RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= CIRT_01675 cimm2 CIRG_01672 Broad_Institute ""
         (270 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2cayB [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36                      65   2e-13
2cayA [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36                      63   9e-13
2dx5A [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36                      38   3e-05
1bdp- [x.x.x] DNA POLYMERASE I                                         37   8e-05
2bdpA [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)                      36   2e-04
1d9dA [c.55.3 - e.8.1] DNA POLYMERASE I                                34   5e-04

>2cayB [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
          Length = 131

 Score = 65.4 bits (159), Expect = 2e-13
 Identities = 30/139 (21%), Positives = 53/139 (38%), Gaps = 16/139 (11%)

Query: 23  SWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGDESLSLQSSNGRVHLTNQRIV 82
            +V    +   +    E+ I           Q++    G   +  Q   GR+ LT+QRI+
Sbjct: 7   HYVETTSSGQPLLREGEKDI--------FIDQSVGLYHGKSKIL-QRQRGRIFLTSQRII 57

Query: 83  YLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKMTF 142
           Y+     P   S    L +L     S+ F   +    I+         PS++   V+++F
Sbjct: 58  YIDDA-KPTQNSLGLELDDLAYVNYSSGFLTRSPRL-ILFFK-----DPSSSTEFVQLSF 110

Query: 143 KEGGAFDFHSAFERIKERL 161
           ++     F  A ER  E +
Sbjct: 111 RKSDGVLFSQATERALENI 129


>2cayA [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
          Length = 132

 Score = 63.1 bits (153), Expect = 9e-13
 Identities = 30/142 (21%), Positives = 51/142 (35%), Gaps = 18/142 (12%)

Query: 23  SWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGD-ESLSLQSSNGRVHLTNQRI 81
            +V    +   +    E+ I              +      +S  LQ   GR+ LT+QRI
Sbjct: 7   HYVETTSSGQPLLREGEKDI----------FIDQSVGLYHGKSKILQRQRGRIFLTSQRI 56

Query: 82  VYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKMT 141
           +Y+     P   S    L +L     S+ F      S  +         PS++   V+++
Sbjct: 57  IYIDDA-KPTQNSLGLELDDLAYVNYSSGFLT---RSPRLILFFKD---PSSSTEFVQLS 109

Query: 142 FKEGGAFDFHSAFERIKERLQQ 163
           F++     F  A ER  E +  
Sbjct: 110 FRKSDGVLFSQATERALENILT 131


>2dx5A [x.x.x] VACUOLAR PROTEIN SORTING PROTEIN 36
          Length = 99

 Score = 38.0 bits (88), Expect = 3e-05
 Identities = 16/128 (12%), Positives = 40/128 (31%), Gaps = 33/128 (25%)

Query: 36  LPNERLIYTSPLRTTISLQALNPRPGDESLSLQSSNGRVHLTNQRIVYLPVQPTPQFQSF 95
             NE L+     +  + +        ++  +     G + L+  R+++       +    
Sbjct: 3   EINETLVIQ---QRGVRVY----DGEEKFDA-----GTLLLSTHRLIWRD----QKNNEC 46

Query: 96  SAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKMTFKEGGAFDFHSAFE 155
              +      F+            +V                ++++FKE G  +F+    
Sbjct: 47  CMAIPLSQIVFIE------EQAKIVVHLHSKNSY--------IRLSFKEHGQIEFYR--- 89

Query: 156 RIKERLQQ 163
           R+ E + Q
Sbjct: 90  RLSEEMTQ 97


>1bdp- [x.x.x] DNA POLYMERASE I
          Length = 574

 Score = 36.8 bits (84), Expect = 8e-05
 Identities = 11/50 (22%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 128 GIPPSNTAVQVKMTFKEGGAF--DFHSAFERIKERLQQVVEQARENGMIS 175
           GI     A  + ++ KE   F   +  +F  +K  ++ +V++A++ G ++
Sbjct: 413 GISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVT 462


>2bdpA [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)
          Length = 580

 Score = 35.6 bits (81), Expect = 2e-04
 Identities = 11/54 (20%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 124 VVGGGIPPSNTAVQVKMTFKEGGAF--DFHSAFERIKERLQQVVEQARENGMIS 175
           V G        A  + ++ KE   F   +  +F  +K  ++ +V++A++ G ++
Sbjct: 417 VYGIS--DYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVT 468


>1d9dA [c.55.3 - e.8.1] DNA POLYMERASE I
          Length = 601

 Score = 34.1 bits (77), Expect = 5e-04
 Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 4/57 (7%)

Query: 118 SAIVQPVVGGGIPPSNTAVQVKMTFKEGGAF--DFHSAFERIKERLQQVVEQARENG 172
           +     + G        A Q+ +  KE   +   +   +  + E +++   QA+E G
Sbjct: 432 AINFGLIYGMSAF--GLARQLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQG 486


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0619    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 27,883,887
Number of extensions: 1742352
Number of successful extensions: 17210
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6564
Number of HSP's successfully gapped: 239
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)