# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/broad_1748.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CIRT_02186  [L=567]
Description: cimm2 CIRG_02183 Broad_Institute ""
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      2e-17   65.6   0.9    4.6e-17   64.4   0.6    1.7  1  PF01565  FAD binding domain
    2.9e-09   39.3   1.0    5.4e-09   38.4   0.1    2.0  1  PF08031  Berberine and berberine like
  ------ inclusion threshold ------
        6.6    8.6   0.6         80    5.2   0.0    2.8  1  PF11880  Domain of unknown function (DUF3400)
         13    8.1   0.0         32    6.9   0.0    1.5  1  PF07359  Liver-expressed antimicrobial peptide 2 precursor (
         16    7.2   0.0         24    6.6   0.0    1.2  1  PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin bindin
         40    6.7   0.0         96    5.5   0.0    1.6  1  PF05810  NinF protein
         50    5.7   0.0         91    4.8   0.0    1.3  1  PF07678  A-macroglobulin complement component
         67    5.7   0.1    1.5e+02    4.6   0.0    1.5  1  PF06689  ClpX C4-type zinc finger
         81    5.8   0.1    2.7e+02    4.2   0.0    1.9  1  PF08077  Chloramphenicol resistance gene leader peptide
         87    5.6   1.1    1.7e+02    4.7   0.8    1.4  1  PF00642  Zinc finger C-x8-C-x5-C-x3-H type (and similar)
         88    6.3   0.0    2.2e+02    5.1   0.0    1.6  1  PF00788  Ras association (RalGDS/AF-6) domain
         95    5.2   0.0    1.6e+02    4.5   0.0    1.2  1  PF10278  Mediator of RNA pol II transcription subunit 19
    1.1e+02    4.4   0.0    2.9e+02    3.0   0.0    1.6  1  PF01116  Fructose-bisphosphate aldolase class-II
    1.4e+02    5.2   0.0    5.2e+02    3.3   0.0    1.9  1  PF07943  Penicillin-binding protein 5, C-terminal domain
    1.4e+02    4.3   0.0    3.1e+02    3.1   0.0    1.5  1  PF07402  Human herpesvirus U26 protein
    2.6e+02    3.7   0.0      5e+02    2.8   0.0    1.4  1  PF04030  D-arabinono-1,4-lactone oxidase
    2.6e+02    4.1   0.0      5e+02    3.2   0.0    1.4  1  PF09957  Uncharacterized protein conserved in bacteria (DUF2
    3.7e+02    3.4   0.0    7.4e+02    2.5   0.0    1.5  1  PF00635  MSP (Major sperm protein) domain
    3.8e+02    3.5   0.7    8.5e+02    2.4   0.5    1.5  1  PF11425  Toxin BmKK4
    4.2e+02    2.9   0.0    9.3e+02    1.7   0.0    1.5  1  PF09802  Preprotein translocase subunit Sec66
    4.7e+02    2.4   0.0    8.4e+02    1.5   0.0    1.3  1  PF02578  Multi-copper polyphenol oxidoreductase laccase
    5.2e+02    2.2   0.1    8.6e+02    1.5   0.0    1.2  1  PF02548  Ketopantoate hydroxymethyltransferase
    5.3e+02    3.2   0.8    1.2e+03    2.1   0.5    1.5  1  PF10283  Zinc-finger (CX5CX6HX5H) motif
    5.4e+02    3.4   0.0    1.1e+03    2.4   0.0    1.4  1  PF08951  Enterocin A Immunity
    5.6e+02    1.9   0.0      1e+03    1.1   0.0    1.3  1  PF04541  Herpesvirus virion protein U34
    1.5e+03    1.5   1.7    1.6e+03    1.4   0.1    1.7  1  PF09065  Haemadin
    1.7e+03    1.1   0.2    3.6e+03    0.1   0.1    1.4  1  PF12579  Protein of unknown function (DUF3755)


Domain and alignment annotation for each model:
>> PF01565  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.4   0.6   1.3e-20   4.6e-17       3     137 ..     124     269 ..     122     270 .. 0.86

  Alignments for each domain:
  == domain 1    score: 64.4 bits;  conditional E-value: 1.3e-20
                 EEEEESSHHHHHHHHHHHHHCT-CEEEE-----EESTTC.S-EEEEEGTT---EEEECT...........TTTEEEEE---BHHHHHHHHHHC-TBBS- CS
     PF01565   3 avvrpeseeevaaivrlarekglpvlvrGgGssllgqav.tggvvldlsrlnrileide...........eegtatveaGvtlgdleealaakglllgl 89 
                 + v  +s+++++++v++a++k+l ++v  +G+  lg ++ +g++ l + ++++ +++ +               +t++aG+++ d+++a+a++g ++ +
  CIRT_02186 124 YSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSgQGAFSLWTHNMKGREWHTSfipkgapqettGIPAVTLQAGEQWLDVYRAAAENG-VIVV 221
                 567889*****************************77766999***9977***555555777777765433567****************5555.5556 PP

                 GGGTCCGSB---TTTTT-----TTCH..HHHHEEEEEEEET---EEEE CS
     PF01565  90 epgslipgtvGGaiatngggygsekyGlirdnvlslevvladGevvrl 137
                   ++   g  GG++ ++g+ + s+ yGl+ dn+l++ +v+a+G+ +++
  CIRT_02186 222 GGSARTVGAAGGYLTGGGHSPFSHFYGLAVDNLLEVNLVDANGTPRTI 269
                 78888888***********************************98876 PP

>> PF08031  Berberine and berberine like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.4   0.1   1.5e-12   5.4e-09       1      42 [.     516     555 ..     516     560 .. 0.94

  Alignments for each domain:
  == domain 1    score: 38.4 bits;  conditional E-value: 1.5e-12
                 --GGG--TTS-HCCHHHCCCGGGHHHHHHHHHHH-TT--S-- CS
     PF08031   1 aYvNyrdldlgarewgekYfggNyerLvkvKtkyDPdnvFrn 42 
                 +YvN +++ ++  +w+  ++g+ y+rL ++K+++DP+n+F  
  CIRT_02186 516 TYVNEANPYEP--DWQNVFWGEKYARLLAIKKRIDPTNLFVC 555
                 5**********..***************************65 PP

>> PF11880  Domain of unknown function (DUF3400)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.022        80      24      40 ..     203     219 ..     200     220 .. 0.93

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.022
     PF11880  24 GenWlqdYvakanaGGi 40 
                 Ge+Wl+ Y a a++G i
  CIRT_02186 203 GEQWLDVYRAAAENGVI 219
                 9*************976 PP

>> PF07359  Liver-expressed antimicrobial peptide 2 precursor (LEAP-2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0    0.0086        32      25      59 ..     453     488 ..     450     500 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.0086
     PF07359  25 vpevssakrrprrmtpfwr.avslrpigascrddse 59 
                 + +vssakr      p+w  + +l    a  rdd+ 
  CIRT_02186 453 IGKVSSAKRDETSTHPIWEqSRALLSFAANWRDDAS 488
                 6789**************625689999******986 PP

>> PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0    0.0065        24     245     273 ..     523     552 ..     475     557 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0065
                 SSHHHHHHH-.-HHHHHHHHHHHHH-TT-- CS
     PF09265 245 tsqeeWkrHF.GakwerfverKakyDPkai 273
                   +++W++ F G+k+ r  + K++ DP ++
  CIRT_02186 523 PYEPDWQNVFwGEKYARLLAIKKRIDPTNL 552
                 45789*775549***************987 PP

>> PF05810  NinF protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.026        96      24      43 ..     544     563 ..     538     566 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.026
     PF05810  24 gkkLevdEvhvCeeCvaeal 43 
                  k++++  ++vC+ Cv   +
  CIRT_02186 544 KKRIDPTNLFVCNRCVGTDI 563
                 58999***********8765 PP

>> PF07678  A-macroglobulin complement component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.024        91      12      58 ..     163     207 ..     157     219 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.024
     PF07678  12 sdgsYsafekdksgstWLtAfvvkvlsqakkfifidekkiekslewL 58 
                  +g++s ++++ +g  W t+f+ k     +++++i    ++   +wL
  CIRT_02186 163 GQGAFSLWTHNMKGREWHTSFIPKGA--PQETTGIPAVTLQAGEQWL 207
                 579*****9999**********9953..4455555555555555555 PP

>> PF06689  ClpX C4-type zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.041   1.5e+02      21      31 ..     549     559 ..     545     561 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.041
     PF06689  21 pngvyICdeCv 31 
                 p++ ++C++Cv
  CIRT_02186 549 PTNLFVCNRCV 559
                 6789******9 PP

>> PF08077  Chloramphenicol resistance gene leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.072   2.7e+02       1       9 [.     385     393 ..     385     395 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.072
     PF08077   1 MSGVPGALA 9  
                 M GV GALA
  CIRT_02186 385 MQGVSGALA 393
                 89******9 PP

>> PF00642  Zinc finger C-x8-C-x5-C-x3-H type (and similar)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.8     0.045   1.7e+02      14      21 ..      28      35 ..      25      35 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.045
                -------- CS
     PF00642 14 tCpyGdrC 21
                 C+yGd+C
  CIRT_02186 28 RCSYGDSC 35
                7******* PP

>> PF00788  Ras association (RalGDS/AF-6) domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.059   2.2e+02      19      39 ..     311     331 ..     295     337 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.059
     PF00788  19 ktikvsststaqeVieallek 39 
                 +  +v+++st + Vie++l+ 
  CIRT_02186 311 VQFNVTNNSTLRAVIEKCLQE 331
                 5679***************97 PP

>> PF10278  Mediator of RNA pol II transcription subunit 19
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.043   1.6e+02      60      89 ..     316     342 ..     305     347 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.043
     PF10278  60 kenssLrsliekPPiggkellpltsaalaG 89 
                 ++ns+Lr++iek   + +el  +t a  +G
  CIRT_02186 316 TNNSTLRAVIEK---CLQELPSITDAGYTG 342
                 589*********...455666666665555 PP

>> PF01116  Fructose-bisphosphate aldolase class-II
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0     0.077   2.9e+02      17      37 ..     308     328 ..     304     340 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.077
                 -----EE--SHHHHHHHHHHH CS
     PF01116  17 yAvpafnvnnletiqavleaa 37 
                 +++ +fnv+n++t++av+e +
  CIRT_02186 308 VGLVQFNVTNNSTLRAVIEKC 328
                 68899*************986 PP

>> PF07943  Penicillin-binding protein 5, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.14   5.2e+02      24      46 ..     136     158 ..     124     161 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.14
                 SEEEE---S-EEEEEE---GGG- CS
     PF07943  24 kevplvakediyltvpkgekkkl 46 
                 + v+ +a++++yltv+++ +++l
  CIRT_02186 136 TAVKFAAQKELYLTVKNTGHDHL 158
                 56999************999886 PP

>> PF07402  Human herpesvirus U26 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.085   3.1e+02      80     116 ..     306     342 ..     292     349 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.085
     PF07402  80 lslvvliflifseirlrailsrcvlilpsysmavytg 116
                 + + ++ f +  +  lra++ +c+  lps + a ytg
  CIRT_02186 306 IQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTG 342
                 555666777788889********************99 PP

>> PF04030  D-arabinono-1,4-lactone oxidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.13     5e+02     234     253 ..     535     554 ..     525     559 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.13
     PF04030 234 pdlkeflkvRkelDPegvFl 253
                 ++  + l+++k++DP+++F+
  CIRT_02186 535 EKYARLLAIKKRIDPTNLFV 554
                 7788999************8 PP

>> PF09957  Uncharacterized protein conserved in bacteria (DUF2191)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.13     5e+02      18      35 ..     315     332 ..     313     332 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.13
     PF09957  18 ltglktkrelVelALrtL 35 
                 +t+  t r+++e +L++L
  CIRT_02186 315 VTNNSTLRAVIEKCLQEL 332
                 677889**********98 PP

>> PF00635  MSP (Major sperm protein) domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0       0.2   7.4e+02       2      33 ..     126     157 ..     125     159 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.2
                 CEEESSSEEEE----SS-EEEEEEEEB-SSS- CS
     PF00635   2 lkidPsdllvfaaegnkqgtsklklkNpsekr 33 
                 ++i++++++  a ++  q++ +l++kN+  ++
  CIRT_02186 126 VNIQSTSDIQTAVKFAAQKELYLTVKNTGHDH 157
                 6889999999999999999*********9887 PP

>> PF11425  Toxin BmKK4
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.5      0.23   8.5e+02      19      24 ..      28      33 ..      26      37 .. 0.78

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.23
                EE---- CS
     PF11425 19 RCSYGT 24
                RCSYG 
  CIRT_02186 28 RCSYGD 33
                9****4 PP

>> PF09802  Preprotein translocase subunit Sec66
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.25   9.3e+02     131     145 ..     518     532 ..     515     547 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.25
     PF09802 131 vqEaeaykpgWgqti 145
                 v+Ea+ y+p+W +++
  CIRT_02186 518 VNEANPYEPDWQNVF 532
                 89*********9887 PP

>> PF02578  Multi-copper polyphenol oxidoreductase laccase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.23   8.4e+02     202     232 ..      68      98 ..      51      99 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.23
                 EEEEEETTT-TTT---CCC------EEEEEE CS
     PF02578 202 essdlCTyceperffSyRregktgrmasliv 232
                 +++ +CT+++++ + S+ r+++tg   ++ +
  CIRT_02186  68 YDDAKCTAAKENWLDSFWRTNQTGAYSAILW 98 
                 45678******************98777665 PP

>> PF02548  Ketopantoate hydroxymethyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.23   8.6e+02     107     136 ..     193     222 ..     188     241 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.23
     PF02548 107 agadavkleggeelaetvkalveagipVmg 136
                 +g+ av l++ge+ +++ +a +e+g+ V+g
  CIRT_02186 193 TGIPAVTLQAGEQWLDVYRAAAENGVIVVG 222
                 7899************************87 PP

>> PF10283  Zinc-finger (CX5CX6HX5H) motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.5      0.31   1.2e+03       2       9 ..      28      35 ..      27      37 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.31
     PF10283  2 dCpYGanC 9 
                 C YG++C
  CIRT_02186 28 RCSYGDSC 35
                5******* PP

>> PF08951  Enterocin A Immunity
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0       0.3   1.1e+03      18      36 ..     314     332 ..     311     338 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.3
                 THCSGHHHHHHHHHHHHHH CS
     PF08951  18 ninaneelrelLlkaakkl 36 
                 n+ +n+ lr++++k+ ++l
  CIRT_02186 314 NVTNNSTLRAVIEKCLQEL 332
                 68899************98 PP

>> PF04541  Herpesvirus virion protein U34
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.27     1e+03      87     114 ..     105     132 ..     104     139 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.27
     PF04541  87 kcFlsePrdaqsgaltaeesnviLkkne 114
                 +cF+  Prda+  +  + + +v+ ++++
  CIRT_02186 105 QCFIDSPRDAPCDQGIVPHYSVNIQSTS 132
                 8*********988888889999889887 PP

>> PF09065  Haemadin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.1      0.43   1.6e+03       8      14 ..      29      35 ..      26      37 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.43
                E----EE CS
     PF09065  8 CLYGQSC 14
                C YG SC
  CIRT_02186 29 CSYGDSC 35
                99***** PP

>> PF12579  Protein of unknown function (DUF3755)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.1      0.97   3.6e+03      11      17 ..     429     435 ..     428     435 .. 0.95

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.97
     PF12579  11 LFcrtRd 17 
                 L++rtRd
  CIRT_02186 429 LLHRTRD 435
                 9*****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (567 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       237  (0.0198959); expected 238.2 (0.02)
Passed bias filter:                      209  (0.0175453); expected 238.2 (0.02)
Passed Vit filter:                        27  (0.00226662); expected 11.9 (0.001)
Passed Fwd filter:                        27  (0.00226662); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              27  [number of targets reported over threshold]
# CPU time: 0.33u 0.03s 00:00:00.36 Elapsed: 00:00:00
# Mc/sec: 3709.39
//