0.0    2.4  2  PF00228  Bowman-Birk serine protease inhibitor family
      1e+02    5.3   0.2    2.7e+02    4.0   0.1    1.7  1  PF08042  PqqA family
    1.2e+02    5.4   0.0    2.7e+02    4.2   0.0    1.5  1  PF07927  YcfA-like protein
    1.3e+02    5.1   0.0    3.4e+02    3.8   0.0    1.7  1  PF01296  Galanin
    1.3e+02    4.9   0.1    2.2e+02    4.2   0.1    1.3  1  PF09003  Bacteriophage lambda integrase, N-terminal domain
      2e+02    4.7   0.1    3.4e+02    4.0   0.0    1.3  1  PF01215  Cytochrome c oxidase subunit Vb
    2.5e+02    3.6   0.1      5e+02    2.6   0.1    1.4  1  PF00641  Zn-finger in Ran binding protein and others
    2.8e+02    3.8   2.1    3.2e+02    3.6   1.5    1.1  1  PF00859  CTF/NF-I family transcription modulation region
    2.9e+02    2.0   0.0    3.6e+02    1.6   0.0    1.1  1  PF05327  RNA polymerase I specific transcription initiation 
    3.3e+02    3.7   0.2    6.4e+02    2.8   0.2    1.4  1  PF00037  4Fe-4S binding domain
    4.1e+02    2.6   0.2    4.9e+02    2.4   0.1    1.1  1  PF10738  Probable lipoprotein LpqN
    4.9e+02    3.1   0.1    8.7e+02    2.3   0.0    1.4  1  PF08054  Leucine operon leader peptide
    5.7e+02    3.1   0.0    9.2e+02    2.4   0.0    1.3  1  PF01381  Helix-turn-helix
    6.9e+02    0.9   0.0    8.4e+02    0.6   0.0    1.0  1  PF06934  Fatty acid cis/trans isomerase (CTI)
    8.7e+02    2.5   6.5    1.5e+02    5.0   0.7    2.3  1  PF12035  Protein of unknown function (DUF3521)
    1.2e+03    1.9   6.1    2.2e+03    1.0   3.2    2.3  1  PF05191  Adenylate kinase, active site lid


Domain and alignment annotation for each model:
>> PF01286  XPA protein N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0         1   3.5e+03      10      19 ..      31      40 ..      31      42 .. 0.87
   2 ?   12.5   0.1   0.00016      0.56       2      16 ..      90     104 ..      89     105 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 1
     PF01286 10 gkefmDSyLf 19
                +k+fm S++ 
  CIRT_00395 31 QKRFMVSFWT 40
                79******96 PP

  == domain 2    score: 12.5 bits;  conditional E-value: 0.00016
     PF01286   2 eyekCeeCgkefmDS 16 
                 e+e C+eCg++ +D+
  CIRT_00395  90 EPERCFECGSPHIDW 104
                 6899**********9 PP

>> PF04365  Protein of unknown function (DUF497)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0     0.002         7       5      45 ..      25      66 ..      22      70 .. 0.81

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.002
     PF04365  5 KnasNlkkH.gvsfeeaeelfndpllltledrresndEeRfi 45
                K  +  +k+  vsf +a  +fn ++l t +drr+ +d +R++
  CIRT_00395 25 KTPTSSQKRfMVSFWTAPAFFNSKTLKTRPDRRSCRDMHRYY 66
                55444555549**********************988988885 PP

>> PF04738  Lantibiotic dehydratase, C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0015       5.3     150     188 ..      55      93 ..      40     101 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0015
     PF04738 150 grqelrdyhekFlekygeealVpllelldsdsglgapag 188
                 +r++ rd+h+ +   +g+++++p++ l+d ++  g+p++
  CIRT_00395  55 DRRSCRDMHRYYHPLQGQRQPIPVDRLVDGNRSGGEPER 93 
                 67899*************************999999886 PP

>> PF09076  Streptomyces killer toxin-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.067   2.3e+02      34      56 ..      21      43 ..      12      47 .. 0.86
   2 ?    1.2   0.0      0.64   2.2e+03      51      61 ..      95     105 ..      93     106 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.067
     PF09076 34 hdanGttvayrkhyiisfptrpp 56
                 da  t  + +k +++sf t p 
  CIRT_00395 21 PDAKKTPTSSQKRFMVSFWTAPA 43
                5899999999**********997 PP

  == domain 2    score: 1.2 bits;  conditional E-value: 0.64
     PF09076  51 fptrpphvdwi 61 
                 f    ph+dw 
  CIRT_00395  95 FECGSPHIDWT 105
                 66678*****5 PP

>> PF01412  Putative GTPase activating protein for Arf
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0     0.006        21      12      27 ..      90     105 ..      80     112 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.006
                 CCCB-TTT--BS--EE CS
     PF01412  12 enkvCaDCgaknptWa 27 
                 e ++C++Cg+++ +W+
  CIRT_00395  90 EPERCFECGSPHIDWT 105
                 5589***********7 PP

>> PF09250  Bifunctional DNA primase/polymerase, N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.015        53       6      23 ..      12      35 ..      10      69 .. 0.74
   2 ?    0.0   0.0       1.4   4.7e+03     114     134 ..      82     113 ..      50     135 .. 0.62

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.015
                H-----EEE-TTTSSBS....... CS
     PF09250  6 arglaviPlkpgsKkPa......s 23
                + g++++P++  +K+P+      +
  CIRT_00395 12 KSGCSILPIPDAKKTPTssqkrfM 35
                569*************96555552 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 1.4
                 -----E..............EE.EE-TT--B-- CS
     PF09250 114 tkggdk............pgvDiradgngyvva 134
                  +g+++            p++D   dg gy +a
  CIRT_00395  82 VDGNRSggepercfecgsPHIDWTRDGAGY-LA 113
                 333333445567777777888887888888.44 PP

>> PF11781  RNA polymerase I-specific transcription initiation factor Rrn7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.3     0.012        41       4      26 ..      87     111 ..      84     112 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.012
     PF11781   4 akgpniaCgvCrsr..sffrsddGf 26 
                 + g++++C +C+s   +++r  +G+
  CIRT_00395  87 SGGEPERCFECGSPhiDWTRDGAGY 111
                 67999********999999999997 PP

>> PF09180  Prolyl-tRNA synthetase, C-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.021        73      40      62 ..      77     105 ..      74     111 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.021
     PF09180  40 Pld......eeekeggkCilcgkpAkkwv 62 
                 P+d      +  +e+++C+ cg p   w+
  CIRT_00395  77 PVDrlvdgnRSGGEPERCFECGSPHIDWT 105
                 55555556667799********9977776 PP

>> PF08271  TFIIB zinc-binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.026        90       2      11 ..      93     102 ..      92     111 .. 0.78

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.026
                 E-SSS--EEH CS
     PF08271   2 kCPnCgstel 11 
                 +C +Cgs+++
  CIRT_00395  93 RCFECGSPHI 102
                 8******997 PP

>> PF05254  Uncharacterised protein family (UPF0203)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.035   1.2e+02      23      46 ..      44      67 ..      38      71 .. 0.93

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.035
     PF05254 23 wysekFlkgdlaeneCeelfekYk 46
                +++ k lk + +++ C+++++ Y+
  CIRT_00395 44 FFNSKTLKTRPDRRSCRDMHRYYH 67
                8999****************9996 PP

>> PF03604  DNA directed RNA polymerase, 7 kDa subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.2     0.051   1.8e+02      15      25 ..      89      99 ..      86     100 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.051
     PF03604 15 gdpirCkeCGf 25
                g+p rC eCG+
  CIRT_00395 89 GEPERCFECGS 99
                67779****95 PP

>> PF01194  RNA polymerases N / 8 kDa subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.046   1.6e+02       4      13 ..      91     100 ..      90     106 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.046
                 -SS-S----- CS
     PF01194   4 PvrCftCGkv 13 
                 P rCf CG++
  CIRT_00395  91 PERCFECGSP 100
                 67******86 PP

>> PF00098  Zinc knuckle
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.2     0.048   1.6e+02       2       9 ..      93     100 ..      92     100 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.048
                 TBSTT--- CS
     PF00098   2 kCynCGke 9  
                 +C+ CG++
  CIRT_00395  93 RCFECGSP 100
                 7*****87 PP

>> PF00228  Bowman-Birk serine protease inhibitor family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.1       1.4   4.8e+03      14      21 ..      56      63 ..      50      65 .. 0.79
   2 ?    2.9   0.0      0.19   6.5e+02      10      16 ..     114     120 ..     105     120 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.4
                EEEECEEE CS
     PF00228 14 rcvCtDvf 21
                r  C D+ 
  CIRT_00395 56 RRSCRDMH 63
                789***96 PP

  == domain 2    score: 2.9 bits;  conditional E-value: 0.19
                 SSSTEEE CS
     PF00228  10 SiPPrcv 16 
                 S+P+rc+
  CIRT_00395 114 SYPARCR 120
                 9*****8 PP

>> PF08042  PqqA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.1     0.079   2.7e+02       3       8 ..      39      44 ..      35      45 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.079
     PF08042  3 WtkPkF 8 
                Wt+P+F
  CIRT_00395 39 WTAPAF 44
                *****9 PP

>> PF07927  YcfA-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.078   2.7e+02      23      39 ..      63      79 ..      62      83 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.078
                EEEE---.--EEEE--- CS
     PF07927 23 hilkhpgkkrrvtVPvH 39
                h+++hp  ++r ++Pv 
  CIRT_00395 63 HRYYHPLQGQRQPIPVD 79
                89*************86 PP

>> PF01296  Galanin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.099   3.4e+02       2      10 ..     104     112 ..     103     113 .. 0.94

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.099
     PF01296   2 WTLNSAGYL 10 
                 WT   AGYL
  CIRT_00395 104 WTRDGAGYL 112
                 ********9 PP

>> PF09003  Bacteriophage lambda integrase, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.1     0.064   2.2e+02      15      39 ..      49      73 ..      45      80 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.064
     PF09003 15 nLyarkdkrngkvYyqYrnPltgke 39
                 L  r d+r  +   +Y +Pl+g+ 
  CIRT_00395 49 TLKTRPDRRSCRDMHRYYHPLQGQR 73
                688999****************986 PP

>> PF01215  Cytochrome c oxidase subunit Vb
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.097   3.4e+02      79      89 ..      89      99 ..      85     102 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.097
                T-EEE-ST--- CS
     PF01215 79 kkatrCleCGs 89
                ++++rC+eCGs
  CIRT_00395 89 GEPERCFECGS 99
                6899******8 PP

>> PF00641  Zn-finger in Ran binding protein and others
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.15     5e+02      20      27 ..      93     100 ..      90     101 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.15
                 B-SSS--B CS
     PF00641  20 kCvaCqap 27 
                 +C+ C++p
  CIRT_00395  93 RCFECGSP 100
                 7*****98 PP

>> PF00859  CTF/NF-I family transcription modulation region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   1.5     0.092   3.2e+02     226     253 ..       4      31 ..       1      57 [. 0.80

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.092
     PF00859 226 laPpPpprlarPvslslPdtkPattste 253
                 l+P P p+      l++Pd+k + ts++
  CIRT_00395   4 LPPQPTPTKSGCSILPIPDAKKTPTSSQ 31 
                 89999999999999******99888865 PP

>> PF05327  RNA polymerase I specific transcription initiation factor RRN3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0       0.1   3.6e+02     369     384 ..     108     123 ..      98     127 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.1
     PF05327 369 AaaYlaSfvARAkfvs 384
                  a+YlaS+ AR + + 
  CIRT_00395 108 GAGYLASYPARCRALA 123
                 579********99875 PP

>> PF00037  4Fe-4S binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.2      0.19   6.4e+02       5      12 ..      91      98 ..      90      99 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.19
                TTTS---T CS
     PF00037  5 eekCigCG 12
                +e+C  CG
  CIRT_00395 91 PERCFECG 98
                89*****9 PP

>> PF10738  Probable lipoprotein LpqN
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.14   4.9e+02      37      90 ..       3      56 ..       1      62 [. 0.76

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.14
     PF10738 37 pdppapapasaqsivsttsttsaapaavpaaaavpsgtlaeyleekgvklepva 90
                p pp+p+p+ +  ++ ++++++ +p++  +   v+  t   ++++k  k +p +
  CIRT_00395  3 PLPPQPTPTKSGCSILPIPDAKKTPTSSQKRFMVSFWTAPAFFNSKTLKTRPDR 56
                667778887777777777888888998777888888889999999988888765 PP

>> PF08054  Leucine operon leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.25   8.7e+02      21      28 .]      80      87 ..      80      87 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.25
     PF08054 21 rlVgGiqh 28
                rlV+G+++
  CIRT_00395 80 RLVDGNRS 87
                89****97 PP

>> PF01381  Helix-turn-helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.27   9.2e+02      29      36 ..     129     136 ..     129     141 .] 0.88

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.27
                 HHTTSSGS CS
     PF01381  29 iEnGernP 36 
                 +EnG+rnP
  CIRT_00395 129 WENGRRNP 136
                 9******9 PP

>> PF06934  Fatty acid cis/trans isomerase (CTI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.24   8.4e+02     658     692 ..      32      66 ..      24      68 .. 0.91

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.24
     PF06934 658 rRsnpkfWevsdalekalkkeepveagllDlnRye 692
                 +R   +fW++   +++++ k++p   ++ D+ Ry+
  CIRT_00395  32 KRFMVSFWTAPAFFNSKTLKTRPDRRSCRDMHRYY 66 
                 577789***************************97 PP

>> PF12035  Protein of unknown function (DUF3521)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.7     0.042   1.5e+02       4      17 ..     109     122 ..     108     124 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.042
     PF12035   4 AlrlaGYqaygnll 17 
                 A+ la+Y+a +++l
  CIRT_00395 109 AGYLASYPARCRAL 122
                 7889*******987 PP

>> PF05191  Adenylate kinase, active site lid
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   3.2      0.63   2.2e+03       1      13 [.      56      82 ..      56     103 .. 0.62

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.63
                -EEETT---EEB..............T CS
     PF05191  1 RrvCpdCGrvYh..............i 13
                Rr+C+d  r Yh              +
  CIRT_00395 56 RRSCRDMHRYYHplqgqrqpipvdrlV 82
                99***9999999666555555555554 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (141 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       193  (0.0162021); expected 238.2 (0.02)
Passed bias filter:                      178  (0.0149429); expected 238.2 (0.02)
Passed Vit filter:                        29  (0.00243452); expected 11.9 (0.001)
Passed Fwd filter:                        29  (0.00243452); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              29  [number of targets reported over threshold]
# CPU time: 0.15u 0.02s 00:00:00.17 Elapsed: 00:00:00
# Mc/sec: 2029.37
//