RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= CIRT_00384 cimm2 CIRG_00384 Broad_Institute ""
         (406 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1cvjC [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 50   1e-08
3dedA [x.x.x] PROBABLE HEMOLYSIN                                       50   2e-08
1cvjF [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 49   3e-08
2dgqA [x.x.x] BRUNO-LIKE 6, RNA BINDING PROTEIN                        48   6e-08
1cvjD [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 46   2e-07
3dedC [x.x.x] PROBABLE HEMOLYSIN                                       45   3e-07
1b7fA [d.58.7 - d.58.7] PROTEIN (SXL-LETHAL PROTEIN)                   43   2e-06
2cpzA [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1                 42   3e-06
1a9nB [d.58.7] SPLICEOSOMAL U2B''                                      42   3e-06
2dhxA [x.x.x] POLY (ADP-RIBOSE) POLYMERASE FAMILY, MEMBER 10           41   5e-06
2cqcA [x.x.x] ARGININE/SERINE-RICH SPLICING FACTOR 10                  41   5e-06
3b4mD [x.x.x] POLYADENYLATE-BINDING PROTEIN 2                          41   5e-06
2dh7A [x.x.x] NUCLEOLYSIN TIAR                                         41   6e-06
2cjkA [x.x.x] NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN 4             40   9e-06
2a3jA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A                     40   1e-05
2e5iA [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN L-LIKE           40   1e-05
2cphA [x.x.x] RNA BINDING MOTIF PROTEIN 19                             40   1e-05
2ek6A [x.x.x] RNA-BINDING PROTEIN 12                                   39   2e-05
2dhaA [x.x.x] FLJ20171 PROTEIN                                         39   3e-05
2dnlA [x.x.x] CYTOPLASMIC POLYADENYLATION ELEMENT BINDING              39   3e-05
2dgpA [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN                        39   3e-05
1cx0A [d.58.7] U1A PROTEIN                                             39   3e-05
2cq0A [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3               39   3e-05
3culA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A                     39   3e-05
3ctrA [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN                       38   4e-05
3d45A [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN                       38   4e-05
2e5hA [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-             38   4e-05
2dgxA [x.x.x] KIAA0430 PROTEIN                                         38   4e-05
2dk2A [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN R                38   5e-05
1audA [d.58.7] U1A 102                                                 38   5e-05
1drzA [d.58.7] PROTEIN (U1 SMALL RIBONUCLEOPROTEIN A)                  37   7e-05
1cvjB [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 37   8e-05
2adbA [x.x.x] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1                   37   9e-05
2disA [x.x.x] UNNAMED PROTEIN PRODUCT                                  37   9e-05
3egnA [x.x.x] RNA-BINDING PROTEIN 40                                   37   1e-04
1cvjA [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 37   1e-04
2cpxA [x.x.x] HYPOTHETICAL PROTEIN FLJ11016                            37   1e-04
2cpyA [x.x.x] RNA-BINDING PROTEIN 12                                   37   1e-04
3d45B [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN                       37   1e-04
2do4A [x.x.x] SQUAMOUS CELL CARCINOMA ANTIGEN RECOGNIZED BY T-         36   2e-04
2dnkA [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN                        36   2e-04
2dgoA [x.x.x] CYTOTOXIC GRANULE-ASSOCIATED RNA BINDING PROTEIN         36   2e-04
2cpfA [x.x.x] RNA BINDING MOTIF PROTEIN 19                             36   2e-04
1a9nD [d.58.7] SPLICEOSOMAL U2B''                                      36   2e-04
1cvjH [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 36   2e-04
2cqdA [x.x.x] RNA-BINDING REGION CONTAINING PROTEIN 1                  36   3e-04
2cqgA [x.x.x] TAR DNA-BINDING PROTEIN-43                               35   3e-04
2cqbA [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E                    35   4e-04
3cunA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A                     35   5e-04
1cvjG [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1                 34   7e-04
2cq4A [x.x.x] RNA BINDING MOTIF PROTEIN 23                             34   8e-04
3b4dA [x.x.x] POLYADENYLATE-BINDING PROTEIN 2                          34   8e-04
2dnnA [x.x.x] RNA-BINDING PROTEIN 12                                   34   8e-04
2dnyA [x.x.x] FUSE-BINDING PROTEIN-INTERACTING REPRESSOR,              34   8e-04
2dnpA [x.x.x] RNA-BINDING PROTEIN 14                                   34   8e-04
2dnzA [x.x.x] PROBABLE RNA-BINDING PROTEIN 23                          34   0.001

>1cvjC [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 168

 Score = 49.7 bits (117), Expect = 1e-08
 Identities = 14/63 (22%), Positives = 26/63 (41%), Gaps = 3/63 (4%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +    +  G    +  +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKFSPAG---PILSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKH 171
           A  
Sbjct: 58  ALD 60


>3dedA [x.x.x] PROBABLE HEMOLYSIN
          Length = 84

 Score = 49.7 bits (118), Expect = 2e-08
 Identities = 8/88 (9%), Positives = 19/88 (21%), Gaps = 6/88 (6%)

Query: 90  QGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVN 149
           + V+R++                  +L      +         G   +L  V        
Sbjct: 2   EIVQREDGSWLVDGVSLDRF-REFFELEAPLPGEAGGNIHTLAGVLYQLGRVPS--VTDR 58

Query: 150 GKSKGQAFVEFTSPQAATAAKHQIESLN 177
            +  G +F               +   +
Sbjct: 59  FEWNGFSFEVVDDRTRVDKI---LVQRH 83


>1cvjF [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 131

 Score = 48.7 bits (115), Expect = 3e-08
 Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 3/64 (4%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +    +     G +  +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKFS---PAGPILSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQ 172
           A   
Sbjct: 58  ALDT 61


>2dgqA [x.x.x] BRUNO-LIKE 6, RNA BINDING PROTEIN
          Length = 108

 Score = 47.8 bits (113), Expect = 6e-08
 Identities = 12/81 (14%), Positives = 32/81 (39%), Gaps = 6/81 (7%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +  P        L++  +     + +++         G + ++T  + ++ G  KG A
Sbjct: 4   GSSGVPMKDHDAIKLFVGQIPRGLDEQDLKPLF---EEFGRIYELTVLKDRLTGLHKGCA 60

Query: 157 FVEFTSPQAATAAKHQIESLN 177
           F+ + +  +A  A     +L+
Sbjct: 61  FLTYCARDSALKA---QSALH 78


>1cvjD [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 161

 Score = 45.7 bits (107), Expect = 2e-07
 Identities = 16/91 (17%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +          G +  +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKF---SPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQIESLNAAQQSARKYSVNYTQPHTNPFR 199
           A   ++++N      +   + ++Q   +  +
Sbjct: 58  A---LDTMNFDVIKGKPVRIMWSQRDPSLRK 85


>3dedC [x.x.x] PROBABLE HEMOLYSIN
          Length = 88

 Score = 45.2 bits (106), Expect = 3e-07
 Identities = 8/80 (10%), Positives = 16/80 (20%), Gaps = 2/80 (2%)

Query: 93  KRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKS 152
            ++E  +               +L      +         G   +L  V         + 
Sbjct: 8   VQREDGSWLVDGVSLDRFREFFELEAPLPGEAGGNIHTLAGVLYQLGRVPS--VTDRFEW 65

Query: 153 KGQAFVEFTSPQAATAAKHQ 172
            G +F              Q
Sbjct: 66  NGFSFEVVDDRTRVDKILVQ 85


>1b7fA [d.58.7 - d.58.7] PROTEIN (SXL-LETHAL PROTEIN)
          Length = 167

 Score = 43.0 bits (100), Expect = 2e-06
 Identities = 23/122 (18%), Positives = 39/122 (31%), Gaps = 6/122 (4%)

Query: 107 ATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAA 166
           + + L ++ L    TD E+          G +           G S G AFV+FTS   +
Sbjct: 1   SNTNLIVNYLPQDMTDRELY---ALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDS 57

Query: 167 TAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRSSSAGFNSPVQ 226
             A   I+ LN      ++  V+Y +P     +          +          F     
Sbjct: 58  QRA---IKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGS 114

Query: 227 GM 228
            +
Sbjct: 115 IV 116


>2cpzA [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
          Length = 115

 Score = 42.1 bits (98), Expect = 3e-06
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 6/101 (5%)

Query: 93  KRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKS 152
           ++         +    + L+I  L     D ++          G +        K    S
Sbjct: 10  QQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMF---MPFGNVVSAKVFIDKQTNLS 66

Query: 153 KGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           K   FV + +P +A AA   I+S+N  Q   ++  V   + 
Sbjct: 67  KCFGFVSYDNPVSAQAA---IQSMNGFQIGMKRLKVQLKRS 104


>1a9nB [d.58.7] SPLICEOSOMAL U2B''
          Length = 94

 Score = 42.0 bits (98), Expect = 3e-06
 Identities = 16/86 (18%), Positives = 32/86 (37%), Gaps = 5/86 (5%)

Query: 108 TSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAAT 167
              +YI+++      +E++  + A     +   V         K +GQAFV F    ++T
Sbjct: 4   NHTIYINNMNDKIKKEELKRSLYALF--SQFGHVVDIVALKTMKMRGQAFVIFKELGSST 61

Query: 168 AAKHQIESLNAAQQSARKYSVNYTQP 193
            A   +  L       +   + Y + 
Sbjct: 62  NA---LRQLQGFPFYGKPMRIQYAKT 84


>2dhxA [x.x.x] POLY (ADP-RIBOSE) POLYMERASE FAMILY, MEMBER 10
          Length = 104

 Score = 41.5 bits (97), Expect = 5e-06
 Identities = 5/67 (7%), Positives = 14/67 (20%), Gaps = 9/67 (13%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAK 170
           + +  L     D+ +  +                      +      + F  P  A    
Sbjct: 11  VEVRGLPPAVPDELLTLYFENRR------RSGGGPVLSWQRLGCGGVLTFREPADAERV- 63

Query: 171 HQIESLN 177
             +   +
Sbjct: 64  --LAQAD 68


>2cqcA [x.x.x] ARGININE/SERINE-RICH SPLICING FACTOR 10
          Length = 95

 Score = 41.3 bits (96), Expect = 5e-06
 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 6/96 (6%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +    +PD    L +  L  +TT+ ++R         G + DV+    + + +S+G A
Sbjct: 4   GSSGNRANPDPNCCLGVFGLSLYTTERDLR---EVFSKYGPIADVSIVYDQQSRRSRGFA 60

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQ 192
           FV F +   A  A    E  N  +   R+  V+   
Sbjct: 61  FVYFENVDDAKEA---KERANGMELDGRRIRVSGPS 93


>3b4mD [x.x.x] POLYADENYLATE-BINDING PROTEIN 2
          Length = 79

 Score = 41.2 bits (96), Expect = 5e-06
 Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAA 169
           +Y+ ++ +  T +E+    +  G       VT    K +G  KG A++EF+  ++   +
Sbjct: 6   IYVGNVDYGATAEELEAHFHGCGSV---NRVTILCDKFSGHPKGFAYIEFSDKESVRTS 61


>2dh7A [x.x.x] NUCLEOLYSIN TIAR
          Length = 105

 Score = 40.9 bits (95), Expect = 6e-06
 Identities = 20/97 (20%), Positives = 34/97 (35%), Gaps = 6/97 (6%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             + +  D      +++ DL    T ++I+      G    + D    +    GKSKG  
Sbjct: 4   GSSGQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGK---ISDARVVKDMATGKSKGYG 60

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           FV F +   A  A   I  +       R+   N+   
Sbjct: 61  FVSFYNKLDAENA---IVHMGGQWLGGRQIRTNWATR 94


>2cjkA [x.x.x] NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN 4
          Length = 167

 Score = 40.5 bits (93), Expect = 9e-06
 Identities = 15/62 (24%), Positives = 26/62 (41%), Gaps = 3/62 (4%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAK 170
           ++I  L W TT+D +R +    G      D+   +    G+S+G  F+ F  P +     
Sbjct: 6   MFIGGLNWDTTEDNLREYFGKYGTV---TDLKIMKDPATGRSRGFGFLSFEKPSSVDEVV 62

Query: 171 HQ 172
             
Sbjct: 63  KT 64


>2a3jA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
          Length = 96

 Score = 39.9 bits (93), Expect = 1e-05
 Identities = 11/93 (11%), Positives = 41/93 (44%), Gaps = 7/93 (7%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINA-TGCEGELKDVTFSEHKVNGKSKGQAFVEF 160
           P   + +  + I+++      ++++  + A    +G++ D+      ++  + G+A++ F
Sbjct: 2   PPHTEPSQVVLITNINPEVPKEKLQALLYALASSQGDILDIVVD---LSDDNSGKAYIVF 58

Query: 161 TSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
            + ++A A    +E+            + +++ 
Sbjct: 59  ATQESAQAF---VEAFQGYPFQGNPLVITFSET 88


>2e5iA [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN L-LIKE
          Length = 124

 Score = 39.8 bits (92), Expect = 1e-05
 Identities = 24/125 (19%), Positives = 40/125 (32%), Gaps = 17/125 (13%)

Query: 94  RKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSK 153
            +   TD P+  +    L I +  +  T D +    N  G              +  ++ 
Sbjct: 11  TRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGK--------VQRIVIFKRNG 62

Query: 154 GQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDR 213
            QA VEF S   A  A     +LN A   A   ++              + N +R  +D 
Sbjct: 63  IQAMVEFESVLCAQKA---KAALNGADIYAGCCTLKIEYARP------TRLNVIRNDNDS 113

Query: 214 SRSSS 218
              + 
Sbjct: 114 WDYTK 118


>2cphA [x.x.x] RNA BINDING MOTIF PROTEIN 19
          Length = 107

 Score = 39.8 bits (92), Expect = 1e-05
 Identities = 14/76 (18%), Positives = 27/76 (35%), Gaps = 2/76 (2%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             + +      TS + + ++ +     EIR   +  G           +    G  +G  
Sbjct: 4   GSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKT--VRLPKKMTGTGAHRGFG 61

Query: 157 FVEFTSPQAATAAKHQ 172
           FV+F + Q A  A + 
Sbjct: 62  FVDFITKQDAKKAFNA 77


>2ek6A [x.x.x] RNA-BINDING PROTEIN 12
          Length = 78

 Score = 39.3 bits (91), Expect = 2e-05
 Identities = 17/82 (20%), Positives = 33/82 (40%), Gaps = 6/82 (7%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           + + + ++ +  + DEI  +         +      ++   G   G+A V F S   ATA
Sbjct: 2   TVIKVQNMPFTVSIDEILDFF---YGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATA 58

Query: 169 AKHQIESLNAAQQSARKYSVNY 190
           A   +  LN     +RK  ++ 
Sbjct: 59  A---VIDLNDRPIGSRKVKLSG 77


>2dhaA [x.x.x] FLJ20171 PROTEIN
          Length = 123

 Score = 38.7 bits (89), Expect = 3e-05
 Identities = 15/120 (12%), Positives = 35/120 (29%), Gaps = 12/120 (10%)

Query: 101 RPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEF 160
           +    +    + +  L +  T +E+  +          K+        +G+  G AFV F
Sbjct: 16  QFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGILFVTYPDGRPTGDAFVLF 75

Query: 161 TSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRSSSAG 220
              + A  A       +      R   +  +           +   +  +   +   S+G
Sbjct: 76  ACEEYAQNAL----RKHKDLLGKRYIELFRSTA--------AEVQQVLNRFSSASGPSSG 123


>2dnlA [x.x.x] CYTOPLASMIC POLYADENYLATION ELEMENT BINDING
          Length = 114

 Score = 38.6 bits (89), Expect = 3e-05
 Identities = 20/119 (16%), Positives = 35/119 (29%), Gaps = 6/119 (5%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFT 161
            +    +  +++  L     +DEI       G          +E K     KG AF+ F 
Sbjct: 2   SSGSSGSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWP-HKAESKSYFPPKGYAFLLFQ 60

Query: 162 SPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRSSSAG 220
              +  A    I++    +       V+       P +  P  N            S+G
Sbjct: 61  EESSVQAL---IDACL-EEDGKLYLCVSSPTIKDKPVQIRPW-NLSDSDFVMDSGPSSG 114


>2dgpA [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
          Length = 106

 Score = 38.6 bits (89), Expect = 3e-05
 Identities = 13/81 (16%), Positives = 30/81 (37%), Gaps = 6/81 (7%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
           S             L+I  +     + +++      G    + ++T  + +  G  KG A
Sbjct: 2   SSGSSGMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGK---IYELTVLKDRFTGMHKGCA 58

Query: 157 FVEFTSPQAATAAKHQIESLN 177
           F+ +   ++A  A     +L+
Sbjct: 59  FLTYCERESALKA---QSALH 76


>1cx0A [d.58.7] U1A PROTEIN
          Length = 91

 Score = 38.6 bits (89), Expect = 3e-05
 Identities = 17/90 (18%), Positives = 29/90 (32%), Gaps = 6/90 (6%)

Query: 104 DPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSP 163
           +      +YI++L      DE++  ++A                     +GQAFV F   
Sbjct: 2   ETRPNHTIYINNLNEKIKKDELKKSLHAIFSR---FGQILDILVSRSLKRGQAFVIFKEV 58

Query: 164 QAATAAKHQIESLNAAQQSARKYSVNYTQP 193
            +AT A   + S         +     T  
Sbjct: 59  SSATNA---LRSQGFPFYDKPRIQYAKTDS 85


>2cq0A [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3
          Length = 103

 Score = 38.6 bits (89), Expect = 3e-05
 Identities = 17/97 (17%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +      D  + + +++L   T + +++         G +  +  ++ K  G+SKG A
Sbjct: 4   GSSGPNRRADDNATIRVTNLSEDTRETDLQELF---RPFGSISRIYLAKDKTTGQSKGFA 60

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           F+ F   + A  A   I  ++         +V + +P
Sbjct: 61  FISFHRREDAARA---IAGVSGFGYDHLILNVEWAKP 94


>3culA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
          Length = 88

 Score = 38.6 bits (89), Expect = 3e-05
 Identities = 19/91 (20%), Positives = 31/91 (34%), Gaps = 8/91 (8%)

Query: 103 TDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTS 162
           T P+ T  +YI++L      DE++  ++                      +GQAFV F  
Sbjct: 1   TRPNHT--IYINNLNEKIKKDELKKSLH---AIFSRFGQILDILVSRSLKRGQAFVIFKE 55

Query: 163 PQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
             +AT A   + S         +     T  
Sbjct: 56  VSSATNA---LRSQGFPFYDKPRIQYAKTDS 83


>3ctrA [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
          Length = 75

 Score = 38.4 bits (89), Expect = 4e-05
 Identities = 5/68 (7%), Positives = 15/68 (22%), Gaps = 8/68 (11%)

Query: 105 PDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQ 164
           P  +  +            ++    +A G              ++  S   +  +    +
Sbjct: 2   PLGSDHVLHVTFPKEWKTSDLYQLFSAFGN--------IQISWIDDTSAFVSLSQPEQVK 53

Query: 165 AATAAKHQ 172
            A      
Sbjct: 54  IAVNTSKY 61


>3d45A [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
          Length = 383

 Score = 38.3 bits (88), Expect = 4e-05
 Identities = 8/92 (8%), Positives = 22/92 (23%), Gaps = 14/92 (15%)

Query: 86  QVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSE 145
               + +       + P        +            ++    +A G            
Sbjct: 295 LFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGN----------- 343

Query: 146 HKVNGKSKGQAFVEFTSPQAATAAKHQIESLN 177
            +++      AFV  + P+    A   + +  
Sbjct: 344 IQISWIDDTSAFVSLSQPEQVQIA---VNTSK 372


>2e5hA [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-
          Length = 94

 Score = 38.2 bits (88), Expect = 4e-05
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 106 DATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQA 165
            + S +Y+S+L +  T++++          G++  VT  + K   KSKG AF+ F    +
Sbjct: 14  PSKSTVYVSNLPFSLTNNDLYRI---FSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDS 70

Query: 166 ATAAKHQIESLNAAQQSARKYSVNY 190
           A        ++N  Q   R    + 
Sbjct: 71  AQNC---TRAINNKQLFGRVIKASI 92


>2dgxA [x.x.x] KIAA0430 PROTEIN
          Length = 96

 Score = 38.2 bits (88), Expect = 4e-05
 Identities = 13/92 (14%), Positives = 34/92 (36%), Gaps = 5/92 (5%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFT 161
                  + + +S++ +  +  E++  +           V   E   +   + +A V+  
Sbjct: 3   SGSSGNGADVQVSNIDYRLSRKELQQLLQEAF--ARHGKVKSVELSPHTDYQLKAVVQME 60

Query: 162 SPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           + Q A  A   + SL+  +  ++K  V+    
Sbjct: 61  NLQDAIGA---VNSLHRYKIGSKKILVSLATG 89


>2dk2A [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN R
          Length = 97

 Score = 38.0 bits (88), Expect = 5e-05
 Identities = 16/97 (16%), Positives = 32/97 (32%), Gaps = 14/97 (14%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +  P        L++ +L    T++ +    +  G             +   K K  A
Sbjct: 4   GSSGDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGK-----------LERVKKLKDYA 52

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           FV F    AA  A   ++ +N  +    +  +   +P
Sbjct: 53  FVHFEDRGAAVKA---MDEMNGKEIEGEEIEIVLAKP 86


>1audA [d.58.7] U1A 102
          Length = 101

 Score = 37.9 bits (87), Expect = 5e-05
 Identities = 17/102 (16%), Positives = 36/102 (35%), Gaps = 5/102 (4%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFT 161
             +      +YI++L      DE++  +           +       + K +GQAFV F 
Sbjct: 2   VPETRPNHTIYINNLNEKIKKDELKKSL--HAIFSRFGQILDILVSRSLKMRGQAFVIFK 59

Query: 162 SPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPK 203
              +AT A   + S+       +   + Y +  ++    +  
Sbjct: 60  EVSSATNA---LRSMQGFPFYDKPMRIQYAKTDSDIIAKMKG 98


>1drzA [d.58.7] PROTEIN (U1 SMALL RIBONUCLEOPROTEIN A)
          Length = 91

 Score = 37.4 bits (86), Expect = 7e-05
 Identities = 17/90 (18%), Positives = 29/90 (32%), Gaps = 6/90 (6%)

Query: 104 DPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSP 163
           +      +YI++L      DE++  ++A                     +GQAFV F   
Sbjct: 2   ETRPNHTIYINNLNEKIKKDELKKSLHAIFSR---FGQILDILVSRSLKRGQAFVIFKEV 58

Query: 164 QAATAAKHQIESLNAAQQSARKYSVNYTQP 193
            +AT A   + S         +     T  
Sbjct: 59  SSATNA---LRSQGFPFYDKPRIQYAKTDS 85


>1cvjB [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 151

 Score = 37.3 bits (85), Expect = 8e-05
 Identities = 14/64 (21%), Positives = 25/64 (39%), Gaps = 3/64 (4%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +          G +  +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLY---EKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQ 172
           A   
Sbjct: 58  ALDT 61


>2adbA [x.x.x] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
          Length = 127

 Score = 37.2 bits (85), Expect = 9e-05
 Identities = 11/108 (10%), Positives = 29/108 (26%), Gaps = 10/108 (9%)

Query: 100 DRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVE 159
                      + + +L++  T D +    +  G                  ++ QA ++
Sbjct: 4   MAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGT-------VLKIITFTKNNQFQALLQ 56

Query: 160 FTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPM 207
           +  P +A  A     SL+         ++               ++  
Sbjct: 57  YADPVSAQHA---KLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKS 101


>2disA [x.x.x] UNNAMED PROTEIN PRODUCT
          Length = 109

 Score = 37.1 bits (85), Expect = 9e-05
 Identities = 21/107 (19%), Positives = 37/107 (34%), Gaps = 6/107 (5%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFT 161
            +       L+I  +      +EI   I           V  S      K++G AFVE+ 
Sbjct: 2   SSGSSGNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAAD-KMKNRGFAFVEYE 60

Query: 162 SPQAATAAKHQIESLNAA--QQSARKYSVNYTQPHTNPFRTLPKDNP 206
           S +AA  A      L     Q    + +V++ +P  +    + +   
Sbjct: 61  SHRAAAMA---RRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVS 104


>3egnA [x.x.x] RNA-BINDING PROTEIN 40
          Length = 120

 Score = 37.1 bits (85), Expect = 1e-04
 Identities = 12/79 (15%), Positives = 24/79 (30%), Gaps = 2/79 (2%)

Query: 93  KRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVT--FSEHKVNG 150
               S        +    +Y+ +L     + +++                         G
Sbjct: 18  METLSVFRSYEPGEPNCRIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEG 77

Query: 151 KSKGQAFVEFTSPQAATAA 169
           + KGQAF+   + +AA  A
Sbjct: 78  RMKGQAFIGLPNEKAAAKA 96


>1cvjA [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 169

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 16/85 (18%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +    +  G    +  +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKFSPAGP---ILSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQIESLNAAQQSARKYSVNYTQP 193
           A   ++++N      +   + ++Q 
Sbjct: 58  A---LDTMNFDVIKGKPVRIMWSQR 79


>2cpxA [x.x.x] HYPOTHETICAL PROTEIN FLJ11016
          Length = 115

 Score = 36.8 bits (84), Expect = 1e-04
 Identities = 16/102 (15%), Positives = 36/102 (35%), Gaps = 6/102 (5%)

Query: 92  VKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGK 151
             RK          +    LY+ +L    T+ ++         +   K        + G+
Sbjct: 9   EIRKIPMFSSYNPGEPNKVLYLKNLSPRVTERDLVSLFARFQEK---KGPPIQFRMMTGR 65

Query: 152 SKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
            +GQAF+ F + + A  A   +  +N  +   +   + + + 
Sbjct: 66  MRGQAFITFPNKEIAWQA---LHLVNGYKLYGKILVIEFGKN 104


>2cpyA [x.x.x] RNA-BINDING PROTEIN 12
          Length = 114

 Score = 36.7 bits (84), Expect = 1e-04
 Identities = 11/76 (14%), Positives = 26/76 (34%), Gaps = 3/76 (3%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +       A    +I+++ +  T  ++             ++        NG+  GQA
Sbjct: 4   GSSGEGDVNSAKVCAHITNIPFSITKMDVL---QFLEGIPVDENAVHVLVDNNGQGLGQA 60

Query: 157 FVEFTSPQAATAAKHQ 172
            V+F +   A  ++  
Sbjct: 61  LVQFKNEDDARKSERL 76


>3d45B [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
          Length = 373

 Score = 36.5 bits (83), Expect = 1e-04
 Identities = 9/84 (10%), Positives = 22/84 (26%), Gaps = 14/84 (16%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
              + P        +            ++    +A G             +++      A
Sbjct: 294 LNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFG-----------NIQISWIDDTSA 342

Query: 157 FVEFTSPQAATAAKHQIESLNAAQ 180
           FV  + P+    A   + +   A+
Sbjct: 343 FVSLSQPEQVQIA---VNTSKYAE 363


>2do4A [x.x.x] SQUAMOUS CELL CARCINOMA ANTIGEN RECOGNIZED BY T-
          Length = 100

 Score = 36.3 bits (83), Expect = 2e-04
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 7/100 (7%)

Query: 94  RKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSK 153
              S   R +       L+IS L +  T +E+     A G   +L+ VT        K K
Sbjct: 3   SGSSGVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAG----KPK 58

Query: 154 GQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           G A+VE+ +   A+ A   +  ++          V  +  
Sbjct: 59  GLAYVEYENESQASQA---VMKMDGMTIKENIIKVAISNS 95


>2dnkA [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
          Length = 105

 Score = 36.3 bits (83), Expect = 2e-04
 Identities = 18/97 (18%), Positives = 38/97 (39%), Gaps = 4/97 (4%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +     P +   L++  L    ++D++R         G +++        +G SKG A
Sbjct: 4   GSSGCLRQPPSHRKLFVGMLNKQQSEDDVRRLFE---AFGNIEEC-TILRGPDGNSKGCA 59

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
           FV+++S   A AA + +        ++    V +   
Sbjct: 60  FVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADT 96


>2dgoA [x.x.x] CYTOTOXIC GRANULE-ASSOCIATED RNA BINDING PROTEIN
          Length = 115

 Score = 36.0 bits (82), Expect = 2e-04
 Identities = 23/124 (18%), Positives = 41/124 (33%), Gaps = 12/124 (9%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             + +  D      +++ DL    T ++I+         G + D    +    GKSKG  
Sbjct: 4   GSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFA---PFGRISDARVVKDMATGKSKGYG 60

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRS 216
           FV F +   A  A   I+ +       R+   N+           P        + +   
Sbjct: 61  FVSFFNKWDAENA---IQQMGGQWLGGRQIRTNWATRKP------PAPKSTYESNTKQSG 111

Query: 217 SSAG 220
            S+G
Sbjct: 112 PSSG 115


>2cpfA [x.x.x] RNA BINDING MOTIF PROTEIN 19
          Length = 98

 Score = 36.0 bits (82), Expect = 2e-04
 Identities = 18/83 (21%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAK 170
           L+I +L + TT++ ++G  +  G                  S G  FVE+  P+ A  A 
Sbjct: 8   LFIKNLNFSTTEETLKGVFSKVGAIKSCTISKKKNKAGVLLSMGFGFVEYKKPEQAQKA- 66

Query: 171 HQIESLNAAQQSARKYSVNYTQP 193
             ++ L        K  V  ++ 
Sbjct: 67  --LKQLQGHTVDGHKLEVRISER 87


>1a9nD [d.58.7] SPLICEOSOMAL U2B''
          Length = 93

 Score = 35.9 bits (82), Expect = 2e-04
 Identities = 16/86 (18%), Positives = 32/86 (37%), Gaps = 5/86 (5%)

Query: 108 TSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAAT 167
              +YI+++      +E++  + A     +   V         K +GQAFV F    ++T
Sbjct: 4   NHTIYINNMNDKIKKEELKRSLYALF--SQFGHVVDIVALKTMKMRGQAFVIFKELGSST 61

Query: 168 AAKHQIESLNAAQQSARKYSVNYTQP 193
            A   +  L       +   + Y + 
Sbjct: 62  NA---LRQLQGFPFYGKPMRIQYAKT 84


>1cvjH [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 132

 Score = 35.7 bits (81), Expect = 2e-04
 Identities = 15/69 (21%), Positives = 30/69 (43%), Gaps = 6/69 (8%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +    +  G       +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKFSPAGPI---LSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQIESLN 177
           A   ++++N
Sbjct: 58  A---LDTMN 63


>2cqdA [x.x.x] RNA-BINDING REGION CONTAINING PROTEIN 1
          Length = 116

 Score = 35.6 bits (81), Expect = 3e-04
 Identities = 21/105 (20%), Positives = 36/105 (34%), Gaps = 7/105 (6%)

Query: 105 PDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQ 164
               + +++  L + TTD  +R +       G++++      +  GKS+G  FV      
Sbjct: 14  DTTFTKIFVGGLPYHTTDASLRKY---FEGFGDIEEAVVITDRQTGKSRGYGFVTMADRA 70

Query: 165 AATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRG 209
           AA  A    +  N      RK +VN       P            
Sbjct: 71  AAERA---CKDPNPIIDG-RKANVNLAYLGAKPRSLQTGFAIGVS 111


>2cqgA [x.x.x] TAR DNA-BINDING PROTEIN-43
          Length = 103

 Score = 35.5 bits (81), Expect = 3e-04
 Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 3/81 (3%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
             +        TS L +  L W TT+ +++ + +     GE+  V   +    G SKG  
Sbjct: 4   GSSGVKRAVQKTSDLIVLGLPWKTTEQDLKEYFS---TFGEVLMVQVKKDLKTGHSKGFG 60

Query: 157 FVEFTSPQAATAAKHQIESLN 177
           FV FT  +       Q   ++
Sbjct: 61  FVRFTEYETQVKVMSQRHMID 81


>2cqbA [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
          Length = 102

 Score = 35.1 bits (80), Expect = 4e-04
 Identities = 22/93 (23%), Positives = 34/93 (36%), Gaps = 6/93 (6%)

Query: 101 RPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEF 160
                     LY+  L     D  +       G    + D+         K +G AFVEF
Sbjct: 5   SSGMATTKRVLYVGGLAEEVDDKVLHAAFIPFGD---ITDIQIPLDYETEKHRGFAFVEF 61

Query: 161 TSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
              + A AA   I+++N ++   R   VN  +P
Sbjct: 62  ELAEDAAAA---IDNMNESELFGRTIRVNLAKP 91


>3cunA [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
          Length = 87

 Score = 34.7 bits (79), Expect = 5e-04
 Identities = 16/83 (19%), Positives = 27/83 (32%), Gaps = 6/83 (7%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAK 170
           +YI++L      DE++  ++                      +GQAFV F    +AT A 
Sbjct: 6   IYINNLNEKIKKDELKKSLH---AIFSRFGQILDILVSRSLKRGQAFVIFKEVSSATNA- 61

Query: 171 HQIESLNAAQQSARKYSVNYTQP 193
             + S         +     T  
Sbjct: 62  --LRSQGFPFYDKPRIQYAKTDS 82


>1cvjG [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
          Length = 165

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 16/91 (17%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 109 SALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATA 168
           ++LY+ DL+   T+  +    +  G       +      +  +S G A+V F  P  A  
Sbjct: 1   ASLYVGDLHPDVTEAMLYEKFSPAGPI---LSIRVCRDMITRRSLGYAYVNFQQPADAER 57

Query: 169 AKHQIESLNAAQQSARKYSVNYTQPHTNPFR 199
           A   ++++N      +   + ++Q   +  +
Sbjct: 58  A---LDTMNFDVIKGKPVRIMWSQRDPSLRK 85


>2cq4A [x.x.x] RNA BINDING MOTIF PROTEIN 23
          Length = 114

 Score = 34.0 bits (77), Expect = 8e-04
 Identities = 17/106 (16%), Positives = 35/106 (33%), Gaps = 7/106 (6%)

Query: 88  PQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHK 147
                  +E   +   +      ++   L       ++  +       G+++DV     +
Sbjct: 5   SSGKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFF---SAVGKVRDVRIISDR 61

Query: 148 VNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
            + +SKG A+VEF   Q+   A      L   +       V  +Q 
Sbjct: 62  NSRRSKGIAYVEFCEIQSVPLAI----GLTGQRLLGVPIIVQASQA 103


>3b4dA [x.x.x] POLYADENYLATE-BINDING PROTEIN 2
          Length = 80

 Score = 34.0 bits (77), Expect = 8e-04
 Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 111 LYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAA 169
           +Y+ ++ +  T +E+          G +  VT    K +G  KG A++EF+  ++   +
Sbjct: 6   IYVGNVDYGATAEELEAH---FHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS 61


>2dnnA [x.x.x] RNA-BINDING PROTEIN 12
          Length = 108

 Score = 33.9 bits (77), Expect = 8e-04
 Identities = 17/121 (14%), Positives = 32/121 (26%), Gaps = 17/121 (14%)

Query: 97  SPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQA 156
           S             + +  + +   ++++R + +         D         G++ G  
Sbjct: 5   SSGKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRV-----DAVHLLKDHVGRNNGNG 59

Query: 157 FVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRS 216
            V+F SPQ    A       N      R   V+             +     G      S
Sbjct: 60  LVKFLSPQDTFEAL----KRNRMLMIQRYVEVSPATE--------RQWVAAGGHITSGPS 107

Query: 217 S 217
           S
Sbjct: 108 S 108


>2dnyA [x.x.x] FUSE-BINDING PROTEIN-INTERACTING REPRESSOR,
          Length = 119

 Score = 33.9 bits (77), Expect = 8e-04
 Identities = 17/122 (13%), Positives = 31/122 (25%), Gaps = 19/122 (15%)

Query: 100 DRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVN----GKSKGQ 155
            + +       +          + E+       G  G +  V   + K       +   +
Sbjct: 12  KQESTVMVLRNMVDPKDIDDDLEGEVT---EECGKFGAVNRVIIYQEKQGEEEDAEIIVK 68

Query: 156 AFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSR 215
            FVEF+       A   I++LN    + RK                 +            
Sbjct: 69  IFVEFSIASETHKA---IQALNGRWFAGRKVVAEVYD---------QERFDNSDLSASGP 116

Query: 216 SS 217
           SS
Sbjct: 117 SS 118


>2dnpA [x.x.x] RNA-BINDING PROTEIN 14
          Length = 90

 Score = 33.9 bits (77), Expect = 8e-04
 Identities = 15/92 (16%), Positives = 26/92 (28%), Gaps = 14/92 (15%)

Query: 102 PTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFT 161
                 T  +++ ++    T  E+R                          K  AFV   
Sbjct: 3   SGSSGNTWKIFVGNVSAACTSQELRSLFE-----------RRGRVIECDVVKDYAFVHME 51

Query: 162 SPQAATAAKHQIESLNAAQQSARKYSVNYTQP 193
               A AA   I  LN  +   ++ +V  +  
Sbjct: 52  KEADAKAA---IAQLNGKEVKGKRINVELSTK 80


>2dnzA [x.x.x] PROBABLE RNA-BINDING PROTEIN 23
          Length = 95

 Score = 33.7 bits (76), Expect = 0.001
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 108 TSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAAT 167
           +S LY+  L++  T+D +RG     G      ++   +    G+SKG  F+ F+  + A 
Sbjct: 5   SSGLYVGSLHFNITEDMLRGIFEPFGKI---DNIVLMKDSDTGRSKGYGFITFSDSECAR 61

Query: 168 AAKHQIESLNAAQQSARKYSVNYTQP 193
            A   +E LN  + + R   V +   
Sbjct: 62  RA---LEQLNGFELAGRPMRVGHVTE 84


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0634    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,381,758
Number of extensions: 1604394
Number of successful extensions: 17843
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6666
Number of HSP's successfully gapped: 901
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)