# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/broad_1756.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CIRT_02989  [L=1343]
Description: cimm2 CIRG_02986 Broad_Institute ""
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      3e-89  301.8  36.3    1.5e-46  161.7  11.6    2.1  2  PF00664  ABC transporter transmembrane region
    3.6e-40  139.6   0.0    2.3e-18   69.3   0.0    2.6  2  PF00005  ABC transporter
    4.1e-14   55.0   0.0     0.0005   22.0   0.0    4.0  4  PF02463  RecF/RecN/SMC N terminal domain
    3.1e-06   29.1   0.5       0.32   12.8   0.1    3.2  3  PF03193  Protein of unknown function, DUF258
    2.2e-05   26.0   2.4      0.099   13.9   0.0    2.8  2  PF09818  Predicted ATPase of the ABC class
     0.0012   21.7   4.3         57    6.6   0.0    4.3  3  PF00004  ATPase family associated with various cellular acti
     0.0012   21.0   0.1        2.8   10.0   0.0    2.8  2  PF00448  SRP54-type protein, GTPase domain
     0.0015   20.0   0.3       0.61   11.5   0.0    2.2  2  PF03215  Rad17 cell cycle checkpoint protein
     0.0043   19.4   0.6         10    8.4   0.0    3.0  2  PF07728  AAA domain (dynein-related subfamily)
     0.0073   18.7   0.3         11    8.4   0.0    3.0  2  PF03205  Molybdopterin guanine dinucleotide synthesis protei
  ------ inclusion threshold ------
      0.084   14.6   0.5         28    6.4   0.0    3.1  2  PF06414  Zeta toxin
       0.12   15.2   0.1         22    7.9   0.0    2.9  2  PF00910  RNA helicase
       0.66   12.2   0.0         80    5.4   0.0    2.5  2  PF00485  Phosphoribulokinase / Uridine kinase family
       0.93   11.9   1.5         96    5.3   0.1    2.7  2  PF01935  Domain of unknown function DUF87
        1.3   11.1   0.6    1.9e+02    4.0   0.0    3.0  2  PF01695  IstB-like ATP binding protein
        1.3   11.3   0.5         78    5.5   0.0    2.6  2  PF05729  NACHT domain
        1.7   10.8   0.2         31    6.7   0.0    2.4  2  PF03029  Conserved hypothetical ATP binding protein
        3.6    9.9   0.1      1e+02    5.2   0.0    2.7  2  PF01583  Adenylylsulphate kinase
         10    8.2   0.1    3.2e+02    3.3   0.0    2.3  2  PF00625  Guanylate kinase
         11    8.4   0.0         28    7.1   0.0    1.6  1  PF04076  Bacterial OB fold (BOF) protein
         13    7.2   1.2         64    4.9   0.0    2.2  2  PF00931  NB-ARC domain
         22    7.8   1.2    1.1e+02    5.6   0.9    2.1  1  PF03376  Adenovirus E3B protein
         22    7.4   1.1    5.2e+02    3.0   0.7    2.7  2  PF09047  MEF2 binding
         27    5.4   0.0         49    4.5   0.0    1.3  1  PF11062  Protein of unknown function (DUF2863)
         27    7.9   0.0    7.3e+02    3.3   0.0    2.8  2  PF08477  Miro-like protein
         29    7.2   0.2    2.5e+02    4.2   0.0    2.3  1  PF05014  Nucleoside 2-deoxyribosyltransferase
         29    7.0   0.0         98    5.3   0.0    1.9  1  PF11347  Protein of unknown function (DUF3148)
         31    7.0   0.7    1.2e+03    1.9   0.0    3.2  2  PF09003  Bacteriophage lambda integrase, N-terminal domain
         39    6.9   0.0    1.1e+02    5.5   0.0    1.7  1  PF07293  Protein of unknown function (DUF1450)
         41    6.5   0.0    1.4e+02    4.8   0.0    1.9  1  PF00205  Thiamine pyrophosphate enzyme, central domain
         45    7.1   0.0    1.1e+02    5.9   0.0    1.5  1  PF00277  Serum amyloid A protein
         45    6.5   0.0    1.1e+02    5.3   0.0    1.6  1  PF09122  Domain of unknown function (DUF1930)
         58    4.4   0.0         98    3.6   0.0    1.3  1  PF03387  Herpesvirus UL46 protein
         70    5.6   0.1    2.6e+02    3.8   0.0    2.1  1  PF00036  EF hand
         82    4.3   9.7        4.1    8.6   0.1    2.9  1  PF09972  Predicted membrane protein (DUF2207)
    1.2e+02    4.3   0.9    3.5e+02    2.8   0.0    2.0  1  PF04548  AIG1 family
    1.3e+02    5.0   0.0    1.1e+03    2.0   0.0    2.2  1  PF08303  tRNA ligase kinase domain
    1.3e+02    4.8   0.1    2.9e+02    3.6   0.1    1.5  1  PF04127  DNA / pantothenate metabolism flavoprotein
    1.3e+02    5.1   0.1    3.9e+02    3.6   0.0    1.7  1  PF10506  PDZ domain of MCC-2 bdg protein for Usher syndrome
    2.2e+02    4.4   0.2    1.3e+03    1.9   0.0    2.4  1  PF07625  Protein of unknown function (DUF1586)
    2.3e+02    4.4   0.2    7.6e+02    2.7   0.1    1.8  1  PF09551  Stage II sporulation protein R (spore_II_R)
    3.4e+02    3.1   0.1    7.2e+02    2.0   0.1    1.4  1  PF11153  Protein of unknown function (DUF2931)
    3.9e+02    3.7   0.0    8.3e+02    2.6   0.0    1.4  1  PF03711  Orn/Lys/Arg decarboxylase, C-terminal domain
    4.1e+02    3.4   0.2    9.5e+02    2.2   0.1    1.5  1  PF09744  JNK_SAPK-associated protein-1
    5.1e+02    3.8   0.0    1.4e+03    2.4   0.0    1.7  1  PF04648  Yeast mating factor alpha hormone
    6.1e+02    3.1   2.4      2e+03    1.5   1.7    1.9  1  PF03183  Borrelia repeat protein
    7.7e+02    0.6   0.0    1.3e+03   -0.2   0.0    1.2  1  PF06046  Exocyst complex component Sec6
    1.4e+03    1.6   0.6    2.7e+03    0.8   0.4    1.3  1  PF06512  Sodium ion transport-associated
    1.5e+03    1.7   0.2    3.3e+03    0.6   0.2    1.5  1  PF12107  Plasminogen (Pg) ligand in fibrinolytic pathway
    1.8e+03    0.9   0.0    3.7e+03   -0.2   0.0    1.4  1  PF03543  Yersinia/Haemophilus virulence surface antigen
    2.1e+03    0.3   0.1    3.9e+03   -0.5   0.1    1.2  1  PF04997  RNA polymerase Rpb1, domain 1
    5.4e+03    0.8   0.7    1.6e+04   -0.7   0.5    1.6  1  PF08248  Tryptophyllin-3 skin active peptide


Domain and alignment annotation for each model:
>> PF00664  ABC transporter transmembrane region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  161.7  11.6   7.7e-50   1.5e-46       1     275 []     102     381 ..     102     384 .. 0.89
   2 !  146.0   8.0   4.8e-45   9.2e-42       4     272 ..     776    1048 ..     773    1051 .. 0.94

  Alignments for each domain:
  == domain 1    score: 161.7 bits;  conditional E-value: 7.7e-50
                 HHHHHHHHHHHHHHHHHHHHH---HHHH.......-SCCHHHHHHHHHHHHHHH---HHHHHHHHHHHHHH--HHHHHHHHHHHHHHCCC-HHHHCS.. CS
     PF00664   1 lllailllilagvtalvfplllgrllds.......vsdgndeersslyslailliavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsff 92 
                 ll++ +++i +g++ ++f++l+g++  +       ++++ de++ +l  +a++++++g++ + l+++ + ++++tg++i ++++ ++l+ +l++   ff
  CIRT_02989 102 LLVSAVASIAGGAALPLFTILFGQMAGTfqriilgTISY-DEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFF 199
                 578999*************************77743333.33566666666666666666666666666667799999999999999999999999999 PP

                 .SS----HHHHHHHHHHHHH-----HHHHHHHHHHHH----HHHHH---THHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH---CCCHHHHTHC CS
     PF00664  93 dknsvGellsrltnDvskirdglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEalsgir 191
                 dk  +Ge+++r+t D++ i+dg+++k+gl +++latfv++++++f+  wkltl++ ++++ ++ + +  ++ + +++kk  ++y++ g+vaeE+ls ir
  CIRT_02989 200 DKLGAGEITTRITADTNLIQDGISEKVGLTLTALATFVTAFVIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNVESYGEGGTVAEEVLSSIR 298
                 99************************************************************************************************* PP

                 CCCT-SSHHCHHHHHHHHHHHHHHHHHHCCHHHHHCHHHHHHHHHHHHHHHHH---TGSCGTSSTTHHHHHHHHHHHH---TTT CS
     PF00664 192 tVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgelsvgtvfaflslglqlsgpl 275
                    afg +ek  ++y+ +l ea+k+g k + t g++ g + +i++l y l +w+g+ + ++sge  + ++++ l+ +++ s++l
  CIRT_02989 299 NATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGFWMGSRF-IVSGETELANIITILLAIIIGSFSL 381
                 **********************************************************.7777777777777777777666654 PP

  == domain 2    score: 146.0 bits;  conditional E-value: 4.8e-45
                  HHHHHHHHHHHHHHHHHH---HHHH.......-SCCHHHHHHHHHHHHHHH---HHHHHHHHHHHHHH..--HHHHHHHHHHHHHHCCC-HHHHCS. CS
     PF00664    4 ailllilagvtalvfplllgrllds.......vsdgndeersslyslailliavgvlivlllqgsfyl..lertgqrirkrlfrallrkilglfdsf 91  
                  ++ ++i+ g+  +++++++++ ++        +++   +++ + ++l++l+++++++++ ++qgs++   +e+++ r+r++ fr++lr+++ +fd  
  CIRT_02989  776 GLAVSIICGAGQPTMAVFFSKCISAlalppplYDKL--RSDANFWCLMFLMLGIVMFFAYSIQGSLFAycSEKLIYRARSKAFRSMLRQDIAFFDV- 869 
                  667889999999999999999999988777644444..468***********************988888**************************. PP

                  ..SS----HHHHHHHHHHHHH-----HHHHHHHHHHHH----HHHHH---THHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH---CCCHHHH CS
     PF00664   92 fdknsvGellsrltnDvskirdglgdklglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEals 188 
                   d+ns+G+l+s l++++  ++   g +lg++++  +t+ + ++v++ +gwkl+lv+++++p+l+ + +++  il  +q++ +kay  + ++a Ea s
  CIRT_02989  870 -DENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASMVVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRAKKAYEASASYACEATS 965 
                  .************************************************************************************************ PP

                  THCCCCT-SSHHCHHHHHHHHHHHHHHHHHHCCHHHHHCHHHHHHHHHHHHHHHHH---TGSCGTSSTTHHHHHHHHHHHH--- CS
     PF00664  189 girtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgelsvgtvfaflslglqls 272 
                  +irtV ++++e+ +   y+ +l    k+++ ++  ++ l +++q+++++++al +w+g++l    ge+++ ++f+++s +++ +
  CIRT_02989  966 AIRTVASLTREPDVSGTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTL-LGKGEYTLFQFFLAFSEVIFGA 1048
                  *************************************************************.8899999999999998776655 PP

>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   69.3   0.0   1.2e-21   2.3e-18       1     118 []     470     604 ..     470     604 .. 0.94
   2 !   67.8   0.0   3.4e-21   6.6e-18       1     118 []    1140    1267 ..    1140    1267 .. 0.94

  Alignments for each domain:
  == domain 1    score: 69.3 bits;  conditional E-value: 1.2e-21
                 HHHHHHHTTSS------EEE-..--BGGGB-HHHHH..EEEE-------.--BHHHHHH----S--........-HHHHHHHHHH---HHHH--..... CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxx........xxxxxxxxxxxxxxxxxxxx..... RF
     PF00005   1 STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk........tdkrieevlekvgldelldk..... 84 
                 ST++ ll + ++p  g++ vd  + d+++ +l++lr  i+ ++q+p+lf   t+ +n++ + + +          ++rie+++++ + ++++       
  CIRT_02989 470 STVIGLLERFYNPVGGSVLVD--GVDIQNLNLKWLRqqISLVSQEPTLF-GTTIYNNIKQGLIGSPfelepdqsVRQRIENAAKMANAHDFIMGlpeky 565
                 9********************..56778899999999************.********99988877********999********9999977777999* PP

                 .....----------HHHHHHHHHHTT--SEEEEESTTT CS
                 .....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005  85 .....srvstLSgGqkqrvalArallkkpklllLDEPtn 118
                      +r+  LSgGqkqr+a+Ara++++pk+llLDE+t+
  CIRT_02989 566 ethvgERGFLLSGGQKQRIAIARAIVSDPKILLLDEATS 604
                 *************************************96 PP

  == domain 2    score: 67.8 bits;  conditional E-value: 3.4e-21
                  HHHHHHHTTSS------EEE-..--BGGGB-HHHHH..EEEE-------.--BHHHHHH----S--.-HHHHHHHHHH---HHHH--.......... CS
                  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxx.......... RF
     PF00005    1 STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk.tdkrieevlekvgldelldk.......... 84  
                  ST ++ll + ++  +g ++vd  ++d+ + ++++ r  ++ ++q+p+l  + ++r+n+  + +e++  ++ i e++++ ++ +++ +          
  CIRT_02989 1140 STTIALLERFYDTLSGGVYVD--GTDITRWNVSAYRsfLALVSQEPTLY-QGSIRDNILLGITEDDvPEEAIIEACKAANIYDFIMSlpdgfstlvg 1233
                  9********************..567788888888889***********.***********9998888889999*********88888********* PP

                  ----------HHHHHHHHHHTT--SEEEEESTTT CS
                  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005   85 srvstLSgGqkqrvalArallkkpklllLDEPtn 118 
                  s++s LSgGqkqr+a+Aral+++pk+llLDE+t+
  CIRT_02989 1234 SKGSMLSGGQKQRIAIARALIRDPKILLLDEATS 1267
                  ********************************96 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    7.1   0.1    0.0093        18      25      41 ..     457     473 ..     448     478 .. 0.87
   2 !   22.0   0.0   2.6e-07    0.0005     136     210 ..     575     645 ..     488     653 .. 0.81
   3 ?    2.4   0.0      0.26   4.9e+02      26      41 ..    1128    1143 ..    1119    1149 .. 0.84
   4 !   16.7   0.0   1.1e-05     0.022     135     209 ..    1237    1307 ..    1198    1316 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0093
                 SEEEE--------HHHH CS
                 xxxxxxxxxxxxxxxxx RF
     PF02463  25 sftaivGpNGSGKsnvl 41 
                 + ta+vGp GSGKs v+
  CIRT_02989 457 KTTALVGPSGSGKSTVI 473
                 589***********997 PP

  == domain 2    score: 22.0 bits;  conditional E-value: 2.6e-07
                 G-----HHHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BTBEEEEE-S-HHHHTT-SEEE- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463 136 lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekadklvg 210
                 lLSgG+k+ +a+a       v+   + llDe  +aLD k    v   l+e+sk    i+i++r ++++ ad++v 
  CIRT_02989 575 LLSGGQKQRIAIARA----IVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIIIAHRLSTIKTADNIVV 645
                 79*****98887643....345556899******************************************99875 PP

  == domain 3    score: 2.4 bits;  conditional E-value: 0.26
                  EEEE--------HHHH CS
                  xxxxxxxxxxxxxxxx RF
     PF02463   26 ftaivGpNGSGKsnvl 41  
                    a+vGp G+GKs  +
  CIRT_02989 1128 YVALVGPSGCGKSTTI 1143
                  5789*********866 PP

  == domain 4    score: 16.7 bits;  conditional E-value: 1.1e-05
                  TG-----HHHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BTBEEEEE-S-HHHHTT-SEEE CS
                  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463  135 elLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekadklv 209 
                  ++LSgG+k+ +a+a       ++   + llDe  +aLD +  + v   l+++ k    i +++r ++++kad ++
  CIRT_02989 1237 SMLSGGQKQRIAIARA----LIRDPKILLLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIY 1307
                  48******99888654....45666789*******************************************9987 PP

>> PF03193  Protein of unknown function, DUF258
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   12.8   0.1   0.00017      0.32      34      56 ..     455     477 ..     446     511 .. 0.89
   2 ?    0.5   0.0       1.1     2e+03      15      52 ..     864     900 ..     850     911 .. 0.77
   3 !   11.5   0.0   0.00042      0.81      33      57 ..    1123    1148 ..    1103    1165 .. 0.82

  Alignments for each domain:
  == domain 1    score: 12.8 bits;  conditional E-value: 0.00017
                 TTSBEEEE-------HHHHHHH- CS
     PF03193  34 kdktsvlvGqSGvGKSsLinall 56 
                 ++kt++lvG+SG GKS++i  l+
  CIRT_02989 455 AGKTTALVGPSGSGKSTVIGLLE 477
                 469***************98886 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 1.1
                 EEEEECHHHTT-HHHHHHCTTSBEEEE-------HHHH CS
     PF03193  15 vlvlsvktkegleelaellkdktsvlvGqSGvGKSsLi 52 
                 + ++ v+ ++++ +l++ l+ +t  l G SGv   +++
  CIRT_02989 864 IAFFDVD-ENSTGALTSFLSTETKHLSGISGVTLGTIL 900
                 4445544.788899******************766665 PP

  == domain 3    score: 11.5 bits;  conditional E-value: 0.00042
                  CTT.SBEEEE-------HHHHHHH-- CS
     PF03193   33 lkd.ktsvlvGqSGvGKSsLinallp 57  
                  +k  + ++lvG+SG GKS+ i  l+ 
  CIRT_02989 1123 VKPgQYVALVGPSGCGKSTTIALLER 1148
                  5555899************9998876 PP

>> PF09818  Predicted ATPase of the ABC class
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   11.0   0.0   0.00038      0.74     300     353 ..     552     606 ..     538     649 .. 0.86
   2 !   13.9   0.0   5.1e-05     0.099     298     352 ..    1213    1268 ..    1205    1271 .. 0.90

  Alignments for each domain:
  == domain 1    score: 11.0 bits;  conditional E-value: 0.00038
     PF09818 300 vdispFinnLPegkdtt.efstedASGStsqAanimealeagakllLiDEDtsAt 353
                 ++   Fi  LPe+++t+        SG  +q  +i++a+    k+lL+DE tsA 
  CIRT_02989 552 ANAHDFIMGLPEKYETHvGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSAL 606
                 56789***********955555689****************************95 PP

  == domain 2    score: 13.9 bits;  conditional E-value: 5.1e-05
     PF09818  298 kgvdispFinnLPegkdtt.efstedASGStsqAanimealeagakllLiDEDtsA 352 
                  k ++i  Fi +LP g +t   +  +  SG  +q  +i++al +  k+lL+DE tsA
  CIRT_02989 1213 KAANIYDFIMSLPDGFSTLvGSKGSMLSGGQKQRIAIARALIRDPKILLLDEATSA 1268
                  67899*************955566678****************************9 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.5     0.035        67       3      88 ..     461     619 ..     459     651 .. 0.62
   2 !    6.6   0.0      0.03        57       2      18 ..    1130    1146 ..    1129    1191 .. 0.86
   3 ?    5.8   0.0     0.053     1e+02      27     116 ..    1220    1303 ..    1206    1311 .. 0.55

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.035
                 EE-------HHHHHHHHHHT..........TCEEEEEETTSSSSS...................................................... CS
     PF00004   3 lyGppGtGKTllakavakel..........gvefleisgsellsk...................................................... 37 
                 l+Gp G GK++++  + +            gv++ +++++ l+++                                                      
  CIRT_02989 461 LVGPSGSGKSTVIGLLERFYnpvggsvlvdGVDIQNLNLKWLRQQislvsqeptlfgttiynnikqgligspfelepdqsvrqrienaakmanahdfim 559
                 677777777777766666542222222233355666666666655666666666666666666666666666666666666666666666666666666 PP

                 ..............T.HCHHHHHHHHHHHHHHTSSEEEEEETGGGTSHHHS..TCHHHHHHHHHH CS
     PF00004  38 ..............yvgesekkirelfkeakekapsvlfiDEidalaksrgseseeeervvnqLl 88 
                               ++  + +k r  + +a  + p++l++DE+ +   ++     +e  v+++L 
  CIRT_02989 560 glpekyethvgergFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTK-----SEGVVQAALD 619
                 77777777777777777788888888888888889999999999999888.....3333333332 PP

  == domain 2    score: 6.6 bits;  conditional E-value: 0.03
                  EEE-------HHHHHHH CS
     PF00004    2 llyGppGtGKTllakav 18  
                   l+Gp G+GK++++  +
  CIRT_02989 1130 ALVGPSGCGKSTTIALL 1146
                  69**********98765 PP

  == domain 3    score: 5.8 bits;  conditional E-value: 0.053
                  EEEETTSSSSS......T.HCHHHHHHHHHHHHHHTSSEEEEEETGGGTSHHHS..TCHHHHHHHHHHHHHHHSCSTS-TEEEEEE-SSGGGS-HH CS
     PF00004   27 leisgsellsk......yvgesekkirelfkeakekapsvlfiDEidalaksrgseseeeervvnqLlteldglkkkeskvlvigatnrpdkldpa 116 
                  + +s+++ +s        +  + +k r  + +a    p++l++DE+ +   s+     +e+ v+ +L ++ +g        + i++++r +++++a
  CIRT_02989 1220 FIMSLPDGFSTlvgskgSMLSGGQKQRIAIARALIRDPKILLLDEATSALDSE-----SEKVVQVALDAAAKGR-------TTIAVAHRLSTIQKA 1303
                  55555555555112222222333444444544444459***********9999.....3333333333322222.......346777776666665 PP

>> PF00448  SRP54-type protein, GTPase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    7.7   0.0    0.0072        14       4      39 ..     459     494 ..     456     507 .. 0.90
   2 !   10.0   0.0    0.0014       2.8       3      41 ..    1128    1166 ..    1126    1179 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0072
                 EEEE-------TTTHCCHHHHHHCTS--EEEEEEST CS
     PF00448   4 illvGlqGaGKTTtlaKLAallkkegkkvllvaaDt 39 
                 ++lvG+ G+GK T ++ L + ++  g +vl+  +D+
  CIRT_02989 459 TALVGPSGSGKSTVIGLLERFYNPVGGSVLVDGVDI 494
                 689******************999999999988887 PP

  == domain 2    score: 10.0 bits;  conditional E-value: 0.0014
                  EEEEE-------TTTHCCHHHHHHCTS--EEEEEESTSS CS
     PF00448    3 villvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfR 41  
                  +++lvG+ G GK Tt+a L + + +    v +  +D+ R
  CIRT_02989 1128 YVALVGPSGCGKSTTIALLERFYDTLSGGVYVDGTDITR 1166
                  689****************99999998888888888877 PP

>> PF03215  Rad17 cell cycle checkpoint protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.012        23      50      66 ..     461     477 ..     451     483 .. 0.86
   2 !   11.5   0.0   0.00032      0.61      46      65 ..    1127    1146 ..    1114    1152 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.012
     PF03215  50 ltGPsGcgKsTtvkvls 66 
                 l GPsG+gKsT++  l 
  CIRT_02989 461 LVGPSGSGKSTVIGLLE 477
                 78***********8875 PP

  == domain 2    score: 11.5 bits;  conditional E-value: 0.00032
     PF03215   46 rillltGPsGcgKsTtvkvl 65  
                  + + l GPsGcgKsTt+  l
  CIRT_02989 1127 QYVALVGPSGCGKSTTIALL 1146
                  566799***********987 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    7.9   0.0    0.0078        15       4      24 ..     461     481 ..     459     489 .. 0.87
   2 !    8.4   0.0    0.0055        10       2      23 ..    1129    1150 ..    1128    1166 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0078
     PF07728   4 LvGppGtgKselaerlaealn 24 
                 LvGp+G+gKs+++ +l +++n
  CIRT_02989 461 LVGPSGSGKSTVIGLLERFYN 481
                 9*************9999874 PP

  == domain 2    score: 8.4 bits;  conditional E-value: 0.0055
     PF07728    2 vlLvGppGtgKselaerlaeal 23  
                  v LvGp+G+gKs+ + +l +++
  CIRT_02989 1129 VALVGPSGCGKSTTIALLERFY 1150
                  679***********99998876 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.1     0.014        26       3      18 ..     459     474 ..     457     485 .. 0.85
   2 !    8.4   0.0     0.006        11       3      20 ..    1129    1146 ..    1127    1160 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.014
                 EEEE-E-----HHHHH CS
     PF03205   3 vlvvGpkdsGKTTlie 18 
                  + vGp++sGK+T+i 
  CIRT_02989 459 TALVGPSGSGKSTVIG 474
                 579***********96 PP

  == domain 2    score: 8.4 bits;  conditional E-value: 0.006
                  EEEE-E-----HHHHHHH CS
     PF03205    3 vlvvGpkdsGKTTliekl 20  
                  v+ vGp+++GK+T+i  l
  CIRT_02989 1129 VALVGPSGCGKSTTIALL 1146
                  899***********9866 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.053     1e+02      20      49 ..     460     490 ..     456     500 .. 0.79
   2 ?    6.4   0.0     0.014        28      19      42 ..    1129    1154 ..    1122    1184 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.053
     PF06414  20 llgGqpGAGKtslaellleela.agnivrid 49 
                  l+G+ G+GK++++ ll++ ++  g+ v +d
  CIRT_02989 460 ALVGPSGSGKSTVIGLLERFYNpVGGSVLVD 490
                 599***********99988776656666555 PP

  == domain 2    score: 6.4 bits;  conditional E-value: 0.014
     PF06414   19 vllgGqpGAGKtslaellleela..a 42  
                  v l+G+ G+GK++++ ll++ ++  +
  CIRT_02989 1129 VALVGPSGCGKSTTIALLERFYDtlS 1154
                  789************99998776643 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.18   3.4e+02       3      17 ..     461     475 ..     459     485 .. 0.86
   2 ?    7.9   0.0     0.011        22       2      18 ..    1130    1146 ..    1129    1178 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.18
     PF00910   3 lyGpsgeGKStlake 17 
                 l+Gpsg GKSt++  
  CIRT_02989 461 LVGPSGSGKSTVIGL 475
                 79*********9876 PP

  == domain 2    score: 7.9 bits;  conditional E-value: 0.011
     PF00910    2 wlyGpsgeGKStlakeL 18  
                   l+Gpsg+GKSt++  L
  CIRT_02989 1130 ALVGPSGCGKSTTIALL 1146
                  689*********99873 PP

>> PF00485  Phosphoribulokinase / Uridine kinase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.11   2.2e+02       4      24 ..     461     481 ..     459     504 .. 0.81
   2 ?    5.4   0.0     0.041        80       2      22 ..    1129    1149 ..    1128    1173 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.11
                 E---------THHHHHHHHHH CS
     PF00485   4 vagsSGaGkttvarklesifg 24 
                 + g SG+Gk+tv   le   +
  CIRT_02989 461 LVGPSGSGKSTVIGLLERFYN 481
                 689*********998887665 PP

  == domain 2    score: 5.4 bits;  conditional E-value: 0.041
                  EEE---------THHHHHHHH CS
     PF00485    2 IgvagsSGaGkttvarklesi 22  
                  +++ g SG+Gk+t+ + le  
  CIRT_02989 1129 VALVGPSGCGKSTTIALLERF 1149
                  5789*********99888765 PP

>> PF01935  Domain of unknown function DUF87
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.1      0.05        96      26      56 ..     459     488 ..     455     494 .. 0.74
   2 ?    4.5   0.0     0.089   1.7e+02      26      43 ..    1129    1146 ..    1122    1157 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.05
     PF01935  26 lAilgsTGsGKSntvavLleellekkgatil 56 
                 +A +g +GsGKS+ +++ le+ ++  g+++l
  CIRT_02989 459 TALVGPSGSGKSTVIGL-LERFYNPVGGSVL 488
                 6999********98885.5666644444544 PP

  == domain 2    score: 4.5 bits;  conditional E-value: 0.089
     PF01935   26 lAilgsTGsGKSntvavL 43  
                  +A +g +G GKS+t+a+L
  CIRT_02989 1129 VALVGPSGCGKSTTIALL 1146
                  7999***********987 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0       0.1   1.9e+02      43      61 ..     452     470 ..     424     474 .. 0.85
   2 ?    3.9   0.0      0.11   2.1e+02      47      61 ..    1126    1140 ..    1105    1146 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.1
     PF01695  43 fveqaenlvllGpsGvGKt 61 
                 fv + +  +l+GpsG GK+
  CIRT_02989 452 FVPAGKTTALVGPSGSGKS 470
                 88899999**********8 PP

  == domain 2    score: 3.9 bits;  conditional E-value: 0.11
     PF01695   47 aenlvllGpsGvGKt 61  
                   + ++l+GpsG GK+
  CIRT_02989 1126 GQYVALVGPSGCGKS 1140
                  67799*********8 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.1      0.19   3.7e+02       2      16 ..     458     472 ..     457     479 .. 0.87
   2 ?    5.5   0.0      0.04        78       2      17 ..    1128    1146 ..    1127    1162 .. 0.75

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.19
     PF05729   2 tvilqGeaGsGKTtL 16 
                 t +l+G++GsGK+t 
  CIRT_02989 458 TTALVGPSGSGKSTV 472
                 7899*********96 PP

  == domain 2    score: 5.5 bits;  conditional E-value: 0.04
     PF05729    2 tvilqGeaGsGKTt...Ll 17  
                  +v+l+G++G+GK+t   Ll
  CIRT_02989 1128 YVALVGPSGCGKSTtiaLL 1146
                  799**********833345 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.016        31       2      27 ..     462     487 ..     461     502 .. 0.83
   2 ?    1.5   0.0      0.61   1.2e+03       2      22 ..    1132    1152 ..    1131    1159 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.016
     PF03029   2 vGpaGsGKttfvgalseilelskrsv 27 
                 vGp GsGK+t +g l  +++  + sv
  CIRT_02989 462 VGPSGSGKSTVIGLLERFYNPVGGSV 487
                 8************9999988776665 PP

  == domain 2    score: 1.5 bits;  conditional E-value: 0.61
     PF03029    2 vGpaGsGKttfvgalseilel 22  
                  vGp G GK+t +  l  ++++
  CIRT_02989 1132 VGPSGCGKSTTIALLERFYDT 1152
                  8**********9998887765 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.052     1e+02       3      33 ..     457     487 ..     455     504 .. 0.77
   2 ?    1.5   0.0      0.71   1.4e+03       4      28 ..    1128    1152 ..    1125    1171 .. 0.72

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.052
                 -EEEEE-ETT---HHHHHHHHHHHHHTS--E CS
     PF01583   3 vvvwltGlsgsGKstiavalekkLvekgikv 33 
                  +  l G sgsGKst+   le+  +  g +v
  CIRT_02989 457 KTTALVGPSGSGKSTVIGLLERFYNPVGGSV 487
                 567799***********99999877777554 PP

  == domain 2    score: 1.5 bits;  conditional E-value: 0.71
                  EEEEE-ETT---HHHHHHHHHHHHH CS
     PF01583    4 vvwltGlsgsGKstiavalekkLve 28  
                   v l G sg GKst    le+   +
  CIRT_02989 1128 YVALVGPSGCGKSTTIALLERFYDT 1152
                  67899********988888875544 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.17   3.2e+02       3      20 ..     457     474 ..     455     488 .. 0.81
   2 ?    2.2   0.0      0.35   6.7e+02       5      28 ..    1129    1151 ..    1126    1167 .. 0.72

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.17
                 --EEEE------HHHHHH CS
     PF00625   3 rpivlvGpsgvGkstlkk 20 
                 ++  lvGpsg+Gkst++ 
  CIRT_02989 457 KTTALVGPSGSGKSTVIG 474
                 7888**********9875 PP

  == domain 2    score: 2.2 bits;  conditional E-value: 0.35
                  EEEE------HHHHHHHHHHHSTT CS
     PF00625    5 ivlvGpsgvGkstlkkaLldelpe 28  
                  + lvGpsg Gkst + aLl+++ +
  CIRT_02989 1129 VALVGPSGCGKSTTI-ALLERFYD 1151
                  679********9976.45555544 PP

>> PF04076  Bacterial OB fold (BOF) protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.014        28      52      81 ..     637     666 ..     581     675 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.014
     PF04076  52 keaaDdasvvleGnivkqidddeyvFrDas 81 
                  + aD+ +v + G iv+q  +de v rD +
  CIRT_02989 637 IKTADNIVVLVDGRIVEQGTHDELVERDGT 666
                 4679*********************99976 PP

>> PF00931  NB-ARC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.3         1   1.9e+03      23      35 ..     460     472 ..     454     476 .. 0.88
   2 ?    4.9   0.0     0.033        64      20      36 ..    1127    1143 ..    1114    1148 .. 0.83

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1
                 EEE-------HHH CS
     PF00931  23 glvGmgGvGKttl 35 
                 +lvG  G+GK+t+
  CIRT_02989 460 ALVGPSGSGKSTV 472
                 79**********8 PP

  == domain 2    score: 4.9 bits;  conditional E-value: 0.033
                  EEEEEE-------HHHH CS
     PF00931   20 kvvglvGmgGvGKttla 36  
                  + v+lvG  G+GK+t++
  CIRT_02989 1127 QYVALVGPSGCGKSTTI 1143
                  789**********9976 PP

>> PF03376  Adenovirus E3B protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.9     0.056   1.1e+02      17      56 ..     226     265 ..     221     274 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.056
     PF03376  17 vsatfaavaelepdClppfavyllfalvtcisiCsivclv 56 
                 v  t++a a+  +  +  f  y  ++l++c ++ +iv+++
  CIRT_02989 226 VGLTLTALATFVTAFVIGFIKYWKLTLICCSTVVAIVTIM 265
                 56799999**9999999********************986 PP

>> PF09047  MEF2 binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.7      0.27   5.2e+02      12      23 ..     732     743 ..     730     745 .. 0.93
   2 ?    1.0   0.0       1.2   2.2e+03      19      30 ..    1043    1054 ..    1041    1055 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.27
     PF09047  12 ETKQKLKsvILS 23 
                 ETK  L svILS
  CIRT_02989 732 ETKKSLSSVILS 743
                 9**********9 PP

  == domain 2    score: 1.0 bits;  conditional E-value: 1.2
     PF09047   19 svILSaQSAAtv 30  
                   vI  aQSA tv
  CIRT_02989 1043 EVIFGAQSAGTV 1054
                  59*******997 PP

>> PF11062  Protein of unknown function (DUF2863)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.025        49      28     106 ..      33     108 ..      27     113 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.025
     PF11062  28 sgsrvEdrfWekkLaaalakllkngsdetleaaLdhlfktdseaydelaeaaEtlaEsakiekegkeydvlllaaPvla 106
                 sgs v d      L++  +kl +++ +++l+ +L hl +++ +  ++ +e+ Et++   ++ + +++ d+++l +  +a
  CIRT_02989  33 SGSTVGDGDN---LKKLDSKLANEKRESNLDDSLAHLPEHERDIIKQQLEIPETKVKFFTLYRYATTNDIIILLVSAVA 108
                 5666666543...444445566789999*****************************************9998776665 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.0       2.2   4.3e+03       4      16 ..     461     473 ..     459     553 .. 0.89
   2 ?    3.3   0.0      0.38   7.3e+02       2      17 ..    1129    1144 ..    1128    1154 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 2.2
                 EE--TT---HHHH CS
     PF08477   4 vvGdkgvGKssll 16 
                 +vG +g+GKs+ +
  CIRT_02989 461 LVGPSGSGKSTVI 473
                 79*********88 PP

  == domain 2    score: 3.3 bits;  conditional E-value: 0.38
                  EEEE--TT---HHHHH CS
     PF08477    2 vvvvGdkgvGKsslls 17  
                  v++vG +g+GKs+ ++
  CIRT_02989 1129 VALVGPSGCGKSTTIA 1144
                  789**********996 PP

>> PF05014  Nucleoside 2-deoxyribosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0      0.13   2.5e+02      42      81 ..     620     659 ..     580     661 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.13
                 ...HCCHHHHHHHHHHHHHC-SEEEEEEESSS-----TTT CS
     PF05014  42 eeseeaaraiyeadlellrqadavvanldpfraDsGtafE 81 
                 e+s+   + i +  l+ +++ad +v+++d+  + +Gt  E
  CIRT_02989 620 EASKGRTTIIIAHRLSTIKTADNIVVLVDGRIVEQGTHDE 659
                 2467788889999*****************7799999766 PP

>> PF11347  Protein of unknown function (DUF3148)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.051        98       5      39 ..     627     661 ..     625     671 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.051
     PF11347   5 kvrlveappylKTadpmPmLRppdlvklgevGevv 39 
                 +++++++++ +KTad++ +L    +v+ g   e v
  CIRT_02989 627 TIIIAHRLSTIKTADNIVVLVDGRIVEQGTHDELV 661
                 6889999*************999999988766665 PP

>> PF09003  Bacteriophage lambda integrase, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.97   1.9e+03      40      67 ..     379     408 ..     377     417 .. 0.84
   2 ?    1.9   0.0      0.64   1.2e+03      32      44 ..     745     757 ..     715     769 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.97
     PF09003  40 hgLGr..drreAiaqAieaNleiaeqlakq 67 
                 ++LG+   +++A + Ai+a ++i++ ++++
  CIRT_02989 379 FSLGNvtPNAQAFTSAIAAGAKIFSTIDRK 408
                 78887657899************9988776 PP

  == domain 2    score: 1.9 bits;  conditional E-value: 0.64
     PF09003  32 rnPltgkehgLGr 44 
                 r+P  +ke+gLG+
  CIRT_02989 745 REPEKDKEYGLGT 757
                 89**********8 PP

>> PF07293  Protein of unknown function (DUF1450)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.058   1.1e+02      45      67 ..     641     663 ..     635     672 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.058
     PF07293  45 eslfalvnGevvegdtpeeLven 67 
                 +++  lv+G +ve  t +eLve+
  CIRT_02989 641 DNIVVLVDGRIVEQGTHDELVER 663
                 66789****************96 PP

>> PF00205  Thiamine pyrophosphate enzyme, central domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.074   1.4e+02       5      33 ..     634     662 ..     630     663 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.074
                 HHHHHH-SSEEEEE-CHHCHTTGHHHHHH CS
     PF00205   5 aellkaakrPvilvGggvrrseakeelra 33 
                 ++ +k a + v+lv+g +  +++++el++
  CIRT_02989 634 LSTIKTADNIVVLVDGRIVEQGTHDELVE 662
                 6789**********************986 PP

>> PF00277  Serum amyloid A protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.055   1.1e+02      43      86 ..     281     325 ..     268     329 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.055
     PF00277  43 aqrGpGGvwaakvisdarellqglvkgrgledskad.qeanewGr 86 
                  + G GG+ a +v+s+ r+++   ++++ +++  a   ea++wG 
  CIRT_02989 281 ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHlLEAQKWGT 325
                 5679****************9999988888887776358999995 PP

>> PF09122  Domain of unknown function (DUF1930)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.056   1.1e+02      17      33 ..     639     655 ..     635     677 .. 0.76

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.056
                 -TTT--EEE---EESS- CS
     PF09122  17 tldavtlvvDGavverP 33 
                 t+d++ + vDG +ve+ 
  CIRT_02989 639 TADNIVVLVDGRIVEQG 655
                 68*************85 PP

>> PF03387  Herpesvirus UL46 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.051        98      41      86 ..    1180    1225 ..    1165    1251 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.051
     PF03387   41 ellpsaLlgaeReeaLlkvrsnkvPeslivslvaeDtseeYireyd 86  
                  ++ p   +g  R + Ll++ ++ vPe  i+++    + +++i  + 
  CIRT_02989 1180 SQEPTLYQGSIRDNILLGITEDDVPEEAIIEACKAANIYDFIMSLP 1225
                  66788899*******************9999988888777776665 PP

>> PF00036  EF hand
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.14   2.6e+02      15      28 ..     136     149 ..     136     150 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.14
                 SEBEHHHHHHHHHH CS
     PF00036  15 GkIsfeEfkealkk 28 
                 G+Is++Ef + l+k
  CIRT_02989 136 GTISYDEFNDTLSK 149
                 9*******998876 PP

>> PF09972  Predicted membrane protein (DUF2207)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.1    0.0021       4.1     427     479 ..     815     867 ..     722     873 .. 0.84

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0021
     PF09972 427 laalvllvivlvigliiallllrkllgawtpeGaeeldewkgFknyL.adisrl 479
                 ++ ++l++++l+i++++a+ +++ l++  + e   ++++ k+F+ +L  di+ +
  CIRT_02989 815 ANFWCLMFLMLGIVMFFAYSIQGSLFAYCS-EKLIYRARSKAFRSMLrQDIAFF 867
                 456788888888888888888888887665.55789***********9999755 PP

>> PF04548  AIG1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.18   3.5e+02       3      17 ..    1129    1143 ..    1127    1149 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.18
                  EEEE-------HHHH CS
     PF04548    3 ivlvGktgnGkSaTg 17  
                  + lvG +g+GkS+T+
  CIRT_02989 1129 VALVGPSGCGKSTTI 1143
                  569**********97 PP

>> PF08303  tRNA ligase kinase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.55   1.1e+03       9      24 ..    1136    1151 ..    1129    1180 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.55
     PF08303    9 GCGkttvaltlenlfg 24  
                  GCGk+t+   le+++ 
  CIRT_02989 1136 GCGKSTTIALLERFYD 1151
                  9********9999986 PP

>> PF04127  DNA / pantothenate metabolism flavoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1      0.15   2.9e+02     145     188 ..     606     649 ..     598     659 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.15
                 EES-HHHHHHHHHHHHHHCT-S-EEEEEGGGB-SS-B-EEEE-S CS
     PF04127 145 letdeeeLiekArkkLekynldlviaNdlealstrkkevilvsk 188
                 l t++e +++ A ++ +k +  ++ia  l+ ++t ++ v+lv+ 
  CIRT_02989 606 LDTKSEGVVQAALDEASKGRTTIIIAHRLSTIKTADNIVVLVDG 649
                 7789999***********************************84 PP

>> PF10506  PDZ domain of MCC-2 bdg protein for Usher syndrome
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0       0.2   3.9e+02      41      60 ..     299     322 ..     297     327 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.2
     PF10506  41 navAl....rLalqyservkelys 60 
                 na+A     +La+qy  ++ e+++
  CIRT_02989 299 NATAFgtqeKLAKQYDAHLLEAQK 322
                 799999999**********99985 PP

>> PF07625  Protein of unknown function (DUF1586)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.67   1.3e+03       5      13 ..    1176    1184 ..    1173    1185 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.67
     PF07625    5 LAAVsqtPT 13  
                  LA Vsq PT
  CIRT_02989 1176 LALVSQEPT 1184
                  999*****9 PP

>> PF09551  Stage II sporulation protein R (spore_II_R)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.39   7.6e+02     112     125 ..     815     828 ..     792     833 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.39
     PF09551 112 knwWCvlfPplcfv 125
                 +n+WC++f  l +v
  CIRT_02989 815 ANFWCLMFLMLGIV 828
                 7*******888766 PP

>> PF11153  Protein of unknown function (DUF2931)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.1      0.38   7.2e+02     122     161 ..     305     344 ..     303     349 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.38
     PF11153 122 lrqkmrtpekatkrdgekekyrnnivlGLAPgGkvkVwlq 161
                 +++k++++++a+  + +k+ ++ ++++G+  gG++++ + 
  CIRT_02989 305 TQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFL 344
                 68999******************************98765 PP

>> PF03711  Orn/Lys/Arg decarboxylase, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.43   8.3e+02      79     112 ..     160     191 ..     158     199 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.43
                 SS-BEES-----SC----B-..TTHHHHHHHHHH CS
     PF03711  79 aelvlpYPpGiplvlpGErlteeskavldYllal 112
                 ae vl+Y   +  + +GE++  ++k   +Yl a+
  CIRT_02989 160 AEFVLIYTCTVGFIYTGEHI--AQKIRERYLDAV 191
                 7899****************..778888999875 PP

>> PF09744  JNK_SAPK-associated protein-1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.49   9.5e+02     109     144 ..      53      88 ..      40      95 .. 0.69

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.49
     PF09744 109 elkaknlsdkvsrLeeretelkkeyeslheretkll 144
                 e + +nl d    L+e+e ++ k+  ++ e + k +
  CIRT_02989  53 EKRESNLDDSLAHLPEHERDIIKQQLEIPETKVKFF 88 
                 346678888888888888888777777777766665 PP

>> PF04648  Yeast mating factor alpha hormone
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.72   1.4e+03       4      10 ..    1121    1127 ..    1121    1128 .. 0.96

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.72
     PF04648    4 LslkpGq 10  
                  Ls+kpGq
  CIRT_02989 1121 LSVKPGQ 1127
                  9*****9 PP

>> PF03183  Borrelia repeat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   1.7         1     2e+03       1       8 [.     995    1002 ..     995    1004 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 1
     PF03183    1 TlSILlSR 8   
                  ++SIL+S+
  CIRT_02989  995 LVSILKSS 1002
                  7******8 PP

>> PF06046  Exocyst complex component Sec6
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.0      0.67   1.3e+03     430     475 ..     180     225 ..     172     241 .. 0.86

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 0.67
     PF06046 430 ldelvleYlrallekklkfkakkkrkqfaeklkrDaeqlyqffekl 475
                 ++++  +Yl a+l++++ f +k  + +++ ++++D + +++++++ 
  CIRT_02989 180 AQKIRERYLDAVLRQNIAFFDKLGAGEITTRITADTNLIQDGISEK 225
                 5666789*********************************998875 PP

>> PF06512  Sodium ion transport-associated
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.4       1.4   2.7e+03      80     131 ..     689     740 ..     607     757 .. 0.59

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 1.4
     PF06512  80 dglektikgdlkekdkksfitnpsltvsvpiaegesDlenleeedtssesse 131
                 d  e+ ++g+  +  + ++ +      s+ +a ++ Dle++++e ++s ss 
  CIRT_02989 689 DDGEESPMGSDADALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSV 740
                 2222222222222222233233333445566666666666666666665553 PP

>> PF12107  Plasminogen (Pg) ligand in fibrinolytic pathway
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.2       1.7   3.3e+03       4      12 ..     672     680 ..     671     680 .. 0.85

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.7
     PF12107   4 ELeRLKNER 12 
                 E +R ++ER
  CIRT_02989 672 EAQRINEER 680
                 559*****9 PP

>> PF03543  Yersinia/Haemophilus virulence surface antigen
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.0       1.9   3.7e+03       4      28 ..     942     966 ..     940    1001 .. 0.92

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 1.9
                 GGGGBSS-----TT...------HH CS
     PF03543   4 laefglevakkfaqsadgvCegLsa 28 
                 la f+ +  k +++sa+ +Ce++sa
  CIRT_02989 942 LAAFQRRAKKAYEASASYACEATSA 966
                 688999999**************98 PP

>> PF04997  RNA polymerase Rpb1, domain 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.5   0.1         2   3.9e+03     115     197 ..     659     741 ..     634     761 .. 0.70

  Alignments for each domain:
  == domain 1    score: -0.5 bits;  conditional E-value: 2
                 HHHHHHHSSSHHHHHHHHHHHHSS--B--SEEE-SSS....TTSEEE------B----EE--.--EE--B-SST----SS-B- CS
     PF04997 115 kvvkkkkgkkkkkklkiinelckkksicekskeenenvkdelekleaaegcekkqpkiskegaealeellkkseeeeelkekl 197
                 ++v++ ++  ++ + ++ine   ++++ + ++ e++ + +++++l++++++ +++++ ++   e+++ +l+k+e++++l++ +
  CIRT_02989 659 ELVERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDADALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSVI 741
                 45555555556666777777777777777666555555566777799999999999999999999999999876666655543 PP

>> PF08248  Tryptophyllin-3 skin active peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   0.5       8.2   1.6e+04       6      10 ..     804     808 ..     803     809 .. 0.92

  Alignments for each domain:
  == domain 1    score: -0.7 bits;  conditional E-value: 8.2
     PF08248   6 PPPIY 10 
                 PPP Y
  CIRT_02989 804 PPPLY 808
                 9***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (1343 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       745  (0.062542); expected 238.2 (0.02)
Passed bias filter:                      377  (0.0316488); expected 238.2 (0.02)
Passed Vit filter:                        56  (0.00470114); expected 11.9 (0.001)
Passed Fwd filter:                        55  (0.00461719); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              52  [number of targets reported over threshold]
# CPU time: 0.83u 0.04s 00:00:00.87 Elapsed: 00:00:01
# Mc/sec: 3493.26
//