# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/broad_1743.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CIRT_01687  [L=385]
Description: cimm2 CIRG_01684 Broad_Institute ""
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.4e-34  122.7   0.0    3.3e-34  121.6   0.0    1.6  1  PF06999  Sucrase/ferredoxin-like
  ------ inclusion threshold ------
       0.51   12.8   0.0        1.4   11.4   0.0    1.7  1  PF08069  Ribosomal S13/S15 N-terminal domain
        8.9    8.5   3.2        3.2    9.9   0.1    1.8  1  PF01160  Vertebrate endogenous opioids neuropeptide
         11    8.1   0.0         23    7.2   0.0    1.4  1  PF05082  Protein of unknown function (DUF683)
         14    8.1   0.1         30    7.0   0.1    1.5  1  PF05434  TMEM9
         21    7.4   0.0         44    6.4   0.0    1.5  1  PF01809  Domain of unknown function DUF37
         27    7.5   0.0         62    6.3   0.0    1.6  1  PF06726  Bladder cancer-related protein BC10
         34    7.1   0.0         73    6.0   0.0    1.5  1  PF04945  YHS domain
         53    6.2   0.0      1e+02    5.3   0.0    1.4  1  PF00278  Pyridoxal-dependent decarboxylase, C-terminal sheet
         68    4.7   0.0         96    4.2   0.0    1.1  1  PF02608  Basic membrane protein
         90    4.8   0.0    2.6e+02    3.3   0.0    1.6  1  PF01075  Glycosyltransferase family 9 (heptosyltransferase)
      1e+02    5.3   0.1    2.5e+02    4.0   0.0    1.6  1  PF04135  Nucleolar RNA-binding protein, Nop10p family
    1.1e+02    5.4   0.1    2.1e+02    4.5   0.1    1.4  1  PF10739  Protein of unknown function (DUF2550)
    1.3e+02    5.1   0.2    3.2e+02    3.8   0.1    1.6  1  PF08276  PAN-like domain
    1.5e+02    4.6   0.0    3.3e+02    3.5   0.0    1.5  1  PF06107  Bacterial protein of unknown function (DUF951)
    1.7e+02    4.6   0.5    4.3e+02    3.3   0.4    1.6  1  PF02150  RNA polymerases M/15 Kd subunit
    1.9e+02    4.5   0.3    6.8e+02    2.7   0.1    2.0  1  PF10905  Protein of unknown function (DUF2695)
    2.4e+02    3.5   0.2    5.3e+02    2.4   0.1    1.5  1  PF07710  P53 tetramerisation motif
    2.7e+02    3.8   0.5    6.1e+02    2.7   0.3    1.5  1  PF00284  Lumenal portion of Cytochrome b559, alpha (gene psb
    4.1e+02    3.2   0.0    8.1e+02    2.2   0.0    1.4  1  PF07796  Protein of unknown function (DUF1638)
    4.4e+02    3.3   4.2      1e+03    2.0   2.9    1.5  1  PF05283  Multi-glycosylated core protein 24 (MGC-24)
    4.5e+02    3.0   0.1    1.5e+03    1.4   0.0    1.7  1  PF05186  Dpy-30 motif
    6.3e+02    3.4   2.6    1.8e+03    1.9   1.8    1.7  1  PF12440  Melanoma associated antigen family N terminal
    6.3e+02    2.2   0.0      1e+03    1.5   0.0    1.2  1  PF09264  Vibrio cholerae sialidase, lectin insertion


Domain and alignment annotation for each model:
>> PF06999  Sucrase/ferredoxin-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.6   0.0   7.9e-38   3.3e-34       1     225 [.      87     369 ..      87     376 .. 0.85

  Alignments for each domain:
  == domain 1    score: 121.6 bits;  conditional E-value: 7.9e-38
     PF06999   1 plagtaksydkhllvetgpedWksealdekaavlqala.salaenkkklkvkiplssssgkiansslpetkrskkgevlllpdfieikllpenlkeefv 98 
                 +l+g +k  ++h+lv+tg++dW ++  dek +v++a+    +++++ +lk + + +  +++       + + ++ + vlllp+f  i  ++  l+ +++
  CIRT_01687  87 ELYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIErGGVSAKNGALKLSASNIPVPDEY----YHHPEGEQPTTVLLLPAFTIIDHVTPALVPNLI 181
                 58999*******************99999988888854145666666665555555555554....4467788999***********999888888888 PP

     PF06999  99 ealldekeeal.............................eallrqkllskkklegnreeknarivLvCsHgkrDkrCgitGplLkkefeaelaekglq 168
                  + +d+  ++                                 l++ ++s  ++  +r   +a+++L+Cs ++rD+rCg  +plL++efe++l+  gl+
  CIRT_01687 182 RQFVDLSPTTTtplsdvmqiagqeepteqtpsdiniperpPLDLKDLSESLPTSLRSRPCSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLY 280
                 88888888877899999*****************999998556677888888888999999************************************** PP

     PF06999 169 ddr.........valvSHiGGHkFAgnvliy............lkkt.............pegiwyGrvepehveaivqetiekgkvikel 225
                 +d+         + ++SH+GGHk+++nv++y               +              +giw++rv+pe+ e+iv+ t+ +gkv+k++
  CIRT_01687 281 RDLhderpggvgIYFISHVGGHKYSANVIVYrrrnfewfkegkD--DcsnnvesmekegaSQGIWLARVRPEDCEGIVKFTVLQGKVVKPG 369
                 *999999***99*******************7777776666550..15556666666777****************************986 PP

>> PF08069  Ribosomal S13/S15 N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.4   0.0   0.00033       1.4      11      46 ..     304     339 ..     297     341 .. 0.90

  Alignments for each domain:
  == domain 1    score: 11.4 bits;  conditional E-value: 0.00033
     PF08069  11 kSgstrpyrrtaPeWlklspeeveelivklakkGlt 46 
                  S  +++yrr+  eW+k  ++++ +++  + k+G +
  CIRT_01687 304 YSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGAS 339
                 688999****************************86 PP

>> PF01160  Vertebrate endogenous opioids neuropeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.1   0.00078       3.2      19      32 ..      64      77 ..      51      81 .. 0.82

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.00078
     PF01160 19 dCskdCasCaqqlq 32
                dC +dCasC+ + +
  CIRT_01687 64 DCDHDCASCTIKYP 77
                9********99865 PP

>> PF05082  Protein of unknown function (DUF683)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0054        23      23      35 ..     223     235 ..     220     239 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0054
                 HHHHHHHHTTT-- CS
     PF05082  23 mdLHDLaEdLpid 35 
                 +dL DL+E Lp+ 
  CIRT_01687 223 LDLKDLSESLPTS 235
                 69*********96 PP

>> PF05434  TMEM9
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.1    0.0072        30      22      49 ..      53      79 ..      36      83 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.0072
     PF05434 22 lhvvePvpvkGkdveayclrceckyeer 49
                  vv+P  v+G+d +  c+ c  ky ++
  CIRT_01687 53 FTVVDP-TVDGEDCDHDCASCTIKYPAK 79
                579999.9*****************765 PP

>> PF01809  Domain of unknown function DUF37
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.011        44      30      59 ..     326     354 ..     324     360 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.011
     PF01809  30 CSeYaiealekhGllkGlwlalkRilrChp 59 
                 CS+  +e++ek G+ +G+wla  R   C+ 
  CIRT_01687 326 CSN-NVESMEKEGASQGIWLARVRPEDCEG 354
                 665.5899**************99888875 PP

>> PF06726  Bladder cancer-related protein BC10
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.015        62      37      60 ..     235     259 ..     232     264 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.015
     PF06726  37 tvelkPcvycsiilgllikaic.rp 60 
                  ++++Pc ++++il+   k+ + r+
  CIRT_01687 235 SLRSRPCSHAAVILLCSQKTRDaRC 259
                 5899**********99888866666 PP

>> PF04945  YHS domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.018        73       7      22 ..      74      89 ..      68      90 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.018
                ---E...EEE----EE CS
     PF04945  7 vkkrakykleYeGkrY 22
                +k+ ak++++Ye+++Y
  CIRT_01687 74 IKYPAKFSVDYEDELY 89
                5555***********9 PP

>> PF00278  Pyridoxal-dependent decarboxylase, C-terminal sheet domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.024     1e+02      52      73 ..      45      66 ..      16      89 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.024
                -TTSSEEEEEEE-----TT--S CS
     PF00278 52 laeeptrkatlaGptCdsdDvi 73
                 a++p   +t+++pt d+ D+ 
  CIRT_01687 45 TAQSPSTLFTVVDPTVDGEDCD 66
                67899999************95 PP

>> PF02608  Basic membrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.023        96      76     148 ..      41     125 ..      38     143 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.023
                 HHHHHHH-TTS-EEEESS---S-.............TTEEEEE------------HHHHHHHH----EE-EEE------THHHH- CS
     PF02608  76 lqevasdypktkFliiDavveker............kNvvsvaFrseegafLaGvaaAlmskenkigflgkivGveipvvksfin 148
                 ++ ++ + p+t F ++D++v+ e             +   sv +  e      G a+ ++ +++k + + +++  ++ v+++ + 
  CIRT_01687  41 SKVITAQSPSTLFTVVDPTVDGEDcdhdcasctikyPAKFSVDYEDELYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIER 125
                 678999***************9999999999999888888999999999999999999999999999998888888888777665 PP

>> PF01075  Glycosyltransferase family 9 (heptosyltransferase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.063   2.6e+02     195     237 ..     170     212 ..     167     219 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.063
                 HHHHHHTT--EEEEE----TTSS----TTEEEEES---.---- CS
     PF01075 195 mHlAaAldrpviglygatdpvrtgplskrativsskreklpel 237
                  H++ Al   +i  +++ +p+ t pls+   i +++++  +++
  CIRT_01687 170 DHVTPALVPNLIRQFVDLSPTTTTPLSDVMQIAGQEEPTEQTP 212
                 6*****************************9999888876665 PP

>> PF04135  Nucleolar RNA-binding protein, Nop10p family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.061   2.5e+02      18      38 ..      63      83 ..      59      86 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.061
                SB-S----B-EESS--S--TT CS
     PF04135 18 dkcpecGgetksahParFSPe 38
                + c+++ +  ++  Pa+FS++
  CIRT_01687 63 EDCDHDCASCTIKYPAKFSVD 83
                7788888889999******87 PP

>> PF10739  Protein of unknown function (DUF2550)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1      0.05   2.1e+02      14      57 ..     279     320 ..     274     323 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.05
     PF10739  14 vrrrlllrrlggvecilrelpasggrgWrlGvlrYagdelewyr 57 
                 ++r l   r ggv ++    ++ gg++ ++ v+ Y++ ++ew++
  CIRT_01687 279 LYRDLHDERPGGVGIYFI--SHVGGHKYSANVIVYRRRNFEWFK 320
                 566666666677777766..8999*******************8 PP

>> PF08276  PAN-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1     0.078   3.2e+02      14      39 ..      46      71 ..      40      74 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.078
     PF08276 14 vklPdtsaavvdksisleeCeerCls 39
                 + P t  +vvd +++ e+C + C s
  CIRT_01687 46 AQSPSTLFTVVDPTVDGEDCDHDCAS 71
                5679999999*999**********75 PP

>> PF06107  Bacterial protein of unknown function (DUF951)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.079   3.3e+02      35      53 ..     257     275 ..     252     277 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.079
     PF06107  35 lgCghivmlpRskfekklk 53 
                  +Cg++  l R++fe++l+
  CIRT_01687 257 ARCGQSAPLLRREFERHLR 275
                 68**************987 PP

>> PF02150  RNA polymerases M/15 Kd subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.4       0.1   4.3e+02      17      32 ..      62      78 ..      58      80 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.1
                TTTTE.EESSSS-EEE- CS
     PF02150 17 kegrn.aCrqCgYeepa 32
                 e    +C++C  ++pa
  CIRT_01687 62 GEDCDhDCASCTIKYPA 78
                5554469********98 PP

>> PF10905  Protein of unknown function (DUF2695)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.16   6.8e+02       1      16 [.      52      67 ..      52      85 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.16
     PF10905  1 LlsyvdekleafgCDh 16
                L+  vd  +  ++CDh
  CIRT_01687 52 LFTVVDPTVDGEDCDH 67
                6888************ PP

>> PF07710  P53 tetramerisation motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.13   5.3e+02      18      26 ..     313     321 ..     310     325 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.13
     PF07710  18 RerYEmLkk 26 
                 R+++E++k+
  CIRT_01687 313 RRNFEWFKE 321
                 99******8 PP

>> PF00284  Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.3      0.15   6.1e+02       9      23 ..     143     157 ..     142     159 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.15
                 --CCGSS-SS--S-- CS
     PF00284   9 PRPneYFteerqelP 23 
                 P P+eY+   + e P
  CIRT_01687 143 PVPDEYYHHPEGEQP 157
                 77*****98887776 PP

>> PF07796  Protein of unknown function (DUF1638)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0       0.2   8.1e+02      38      65 ..     325     354 ..     324     359 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.2
     PF07796  38 lCgnglglleedleelg..vlrpkvddCis 65 
                 +C+n+++ +e++ +++g  + r++ +dC +
  CIRT_01687 325 DCSNNVESMEKEGASQGiwLARVRPEDCEG 354
                 7****************888889999*965 PP

>> PF05283  Multi-glycosylated core protein 24 (MGC-24)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   2.9      0.25     1e+03     105     162 ..      13      71 ..       9      73 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.25
     PF05283 105 scsvattt.svptanstaapnitnatttsaakttsvpktnttvtPasqeerkstFDaAs 162
                 s+s++++  sv+  ++t+ p++ + + +s+  t++ p+t  tv  ++ +      D As
  CIRT_01687  13 SPSASPAPsSVSDYEATSVPATGKPAVASKVITAQSPSTLFTVVDPTVDGEDCDHDCAS 71 
                 677777654899999*******999999**********998887665557778888887 PP

>> PF05186  Dpy-30 motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.35   1.5e+03      21      28 ..     344     351 ..     342     351 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.35
     PF05186  21 lakeRPeD 28 
                 la++RPeD
  CIRT_01687 344 LARVRPED 351
                 8******9 PP

>> PF12440  Melanoma associated antigen family N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   1.8      0.43   1.8e+03      36      71 ..      16      51 ..      11      64 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.43
     PF12440 36 stsssspliegtpesvpaagspsppqspqgasstst 71
                +++ +s+++   + svpa+g p +  +   a+s+st
  CIRT_01687 16 ASPAPSSVSDYEATSVPATGKPAVASKVITAQSPST 51
                456677788899999****99999999999999887 PP

>> PF09264  Vibrio cholerae sialidase, lectin insertion
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.24     1e+03      43      90 ..      60     107 ..      51     115 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.24
     PF09264  43 vdgaanriqvadgarkyvvtlavdesgqlvaqlngvsapvvlalesad 90 
                 vdg     ++a  + ky   ++vd   +l  +++g ++ v++a+ ++d
  CIRT_01687  60 VDGEDCDHDCASCTIKYPAKFSVDYEDELYGHVKGWATHVLVATGKTD 107
                 677777788899999*************************99987665 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (385 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       254  (0.021323); expected 238.2 (0.02)
Passed bias filter:                      219  (0.0183848); expected 238.2 (0.02)
Passed Vit filter:                        24  (0.00201478); expected 11.9 (0.001)
Passed Fwd filter:                        24  (0.00201478); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              24  [number of targets reported over threshold]
# CPU time: 0.25u 0.03s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 3324.71
//