RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= CIRT_02566 cimm2 CIRG_02563 Broad_Institute ""
         (287 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2eepA [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE                   48   4e-08
2c7bB [x.x.x] CARBOXYLESTERASE                                         48   4e-08
2c7bA [x.x.x] CARBOXYLESTERASE                                         47   5e-08
3be8A [x.x.x] NEUROLIGIN-4, X-LINKED                                   43   1e-06
2d81A [x.x.x] PHB DEPOLYMERASE                                         42   2e-06
3bl8C [x.x.x] NEUROLIGIN-2                                             42   2e-06
3ccbA [x.x.x] DIPEPTIDYL PEPTIDASE 4                                   42   3e-06
3be8B [x.x.x] NEUROLIGIN-4, X-LINKED                                   41   4e-06
3eblF [x.x.x] GIBBERELLIN RECEPTOR GID1                                41   4e-06
1a7uA [c.69.1] CHLOROPEROXIDASE T                                      41   6e-06
3dl7A [x.x.x] ACETYLCHOLINESTERASE                                     39   1e-05
1c2bA [c.69.1] ACETYLCHOLINESTERASE                                    39   2e-05
3bl8D [x.x.x] NEUROLIGIN-2                                             38   3e-05
3d3nB [x.x.x] PUTATIVE LIPASE/ESTERASE                                 38   3e-05
3dyvA [x.x.x] ESTERASE D                                               38   4e-05
3ed1B [x.x.x] GIBBERELLIN RECEPTOR GID1                                37   6e-05
3dkrA [x.x.x] ESTERASE D                                               36   1e-04
3bl8B [x.x.x] NEUROLIGIN-2                                             36   1e-04
3bixA [x.x.x] NEUROLIGIN-1                                             36   1e-04
3ds8A [x.x.x] LIN2722 PROTEIN                                          36   1e-04
2cutA [x.x.x] CUTINASE                                                 36   1e-04
3bjrA [x.x.x] PUTATIVE CARBOXYLESTERASE                                36   2e-04
2dfpA [c.69.1] PROTEIN (ACETYLCHOLINESTERASE)                          36   2e-04
3b3qA [x.x.x] NLGN1 PROTEIN                                            36   2e-04
3e3aB [x.x.x] POSSIBLE PEROXIDASE BPOC                                 36   2e-04
3eblE [x.x.x] GIBBERELLIN RECEPTOR GID1                                35   2e-04
3eblC [x.x.x] GIBBERELLIN RECEPTOR GID1                                35   2e-04
3bl8A [x.x.x] NEUROLIGIN-2                                             35   3e-04
2bceA [x.x.x] CHOLESTEROL ESTERASE                                     35   4e-04
1be0A [c.69.1 (1cijA)] HALOALKANE DEHALOGENASE                         34   4e-04
1b6gA [x.x.x] HALOALKANE DEHALOGENASE                                  34   5e-04
1broA [c.69.1] BROMOPEROXIDASE A2                                      34   7e-04
1cuxA [x.x.x] CUTINASE                                                 34   7e-04
3b5eB [x.x.x] MLL8374 PROTEIN                                          33   8e-04

>2eepA [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE
          Length = 659

 Score = 47.9 bits (111), Expect = 4e-08
 Identities = 19/148 (12%), Positives = 37/148 (25%), Gaps = 6/148 (4%)

Query: 142 ALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLL 201
            +  L         RIG      G    T  +     +++   A             +  
Sbjct: 509 GVDFLKSQSWVDADRIGVHGWSYGGFMTTNLMLTHGDVFKVGVAGGPVIDWNRYEIMYGE 568

Query: 202 GTTGCPPFDSK------PEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVK 255
                P  + +        +    L   ++L+HG  D VV             +      
Sbjct: 569 RYFDAPQENPEGYDAANLLKRAGDLKGRLMLIHGAIDPVVVWQHSLLFLDACVKARTYPD 628

Query: 256 FYEYSGAENEGHWIKEPDGFDQIAAFLE 283
           +Y Y   E+          ++ I  +  
Sbjct: 629 YYVYPSHEHNVMGPDRVHLYETITRYFT 656


>2c7bB [x.x.x] CARBOXYLESTERASE
          Length = 286

 Score = 47.8 bits (112), Expect = 4e-08
 Identities = 23/180 (12%), Positives = 45/180 (25%), Gaps = 14/180 (7%)

Query: 111 YVLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFT 170
             L  +    + LG   D I   G S G   A    +      +  +   V     +   
Sbjct: 109 AALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNTG 168

Query: 171 LHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGT 230
           +     ++       + L   +      +L        F + P         P L++   
Sbjct: 169 VPTASLVEFGV-AETTSLPIELVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAE 227

Query: 231 DDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI-------KEPDGFDQIAAFLE 283
            D + D     +     K  G       +        ++          +  D  AA + 
Sbjct: 228 YDPLRDE---GELYAYKKASGSRAVAVRF---AGVHGFVSFYPFVDAGREALDLAAASIR 281


>2c7bA [x.x.x] CARBOXYLESTERASE
          Length = 290

 Score = 47.4 bits (111), Expect = 5e-08
 Identities = 23/180 (12%), Positives = 46/180 (25%), Gaps = 14/180 (7%)

Query: 111 YVLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFT 170
             L  +    + LG   D I   G S G   A    +      +  +   V     +   
Sbjct: 113 AALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNTG 172

Query: 171 LHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGT 230
           +     ++   ++  S     +      +L        F + P         P L++   
Sbjct: 173 VPTASLVEFGVAETTSLPIE-LVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAE 231

Query: 231 DDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI-------KEPDGFDQIAAFLE 283
            D + D     +     K  G       +        ++          +  D  AA + 
Sbjct: 232 YDPLRDE---GELYAYKKASGSRAVAVRF---AGVHGFVSFYPFVDAGREALDLAAASIR 285


>3be8A [x.x.x] NEUROLIGIN-4, X-LINKED
          Length = 543

 Score = 42.6 bits (98), Expect = 1e-06
 Identities = 18/169 (10%), Positives = 31/169 (18%), Gaps = 32/169 (18%)

Query: 112 VLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTL 171
            L  IE  +   GG    +   G   G +      L                        
Sbjct: 191 ALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYS----EGLFQKAIIQSGTALS 246

Query: 172 HIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTD 231
                 Q                                   E ++   +   L+     
Sbjct: 247 SWAVNYQ------------PAKYTRILADKVGCNMLDTTDMVECLRNK-NYKELIQQTIT 293

Query: 232 DAVVDISLG------------QQACQLLKEMGMDVKFYEYSGAENEGHW 268
            A   I+ G            Q   +  + +  D+        + EG  
Sbjct: 294 PATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVN---QGEGLK 339


>2d81A [x.x.x] PHB DEPOLYMERASE
          Length = 318

 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 17/166 (10%), Positives = 40/166 (24%), Gaps = 16/166 (9%)

Query: 120 IELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQL 179
           +       +++   GL+ G   A    +          G F G         +    +  
Sbjct: 3   LPAFNVNPNSVSVSGLASGGYMAAQLGVAYSDVFNVGFGVFAGGPYDCARNQYYTSCMYN 62

Query: 180 YRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISL 239
                 +                        ++   V  +    + +  G+ D  V  ++
Sbjct: 63  GYPSITT--------------PTANMKSWSGNQIASVANLGQRKIYMWTGSSDTTVGPNV 108

Query: 240 GQQACQLLKEMG--MDVKFYEYSGAENEGHWIKEPDGFDQIAAFLE 283
             Q    L       +V +   +GA +         G +  +    
Sbjct: 109 MNQLKAQLGNFDNSANVSYVTTTGAVHTFPTDFNGAGDNSCSLSTS 154


>3bl8C [x.x.x] NEUROLIGIN-2
          Length = 545

 Score = 41.8 bits (96), Expect = 2e-06
 Identities = 20/174 (11%), Positives = 35/174 (20%), Gaps = 32/174 (18%)

Query: 112 VLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTL 171
            L  +   I   GG  + I   G   G +     +L                        
Sbjct: 176 ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHS----EGLFQKAIAQSGTAIS 231

Query: 172 HIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTD 231
                 Q             +                     E ++   S+  L+     
Sbjct: 232 SWSVNYQ------------PLKYTRLLAAKVGCDREDSTEAVECLRRK-SSRELVDQDVQ 278

Query: 232 DAVVDISLG------------QQACQLLKEMGMDVKFYEYSGAENEGHWIKEPD 273
            A   I+ G            +   Q  + +  D+        + EG    E  
Sbjct: 279 PARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVN---QGEGLKFVEDS 329


>3ccbA [x.x.x] DIPEPTIDYL PEPTIDASE 4
          Length = 724

 Score = 41.6 bits (95), Expect = 3e-06
 Identities = 27/237 (11%), Positives = 63/237 (26%), Gaps = 25/237 (10%)

Query: 51  SGGQDLPSLFPSWRWVFPSSGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQ 110
                  S      +    +    +   +   S     +          +  +      +
Sbjct: 503 DVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVE 562

Query: 111 YVLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFT 170
             +    +  ++    +  I   G S G       L    G  K  I            +
Sbjct: 563 DQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDS 622

Query: 171 LHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGT 230
           ++ ++ + L   +   +   +  +                      +       LL+HGT
Sbjct: 623 VYTERYMGLPTPEDNLDHYRNSTV------------------MSRAENFKQVEYLLIHGT 664

Query: 231 DDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDG----FDQIAAFLE 283
            D  V      Q  + L ++G+D +   Y    +E H I         +  ++ F++
Sbjct: 665 ADDNVHFQQSAQISKALVDVGVDFQAMWY---TDEDHGIASSTAHQHIYTHMSHFIK 718


>3be8B [x.x.x] NEUROLIGIN-4, X-LINKED
          Length = 534

 Score = 41.0 bits (94), Expect = 4e-06
 Identities = 24/262 (9%), Positives = 50/262 (19%), Gaps = 49/262 (18%)

Query: 16  HIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSSGSRWN 75
           +I  P        +++HG       + E   +                   +      + 
Sbjct: 109 NIYVPTESKKPVMVYIHGGS-----YMEGTGNMIDGSILASYGNVIVITINYRLGILGFL 163

Query: 76  ATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGL 135
           +T  +     + +                        L  IE  +   GG    +   G 
Sbjct: 164 STGDQAAKGNYGLLDQIQ------------------ALRWIEENVGAFGGDPKRVTIFGS 205

Query: 136 SQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLI 195
             G +      L        +            + ++   A                   
Sbjct: 206 GAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTD 265

Query: 196 MPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLG---------QQACQL 246
           M   L                    +   L+      A   I+ G              L
Sbjct: 266 MVECLRN-----------------KNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQIL 308

Query: 247 LKEMGMDVKFYEYSGAENEGHW 268
           +++             + EG  
Sbjct: 309 MEQGEFLNYDIMLGVNQGEGLK 330


>3eblF [x.x.x] GIBBERELLIN RECEPTOR GID1
          Length = 305

 Score = 41.0 bits (94), Expect = 4e-06
 Identities = 18/280 (6%), Positives = 45/280 (16%), Gaps = 12/280 (4%)

Query: 13  PDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQD---LPSLFPSWRWVFPS 69
             L   +                +N                     +     ++  +   
Sbjct: 18  NILRRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAFPVIIFF 77

Query: 70  SGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQ----YVLGVIEREIELLGG 125
            G  +  +                 ++   + +   +                   ++  
Sbjct: 78  HGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQ 137

Query: 126 RSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYA 185
                            +   +      +G           +       ++ +    KY 
Sbjct: 138 PFMRARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYF 197

Query: 186 SELGTSMCLIMPAFLLGTTGCPP--FDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQA 243
             L                   P      P   +         L       +        
Sbjct: 198 VTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAY 257

Query: 244 CQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFLE 283
              L+E G  VK  +    EN                 +E
Sbjct: 258 ADALREDGHHVKVVQC---ENATVGFYLLPNTVHYHEVME 294


>1a7uA [c.69.1] CHLOROPEROXIDASE T
          Length = 277

 Score = 40.6 bits (93), Expect = 6e-06
 Identities = 27/286 (9%), Positives = 61/286 (21%), Gaps = 19/286 (6%)

Query: 5   MEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWR 64
           +         + +           + +HG   +G    E   ++          +    R
Sbjct: 3   ITVGQENSTSIDLYYEDHGAGQPVVLIHGFPLSG-HSWERQSAALLD--AGYRVITYDRR 59

Query: 65  WVFPSSGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLG 124
               SS       +    +    +  L   + +  + +     + +    V       + 
Sbjct: 60  GFGQSSQPTTGYDYDTFAADLNTV--LETLDLQDAVLVGFSMGTGEVARYVSSYGTARIA 117

Query: 125 GRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKY 184
             +                                      +       D          
Sbjct: 118 KVAFLASLEPFLLKTDDNPDGAAPKEFFDGIVAAVKADRYAFYTG-FFNDFYNLDENLGT 176

Query: 185 ASELGTSMCLIMPA----FLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLG 240
                        A    F         + +        +  P L+LHGT D  + I   
Sbjct: 177 RISEEAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPI--- 233

Query: 241 QQACQLLKEMGMDVKFYEYSGAENEGHW--IKEPDGF-DQIAAFLE 283
           +   ++  +     ++ E  GA    H       +     + AFL 
Sbjct: 234 ENTARVFHKALPSAEYVEVEGA---PHGLLWTHAEEVNTALLAFLA 276


>3dl7A [x.x.x] ACETYLCHOLINESTERASE
          Length = 536

 Score = 39.4 bits (90), Expect = 1e-05
 Identities = 18/157 (11%), Positives = 36/157 (22%), Gaps = 5/157 (3%)

Query: 112 VLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTL 171
            L  ++  I   GG   ++   G +   +  +  L      +  R           P+  
Sbjct: 179 ALQWVQENIAAFGGDPMSVTLFGEAGAASVGMHILSLPSRSLFHRA-VLQSGTPNGPWAT 237

Query: 172 HIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTD 231
                 +   +  A  +G      + A L               V    S          
Sbjct: 238 VSAGEARRRATLLARLVGCPNDTELIACLRTRPA-QDLVDHEWHVLPQESIFRFSFVPVV 296

Query: 232 DAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHW 268
           D        +          + V        ++EG +
Sbjct: 297 DGDFLSDTPEALINTGDFQDLQVLVGVV---KDEGSY 330


>1c2bA [c.69.1] ACETYLCHOLINESTERASE
          Length = 539

 Score = 39.1 bits (89), Expect = 2e-05
 Identities = 28/270 (10%), Positives = 52/270 (19%), Gaps = 38/270 (14%)

Query: 20  PQAPHTHTAIFLHGRG-SNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSSGSRWNATF 78
             A  T   I+++G G  +G    +       +  +    +  ++R       +   +  
Sbjct: 103 RPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSRE 162

Query: 79  MEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQG 138
                   D                            ++  I   GG   ++   G S G
Sbjct: 163 APGNVGLLDQRLALQ---------------------WVQENIAAFGGDPMSVTLFGESAG 201

Query: 139 MATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPA 198
            A+    +L  P     R                          + A+ L   +      
Sbjct: 202 AASVGMHILSLP----SRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGG 257

Query: 199 ---------FLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKE 249
                      L T            V    S          D        +        
Sbjct: 258 AGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDF 317

Query: 250 MGMDVKFYEYSGAENEGHWIKEPDGFDQIA 279
             + V          EG +           
Sbjct: 318 QDLQVLVGVVKD---EGSYFLVYGVPGFSK 344


>3bl8D [x.x.x] NEUROLIGIN-2
          Length = 541

 Score = 38.3 bits (87), Expect = 3e-05
 Identities = 18/166 (10%), Positives = 37/166 (22%), Gaps = 32/166 (19%)

Query: 116 IEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQ 175
           +   I   GG  + I   G   G +     +L        +            ++++   
Sbjct: 181 LSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVN--- 237

Query: 176 AIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVV 235
                           +                     E ++   S+  L+      A  
Sbjct: 238 -------------YQPLKYTRLLAAKVGCDREDSTEAVECLRRK-SSRELVDQDVQPARY 283

Query: 236 DISLG------------QQACQLLKEMGMDVKFYEYSGAENEGHWI 269
            I+ G            +   Q  + +  D+      G   EG   
Sbjct: 284 HIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQG---EGLKF 326


>3d3nB [x.x.x] PUTATIVE LIPASE/ESTERASE
          Length = 248

 Score = 38.2 bits (87), Expect = 3e-05
 Identities = 16/156 (10%), Positives = 31/156 (19%), Gaps = 15/156 (9%)

Query: 128 DNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASE 187
             II  G S G          +                                   A  
Sbjct: 102 QRIILAGFSAGGHVVATYNGVATQ----PELRTRYHLDHYQGQHAAIILGYPVIDLTAGF 157

Query: 188 LGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLL 247
             TS                      + +    S P  +     D  V      +  Q L
Sbjct: 158 PTTSAARNQIT-------TDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAL 210

Query: 248 KEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFLE 283
           +   +   ++ +       H++ +         +L+
Sbjct: 211 QH-QVATAYHLFGSG---IHYLNDAIWPQLALRWLQ 242


>3dyvA [x.x.x] ESTERASE D
          Length = 238

 Score = 37.9 bits (86), Expect = 4e-05
 Identities = 33/263 (12%), Positives = 58/263 (22%), Gaps = 46/263 (17%)

Query: 27  TAIFLHGRGSNGPEFTE--DLFSSKTSGGQDLPSLFPSWRWVFPSSGSRWNATFMEHQSA 84
             + LH    +  +                      P +     +       T       
Sbjct: 15  GVVLLHAYTGSPNDMNFMARALQR-----SGYGVYVPLFSG-HGTVEPLDILTKGNPDIW 68

Query: 85  WFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMATALW 144
           W + ++                                +  +   +   GLS G   A+ 
Sbjct: 69  WAESSAAVA----------------------------HMTAKYAKVFVFGLSLGGIFAMK 100

Query: 145 TLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTT 204
            L   PG   G +  F          L              +        I+        
Sbjct: 101 ALETLPGITAGGV--FSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLA 158

Query: 205 GCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAEN 264
               F +       ++  P  +     D +VD  L  Q    L      V F+ Y  A  
Sbjct: 159 AIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALIN-AARVDFHWYDDA-- 215

Query: 265 EGHWI---KEPDGF-DQIAAFLE 283
             H I          + + AF++
Sbjct: 216 -KHVITVNSAHHALEEDVIAFMQ 237


>3ed1B [x.x.x] GIBBERELLIN RECEPTOR GID1
          Length = 316

 Score = 37.3 bits (84), Expect = 6e-05
 Identities = 15/156 (9%), Positives = 28/156 (17%), Gaps = 3/156 (1%)

Query: 128 DNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASE 187
             +   G S G   A    + +        G  +    +        +     +     +
Sbjct: 154 ARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQ 213

Query: 188 LGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLL 247
                                    P   +         L       +           L
Sbjct: 214 DRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADAL 273

Query: 248 KEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFLE 283
           +E G  VK  +    EN                 +E
Sbjct: 274 REDGHHVKVVQC---ENATVGFYLLPNTVHYHEVME 306


>3dkrA [x.x.x] ESTERASE D
          Length = 241

 Score = 36.5 bits (82), Expect = 1e-04
 Identities = 26/155 (16%), Positives = 42/155 (27%), Gaps = 4/155 (2%)

Query: 130 IIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELG 189
           +   GLS G   A+  L   PG      G F          L              +   
Sbjct: 86  VFVFGLSLGGIFAMKALETLPGITA--GGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKS 143

Query: 190 TSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKE 249
                I+            F +       ++  P  +     D +VD  L  Q    L  
Sbjct: 144 DESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALIN 203

Query: 250 MGMDVKFYEYSGAENEGHWIKEPDGF-DQIAAFLE 283
               V F+ Y  A++            + + AF++
Sbjct: 204 -AARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQ 237


>3bl8B [x.x.x] NEUROLIGIN-2
          Length = 546

 Score = 36.4 bits (82), Expect = 1e-04
 Identities = 18/169 (10%), Positives = 38/169 (22%), Gaps = 32/169 (18%)

Query: 112 VLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTL 171
            L  +   I   GG  + I   G   G +     +L        +            +++
Sbjct: 179 ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV 238

Query: 172 HIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTD 231
           +                   +                     E ++   S+  L+     
Sbjct: 239 NYQP----------------LKYTRLLAAKVGCDREDSTEAVECLRRK-SSRELVDQDVQ 281

Query: 232 DAVVDISLG------------QQACQLLKEMGMDVKFYEYSGAENEGHW 268
            A   I+ G            +   Q  + +  D+        + EG  
Sbjct: 282 PARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVN---QGEGLK 327


>3bixA [x.x.x] NEUROLIGIN-1
          Length = 555

 Score = 36.0 bits (81), Expect = 1e-04
 Identities = 23/168 (13%), Positives = 42/168 (25%), Gaps = 25/168 (14%)

Query: 110 QYVLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPF 169
              L      I   GG    I   G   G  + +  L  S    KG     +   G    
Sbjct: 176 IQALRWTSENIGFFGGDPLRITVFGSGAG-GSCVNLLTLSHYSEKGLFQRAIAQSGTALS 234

Query: 170 TLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHG 229
           +  +      Y    A+++G ++   +                 E ++       L+   
Sbjct: 235 SWAVSFQPAKYARILATKVGCNVSDTV--------------ELVECLQKK-PYKELVDQD 279

Query: 230 TDDAVVDISLG---------QQACQLLKEMGMDVKFYEYSGAENEGHW 268
              A   I+ G              L+++             + EG  
Sbjct: 280 VQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLK 327


>3ds8A [x.x.x] LIN2722 PROTEIN
          Length = 245

 Score = 36.0 bits (81), Expect = 1e-04
 Identities = 28/259 (10%), Positives = 50/259 (19%), Gaps = 37/259 (14%)

Query: 29  IFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSSGSRWNATFMEHQSAWFDI 88
           I +HG G N     +    ++                   S G       +   +    I
Sbjct: 6   ILIHGSGGNASSLDKADQLNEYRS-------SNEALTTVNSEGKIKFEGKLTKDAKRPII 58

Query: 89  ASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMATALWTLLC 148
               + N+                L + E      G         G S G     +    
Sbjct: 59  KFGFEQNQATPDDW-------SKWLKIAEDLKSRYGFT---QDGVGHSNGGLALTYYAED 108

Query: 149 SPGPV-KGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCP 207
             G      +   V            D     ++              +P          
Sbjct: 109 YAGDKTVPTLRKLVAIGSPFNDLDPNDNGDLSFK-------------KLPNSTPQDYFIK 155

Query: 208 PFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKE-MGMDVKFYEYSGAENEG 266
                  +++ +     L      D +V                           A    
Sbjct: 156 NQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFPGSAKAYIEDIQVGEDA---V 212

Query: 267 HW--IKEPDGFDQIAAFLE 283
           H    + P   ++   FLE
Sbjct: 213 HQTLHETPKSIEKTYWFLE 231


>2cutA [x.x.x] CUTINASE
          Length = 198

 Score = 35.9 bits (81), Expect = 1e-04
 Identities = 16/156 (10%), Positives = 33/156 (21%), Gaps = 24/156 (15%)

Query: 15  LHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSSGSRW 74
           L      +      I+  G    G   T     +                       +  
Sbjct: 9   LINGNSASCADVIFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVGGAYRATLG 68

Query: 75  NATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGG 134
               +   ++   I  +                       + ++           +I GG
Sbjct: 69  -DNALPRGTSSAAIREMLG---------------------LFQQANTKCPD--ATLIAGG 104

Query: 135 LSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFT 170
            SQG A A  ++      ++ +I   V         
Sbjct: 105 YSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQ 140


>3bjrA [x.x.x] PUTATIVE CARBOXYLESTERASE
          Length = 241

 Score = 35.9 bits (81), Expect = 2e-04
 Identities = 15/165 (9%), Positives = 31/165 (18%), Gaps = 33/165 (20%)

Query: 128 DNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASE 187
             I   G S G              V   +             L       L    +   
Sbjct: 98  QQITPAGFSVGGHIVALYNDYWATRVATELN-VTPALKPNNVVLGYPVISPLLGFTWTPT 156

Query: 188 LGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLL 247
                               P +   ++     + P  +    DD +V  +        L
Sbjct: 157 --------------------PNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATAL 196

Query: 248 KEMGMDVKFYEYSGAENEGHWIKEPDG---------FDQIAAFLE 283
               +  + + +       H +   +                +L 
Sbjct: 197 ATAKIPYELHVFKHG---PHGLALANAQTAWKVAHWLTLALEWLA 238


>2dfpA [c.69.1] PROTEIN (ACETYLCHOLINESTERASE)
          Length = 533

 Score = 35.6 bits (80), Expect = 2e-04
 Identities = 18/216 (8%), Positives = 47/216 (21%), Gaps = 13/216 (6%)

Query: 57  PSLFPSWRWVFPSSGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVI 116
            +L          +      +      A+  +A         ++ +   +      L  +
Sbjct: 124 STLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRM----ALQWV 179

Query: 117 EREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQA 176
              I+  GG    +   G + G +  +  L      +  R           P+       
Sbjct: 180 HDNIQFFGGDPKTVTIFGEAGGASVGMHILSPGSRDLFRRA-ILQSGSPNCPWASVSVAE 238

Query: 177 IQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKA---VLSTPVLLLHGTDDA 233
            +    +    L  ++       L+            +         S          D 
Sbjct: 239 GRRRAVELGRNLNCNLN--SDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDG 296

Query: 234 VVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI 269
               +  +            +        ++EG + 
Sbjct: 297 EFFPTSLESMLNSGNFKKTQILLGVN---KDEGSFF 329


>3b3qA [x.x.x] NLGN1 PROTEIN
          Length = 536

 Score = 35.6 bits (80), Expect = 2e-04
 Identities = 18/167 (10%), Positives = 31/167 (18%), Gaps = 32/167 (19%)

Query: 115 VIEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHID 174
                I   GG    I   G   G +      L        +            + +   
Sbjct: 184 WTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGLFQRAIAQSGTALSSWAVSFQ 243

Query: 175 QAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAV 234
            A              S  + +   L                        L+      A 
Sbjct: 244 PAKYARILATKVGCQVSDTVELVECLQK-----------------KPYKELVDQDVQPAR 286

Query: 235 VDISLG------------QQACQLLKEMGMDVKFYEYSGAENEGHWI 269
             I+ G            Q   +  + +  D+        + EG   
Sbjct: 287 YHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVN---QGEGLKF 330


>3e3aB [x.x.x] POSSIBLE PEROXIDASE BPOC
          Length = 275

 Score = 35.5 bits (81), Expect = 2e-04
 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 10/68 (14%)

Query: 220 LSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHW--IKEPDGF-D 276
           ++ PVL++   DD V    LG++    L     + ++ +   A   GH    + P+    
Sbjct: 213 IAAPVLVIGFADDVVTPPYLGREVADALP----NGRYLQIPDA---GHLGFFERPEAVNT 265

Query: 277 QIAAFLES 284
            +  F  S
Sbjct: 266 AMLKFFAS 273


>3eblE [x.x.x] GIBBERELLIN RECEPTOR GID1
          Length = 315

 Score = 35.3 bits (79), Expect = 2e-04
 Identities = 15/154 (9%), Positives = 28/154 (18%), Gaps = 4/154 (2%)

Query: 130 IIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELG 189
            + G  S G       +  +   VK      +            ++ +         +  
Sbjct: 156 FLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRD 215

Query: 190 TSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKE 249
                 +P                             L       +           L+E
Sbjct: 216 WYWKAYLPEDADRDHPACNPFGPNGRRLG-GLPFAKSLIIVSGLDLTCDRQLAYADALRE 274

Query: 250 MGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFLE 283
            G  VK  +    EN                 +E
Sbjct: 275 DGHHVKVVQC---ENATVGFYLLPNTVHYHEVME 305


>3eblC [x.x.x] GIBBERELLIN RECEPTOR GID1
          Length = 301

 Score = 35.2 bits (79), Expect = 2e-04
 Identities = 17/164 (10%), Positives = 33/164 (20%), Gaps = 10/164 (6%)

Query: 128 DNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASE 187
             +   G S G   A    + +        G  +    +        +     +     +
Sbjct: 140 ARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQ 199

Query: 188 LGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLL 247
                                    P   +         L       +           L
Sbjct: 200 DRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADAL 259

Query: 248 KEMGMDVKFYEYSGAENEGHW------IKEPDGF-DQIAAFLES 284
           +E G  VK  +    EN                  ++I+ FL +
Sbjct: 260 REDGHHVKVVQC---ENATVGFYLLPNTVHYHEVMEEISDFLNA 300


>3bl8A [x.x.x] NEUROLIGIN-2
          Length = 556

 Score = 34.9 bits (78), Expect = 3e-04
 Identities = 23/229 (10%), Positives = 48/229 (20%), Gaps = 40/229 (17%)

Query: 12  FPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSSG 71
             D  + +  +      +FLHG              S  +   ++  +  ++R       
Sbjct: 111 TEDGPLTKKDSGKKPVMLFLHGGSYMEGTG-NMFDGSVLAAYGNVIVVTLNYRLGVLGFL 169

Query: 72  SRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNII 131
           S  +     +      I +L                        +   I   GG  + I 
Sbjct: 170 STGDQAAKGNYGLLDQIQALR----------------------WLSENIAHFGGDPERIT 207

Query: 132 FGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTS 191
             G   G +     +L        +            ++++                   
Sbjct: 208 IFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKVGCDRE 267

Query: 192 MCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLG 240
                   L                    S+  L+      A   I+ G
Sbjct: 268 DSTEAVECLRR-----------------KSSRELVDQDVQPARYHIAFG 299


>2bceA [x.x.x] CHOLESTEROL ESTERASE
          Length = 532

 Score = 34.5 bits (77), Expect = 4e-04
 Identities = 24/162 (14%), Positives = 35/162 (21%), Gaps = 2/162 (1%)

Query: 116 IEREIELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQ 175
           ++R IE  GG  D I   G S G A+     L        +        G  P+ +  D 
Sbjct: 167 VKRNIEAFGGDPDQITLFGESAGGASVSLQTLSPYNKGLIKRAISQSGVGLCPWAIQQDP 226

Query: 176 AIQLYRSKYASELGTSMCLIMPAFLLGTTG--CPPFDSKPEEVKAVLSTPVLLLHGTDDA 233
                R              M   L  T           P           L      D 
Sbjct: 227 LFWAKRIAEKVGCPVDDTSKMAGCLKITDPRALTLAYKLPLGSTEYPKLHYLSFVPVIDG 286

Query: 234 VVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGF 275
                          ++       +  G    G  +   +  
Sbjct: 287 DFIPDDPVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSN 328


>1be0A [c.69.1 (1cijA)] HALOALKANE DEHALOGENASE
          Length = 310

 Score = 34.5 bits (77), Expect = 4e-04
 Identities = 8/66 (12%), Positives = 21/66 (31%), Gaps = 9/66 (13%)

Query: 223 PVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI--KEPDGF-DQIA 279
              +  G  D ++          +   +    +  E + A   GH++         + + 
Sbjct: 251 QTFMAIGMKDKLLGP---DVMYPMKALINGCPEPLEIADA---GHFVQEFGEQVAREALK 304

Query: 280 AFLESK 285
            F E++
Sbjct: 305 HFAETE 310


>1b6gA [x.x.x] HALOALKANE DEHALOGENASE
          Length = 308

 Score = 34.1 bits (76), Expect = 5e-04
 Identities = 8/68 (11%), Positives = 22/68 (32%), Gaps = 9/68 (13%)

Query: 221 STPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI--KEPDGF-DQ 277
           +    +  G  D ++          +   +    +  E + A   GH++         + 
Sbjct: 247 NGQTFMAIGMKDKLLGP---DVMYPMKALINGCPEPLEIADA---GHFVQEFGEQVAREA 300

Query: 278 IAAFLESK 285
           +  F E++
Sbjct: 301 LKHFAETE 308


>1broA [c.69.1] BROMOPEROXIDASE A2
          Length = 277

 Score = 33.7 bits (75), Expect = 7e-04
 Identities = 15/67 (22%), Positives = 27/67 (40%), Gaps = 9/67 (13%)

Query: 220 LSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWI--KEPDGF-D 276
           +  P L+LHGT D  + I   +   ++  +     ++ E  GA    H +     +    
Sbjct: 216 IDVPALILHGTGDRTLPI---ENTARVFHKALPSAEYVEVEGA---PHGLLWTHAEEVNT 269

Query: 277 QIAAFLE 283
            + AFL 
Sbjct: 270 ALLAFLA 276


>1cuxA [x.x.x] CUTINASE
          Length = 197

 Score = 33.6 bits (75), Expect = 7e-04
 Identities = 24/160 (15%), Positives = 40/160 (25%), Gaps = 24/160 (15%)

Query: 11  TFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS 70
           T  DL      +      I+  G    G     +L +   S   +L S F          
Sbjct: 3   TRDDLINGNSASCADVIFIYARGSTETG-----NLGTLGPSIASNLESAFGKDGVWIQGV 57

Query: 71  GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNI 130
           G  + AT  ++       ++                            +           
Sbjct: 58  GGAYRATLGDNALPRGTSSAAIREMLGLF-------------------QQANTKCPDATY 98

Query: 131 IFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFT 170
           I GG SQG A A  ++      ++ +I   V         
Sbjct: 99  IAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQ 138


>3b5eB [x.x.x] MLL8374 PROTEIN
          Length = 211

 Score = 33.4 bits (75), Expect = 8e-04
 Identities = 31/280 (11%), Positives = 51/280 (18%), Gaps = 81/280 (28%)

Query: 8   ENRTFPD-----LHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPS 62
           EN            ++            LHG G +                + +      
Sbjct: 5   ENSPLLTDLAFPYRLLGAGKESRECLFLLHGSGVDETTLVPLA--------RRIAPTATL 56

Query: 63  WRWVFPSSGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIEL 122
                          F       F+  S+             L E++ +         + 
Sbjct: 57  VAARGRIPQEDGFRWFERIDPTRFEQKSI-------------LAETAAFA-AFTNEAAKR 102

Query: 123 LGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRS 182
            G   D+  F G S G       LL         +                         
Sbjct: 103 HGLNLDHATFLGYSNGANLVSSLLLHPGIVRLAAL------------------------- 137

Query: 183 KYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQ 242
                            L          +             L++ G  D      +   
Sbjct: 138 -----------------LRPPVLDHVPATDLAG------IRTLIIAGAADETYGPFVPAL 174

Query: 243 ACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFL 282
              LL   G +V           GH I        +  +L
Sbjct: 175 V-TLLSRHGAEVDARIIPS----GHDI-GDPDAAIVRQWL 208


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.131    0.353 

Gapped
Lambda     K      H
   0.267   0.0414    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 47,324,190
Number of extensions: 2944190
Number of successful extensions: 30441
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 11888
Number of HSP's successfully gapped: 387
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)