hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/eukary_add_37278.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: CIRT_01234
Accession:      [none]
Description:    cimm2 CIRG_01232 Broad_Institute ""

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0052657  Clavaminate synthase-like                      147.9      6e-42   1
0053127  Clavaminate synthase-like                       64.9    4.2e-17   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0053127    1/1      95   375 ..     1   210 []    64.9  4.2e-17
0052657    1/1     111   375 ..     1   200 []   147.9    6e-42

Alignments of top-scoring domains:
0053127: domain 1 of 1, from 95 to 375: score 64.9, E = 4.2e-17
                   *->lvldellllptplllllvpgltlipdflspeeadalleell....de
                        l +  +   +  +  vpgl+++p++l+p+++ +ll++ll+ + ++
  CIRT_01234    95    KDLRDGRDGACVYGIRQVPGLRILPSLLPPAVQTELLSRLLhrdlSD 141  

                   lpwrrdtitlfgkvvlspr...............................
                    + +++ + +++  ++sp  +++ + + + +++++   ++     ++ + 
  CIRT_01234   142 ERHQTNLHLHYDVSYPSPSsdangasalkgtqqeacwstnssffrddptr 191  

                   .....................ltavyg.dagyrysgltllplrpwpplll
                   +   ++++++    ++++ + ++ +   +  y +    ++p+ p p+++ 
  CIRT_01234   192 tfspkdatvhrplsiqaalnsKLRWITlGGQYNWTTKEYPPG-PPPAFPS 240  

                   alrdlleeltg.lpfnaclvnlYrdgsdsigwHsDdepelgpgppiaslS
                    +  ll+ ++++ + +a++vnlY +g+  +++H+D   e +  +  +s+S
  CIRT_01234   241 DISTLLHSIFPeTTAEAAIVNLYSPGD-TLNPHRDVSEECD--TGLISIS 287  

                   LgatrvfllrhklrgdeggdssavetvslpLphgsllvmggetqltwlHg
                   Lg+++ fl++h +++             ++L++g+ ++m+g+++ +w H+
  CIRT_01234   288 LGCHALFLVGHGNGD---------SCAVIRLRSGDAVYMTGASRFAW-HA 327  

                   vpklkkv...........................ggpRisLTFRkvlplppglvllpgflspeeqalllelllelpwsplrinlf..........
                       +pgl++lp++l+p++q +ll++ll+  +s  r+++  + ++++ + 
  CIRT_01234   111    QVPGLRILPSLLPPAVQTELLSRLLHRDLSDERHQTNlhlhydvsyp 157  

                   .........................................gkgvllsrl
                       +++ + + + +++++   ++     ++ + +   +++  +++ls++
  CIRT_01234   158 spssdangasalkgtqqeacwstnssffrddptrtfspkdaTVHRPLSIQ 207  

                   tallgklrwvtlgygyrysgllyvsglplppipdlllallerlaalaglp
                   +al +klrw+tlg +y+++++ y++g p p++p+ ++ ll+ +     +p
  CIRT_01234   208 AALNSKLRWITLGGQYNWTTKEYPPGPP-PAFPSDISTLLHSI-----FP 251  

                   dfvpnaclvnyYrpgdglglHqDdeeldfgppiaslSLgasavflfggkt
                   +++++a++vn+Y+pgd+l++H+D +e  +++ ++s+SLg++a+fl+g+  
  CIRT_01234   252 ETTAEAAIVNLYSPGDTLNPHRDVSE-ECDTGLISISLGCHALFLVGHG- 299  

                   rggktlsllLesgdllvmggesrlawHgvpkikkdtlp............
                   +g+    ++L+sgd ++m+g sr+awH+vpki+++t+p+  ++     ++
  CIRT_01234   300 NGDSCAVIRLRSGDAVYMTGASRFAWHAVPKIIPSTCPdwlktwpgggdv 349  

                   ..........llrggRinLTfRqvlk