RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= CIRT_10408 cimm2 CIRG_10403 Broad_Institute ""
         (221 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3e5uC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       137   3e-35
3e6cC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       135   1e-34
2bgcA [x.x.x] PRFA                                                    133   4e-34
3e5uD [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       132   8e-34
3e6bB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       132   8e-34
3e5xB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       130   5e-33
3d0sB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN                      129   7e-33
3e5uB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       129   9e-33
3e5xD [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       128   2e-32
1db9A [b.82.3 - a.4.5 (1o3sA)] CATABOLITE GENE ACTIVATOR PROTEIN      127   3e-32
3e5qA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       127   4e-32
3dkwA [x.x.x] DNR PROTEIN                                             125   1e-31
3e5xA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       125   2e-31
3e5qB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       124   2e-31
2beoB [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN                        124   3e-31
3e6dB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       121   2e-30
3e97A [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY               121   2e-30
2beoA [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN                        119   8e-30
3dv8A [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY               119   8e-30
2byvE [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 4                119   1e-29
3e5uA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       118   2e-29
3e6bA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       116   6e-29
3e6dA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       116   6e-29
3e5qC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       115   1e-28
2bgcH [x.x.x] PRFA                                                    115   2e-28
3e5qF [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                       114   2e-28
2bgcF [x.x.x] PRFA                                                    114   2e-28
3d0sA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN                      113   7e-28
2bgcB [x.x.x] PRFA                                                    111   1e-27
2bgcD [x.x.x] PRFA                                                    109   6e-27
3cf6E [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR (GEF) 4          108   2e-26
1cx4A [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE REGULATORY...    88   3e-20
3dn7B [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN             85   2e-19
3cl1A [x.x.x] MLL3241 PROTEIN                                          82   1e-18
3co2A [x.x.x] MLOTIK1 ION CHANNEL PROTEIN                              82   2e-18
2d93A [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 6                 81   3e-18
3dn7A [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN             79   9e-18
3bpzA [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED             79   9e-18
3co2D [x.x.x] MLOTIK1 ION CHANNEL PROTEIN                              79   1e-17
3co2B [x.x.x] MLOTIK1 ION CHANNEL PROTEIN                              75   2e-16
3cl1B [x.x.x] MLL3241 PROTEIN                                          75   2e-16
3clpC [x.x.x] MLL3241 PROTEIN                                          75   2e-16
3clpA [x.x.x] MLL3241 PROTEIN                                          74   4e-16
3co2C [x.x.x] MLOTIK1 ION CHANNEL PROTEIN                              74   4e-16
3bpzC [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED             74   5e-16
3bwwA [x.x.x] PROTEIN OF UNKNOWN FUNCTION DUF692/COG3220               72   2e-15
1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]                   37   7e-05
3bwgA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 36   8e-05
3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 36   1e-04
3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 36   1e-04
2dk8A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA                   34   4e-04
3edpB [x.x.x] LIN2111 PROTEIN                                          34   4e-04
2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY               34   5e-04
1e2xA [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN         34   5e-04
2b7oA [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE              33   6e-04
2acjA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE         33   7e-04
2b7oB [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE              33   8e-04

>3e5uC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 219

 Score =  137 bits (346), Expect = 3e-35
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLASLKRENILDKKKNKIIVYNLGELKHLS 218


>3e6cC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 225

 Score =  135 bits (341), Expect = 1e-34
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLASLKRENILDKKKNKIIVYNLGELKHLS 218


>2bgcA [x.x.x] PRFA
          Length = 234

 Score =  133 bits (336), Expect = 4e-34
 Identities = 28/217 (12%), Positives = 66/217 (30%), Gaps = 4/217 (1%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +  ++         +   +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 1   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 60

Query: 69  MGPGQMFGELSLF--DPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 61  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 120

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDG-VHVHHDLTQEELAQLVGASR 185
                     D   +   G +   LL L   +G+   DG      +LT +EL    G + 
Sbjct: 121 QVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAH 180

Query: 186 ET-VNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
            + V++ ++       +  +     + +++ + R A 
Sbjct: 181 SSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 217


>3e5uD [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 220

 Score =  132 bits (333), Expect = 8e-34
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLASLKRENILDKKKNKIIVYNLGELKHLS 218


>3e6bB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 208

 Score =  132 bits (333), Expect = 8e-34
 Identities = 33/210 (15%), Positives = 72/210 (34%), Gaps = 3/210 (1%)

Query: 11  LDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG 70
              E +             +G  +   G+    +  +++GK+KL     DG E LL   G
Sbjct: 2   FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG 61

Query: 71  PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXX 130
              + G+L        +   TA+  +     S + L         +              
Sbjct: 62  GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAY 118

Query: 131 XNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNK 190
               VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G    TV++
Sbjct: 119 YARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSR 178

Query: 191 ALADFASRGWLRLEPRSVVIMDIERMARRA 220
            LA       L  +   +++ ++  +   +
Sbjct: 179 VLASLKRENILDKKKNKIIVYNLGELKHLS 208


>3e5xB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 219

 Score =  130 bits (326), Expect = 5e-33
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS 218


>3d0sB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 218

 Score =  129 bits (325), Expect = 7e-33
 Identities = 106/207 (51%), Positives = 138/207 (66%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
            +F  ++  ++ AL   +      RG  +F EG+ GD+LY++I GKVK+GR + DGRENL
Sbjct: 12  GIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENL 71

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L IMGP  MFGELS+FDPGPR+++ T +T+    S+  + L  W+  RP +         
Sbjct: 72  LTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLA 131

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                 N+ +ADL+F+DVPGRVAK LL LA RFG      + V HDLTQEE+AQLVGASR
Sbjct: 132 RRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASR 191

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMD 212
           ETVNKALADFA RGW+RLE +SV+I D
Sbjct: 192 ETVNKALADFAHRGWIRLEGKSVLISD 218


>3e5uB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 218

 Score =  129 bits (324), Expect = 9e-33
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLASLKRENILDKKKNKIIVYNLGELKHLS 218


>3e5xD [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 220

 Score =  128 bits (322), Expect = 2e-32
 Identities = 33/215 (15%), Positives = 73/215 (33%), Gaps = 3/215 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPTG---NNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L  +   +++ ++  +   +
Sbjct: 184 VTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS 218


>1db9A [b.82.3 - a.4.5 (1o3sA)] CATABOLITE GENE ACTIVATOR PROTEIN
          Length = 200

 Score =  127 bits (320), Expect = 3e-32
 Identities = 51/199 (25%), Positives = 94/199 (47%), Gaps = 2/199 (1%)

Query: 13  DESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMGPG 72
           D ++    +     K      L H+G+  + LY ++ G V +     +G+E +L+ +  G
Sbjct: 1   DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQG 60

Query: 73  QMFGELSLFDPGP-RSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXX 131
              GEL LF+ G  RSA V A T    A +S++   + ++  P +               
Sbjct: 61  DFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVT 120

Query: 132 NDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKA 191
           ++ V +L F DV GR+A+ LL+LA +          +   +T++E+ Q+VG SR+TV + 
Sbjct: 121 SEKVGNLAFLDVTGRIAQTLLNLAKQPDA-MTHPDGMQIKITRQEIGQIVGCSRDTVGRI 179

Query: 192 LADFASRGWLRLEPRSVVI 210
           L     +  +    +++V+
Sbjct: 180 LKMLEDQNLISAHGKTIVV 198


>3e5qA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 202

 Score =  127 bits (319), Expect = 4e-32
 Identities = 28/212 (13%), Positives = 65/212 (30%), Gaps = 10/212 (4%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +    E +             +G  +   G+    +  +++GK+KL     DG E LL  
Sbjct: 1   NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYY 60

Query: 69  MGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXX 128
            G   + G+L        +   TA+  +     S + L         +            
Sbjct: 61  AGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKV 117

Query: 129 XXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETV 188
                 V  +    +   +  +                 +   L+Q+ + ++ G    TV
Sbjct: 118 AYYARQVPTIRILRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTV 170

Query: 189 NKALADFASRGWLRLEPRSVVIMDIERMARRA 220
           ++ LA       L  +   +++ ++  +   +
Sbjct: 171 SRVLACLKRENILDKKKNKIIVYNLGELKHLS 202


>3dkwA [x.x.x] DNR PROTEIN
          Length = 227

 Score =  125 bits (314), Expect = 1e-31
 Identities = 49/214 (22%), Positives = 83/214 (38%), Gaps = 4/214 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
            LF  L    +  L AS     L +G  +F +G+     Y +I G VK+ R + +G+E +
Sbjct: 15  HLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKI 74

Query: 66  LAIMGPGQMFGELS-LFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXX 124
           L +      F E     D     AT  AV  S     S++  L+ L+    +        
Sbjct: 75  LEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKL 134

Query: 125 XXXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGAS 184
                   D +  L   +   RV + LL LA        +   V   + ++ +A  +   
Sbjct: 135 STRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAP---GENCRVEIPVAKQLVAGHLSIQ 191

Query: 185 RETVNKALADFASRGWLRLEPRSVVIMDIERMAR 218
            ET ++ +      G + L+ R + I+D ER+  
Sbjct: 192 PETFSRIMHRLGDEGIIHLDGREISILDRERLEC 225


>3e5xA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 214

 Score =  125 bits (313), Expect = 2e-31
 Identities = 33/210 (15%), Positives = 71/210 (33%), Gaps = 3/210 (1%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIER 215
            TV++ LA       L  +   +++ ++  
Sbjct: 184 VTVSRVLACLKRENILDKKKNKIIVYNLGE 213


>3e5qB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 201

 Score =  124 bits (312), Expect = 2e-31
 Identities = 28/210 (13%), Positives = 63/210 (30%), Gaps = 10/210 (4%)

Query: 11  LDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG 70
              E +             +G  +   G+    +  +++GK+KL     DG E LL   G
Sbjct: 2   FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG 61

Query: 71  PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXX 130
              + G+L        +   TA+  +     S + L         +              
Sbjct: 62  GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAY 118

Query: 131 XNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNK 190
               V  +    +   +  +                     L+Q+ + ++ G    TV++
Sbjct: 119 YARQVPTIRILRLFYELCSSQGKRVGDTYEI-------TMPLSQKSIGEITGVHHVTVSR 171

Query: 191 ALADFASRGWLRLEPRSVVIMDIERMARRA 220
            LA       L  +   +++ ++  +   +
Sbjct: 172 VLACLKRENILDKKKNKIIVYNLGELKHLS 201


>2beoB [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN
          Length = 231

 Score =  124 bits (311), Expect = 3e-31
 Identities = 25/215 (11%), Positives = 57/215 (26%), Gaps = 7/215 (3%)

Query: 11  LDDESMTALHASMA--ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
              E       +      +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 2   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 61

Query: 69  MGPGQMFGELSLFDPGPR--SATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 62  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 121

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRE 186
                     D   +   G +   LL L   +G    +              Q +G S  
Sbjct: 122 QVSYSLAKFNDFSINGKLGSICGQLLILTYVYG---KETPDGIKITLDNLTMQELGYSSS 178

Query: 187 TVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
            V++ ++       +  +     + +++ + R A 
Sbjct: 179 AVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 213


>3e6dB [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 203

 Score =  121 bits (305), Expect = 2e-30
 Identities = 28/210 (13%), Positives = 64/210 (30%), Gaps = 10/210 (4%)

Query: 11  LDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG 70
              E +             +G  +   G+    +  +++GK+KL     DG E LL   G
Sbjct: 2   FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG 61

Query: 71  PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXX 130
              + G+L        +   TA+  +     S + L         +              
Sbjct: 62  GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAY 118

Query: 131 XNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNK 190
               V  +    +   +  +                 +   L+Q+ + ++ G    TV++
Sbjct: 119 YARQVPTIRILRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTVSR 171

Query: 191 ALADFASRGWLRLEPRSVVIMDIERMARRA 220
            LA       L  +   +++ ++  +   +
Sbjct: 172 VLASLKRENILDKKKNKIIVYNLGELKHLS 201


>3e97A [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
          Length = 218

 Score =  121 bits (305), Expect = 2e-30
 Identities = 43/215 (20%), Positives = 84/215 (39%), Gaps = 8/215 (3%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  + ++        + E   +  E++  +   G+ L++V  G V++ R S   RE +
Sbjct: 12  PLFQNVPED-AREALKVVTERNFQPDELVVEQDAEGEALHLVTTGVVRVSRVSL--RERV 68

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L  +    + GE ++     RSA+V A+T      L  E     L   P V         
Sbjct: 69  LGDIYAPGVVGETAVLAHQERSASVRALTPV-RTLLHREHFELILRRHPRVLWNLAELAR 127

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                 +++       +    +     +L  +              L  +++A+   +SR
Sbjct: 128 RVTFLNDEL--IAFGQNTEAALTHVFANLYRQRLAAGVPQ-PEVLPLGTQDIAR-TSSSR 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
           ETV++ L    +   L + PRSV ++D+  +   +
Sbjct: 184 ETVSRVLKRLEAHNILEVSPRSVTLLDLAALEALS 218


>2beoA [x.x.x] LISTERIOLYSIN REGULATORY PROTEIN
          Length = 226

 Score =  119 bits (299), Expect = 8e-30
 Identities = 21/214 (9%), Positives = 53/214 (24%), Gaps = 12/214 (5%)

Query: 11  LDDESMTALHASMA--ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
              E       +      +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 2   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 61

Query: 69  MGPGQMFGELSLF--DPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 62  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 121

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRE 186
                     D   +   G +   LL L   +                +     +     
Sbjct: 122 QVSYSLAKFNDFSINGKLGSICGQLLILTYVY--------GKETPDGIKITLDNLTMQEL 173

Query: 187 TVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            V++ ++       +  +     + +++ + R A
Sbjct: 174 AVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYA 207


>3dv8A [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
          Length = 207

 Score =  119 bits (299), Expect = 8e-30
 Identities = 41/216 (18%), Positives = 79/216 (36%), Gaps = 14/216 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PL++ L+      +  ++    +++G +  H G+    L +V  G+++    S +GRE  
Sbjct: 5   PLWNDLNTAQKKLISDNLITQHVKKGTI-IHNGNDCTGLLLVKSGQLRTYILSDEGREIT 63

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L  +         S         T+ A  D+    +  E      +  PV          
Sbjct: 64  LYRLFDD-CLLSASCIRSIQFEVTIEAEKDTDLWIIPAEIYKGIKDSAPVANYTNELATR 122

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    + + ++  +  RVA  LL+     G            +T E +A  +G+ R
Sbjct: 123 FSDVW----LIEQIWKSLDKRVASFLLEETSIEG-------TNELKITHETIANHLGSHR 171

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
           E +   L  F   G ++L    + I+D +R+    R
Sbjct: 172 EVIT-RLRYFQVEGLVKLSRGKITILDSKRLETLQR 206


>2byvE [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 4
          Length = 922

 Score =  119 bits (297), Expect = 1e-29
 Identities = 32/213 (15%), Positives = 59/213 (27%), Gaps = 7/213 (3%)

Query: 6   PLFSALDDESMTALHASMA-ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGREN 64
              S L       L   +  ES  + G VLF++G+ G   Y+++ G V +        + 
Sbjct: 315 KALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNV----VIYGKG 370

Query: 65  LLAIMGPGQMFGELSLFDPGPRSA-TVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXX 123
           ++  +  G  FG+L+L +  PR+A  V    +  F  +  ED  + L             
Sbjct: 371 VVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEH 430

Query: 124 XXXXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGA 183
                                      L    +               L    +   V  
Sbjct: 431 DQDVLVLEKVPAQQKYTVMSGTPEK-ILEHFLETIRLEPSLNEATDSVLNDFVMMHCVFM 489

Query: 184 SRETVNKALADFASRGWLRLEPRSVVIMDIERM 216
               +  AL         +   +  +   +   
Sbjct: 490 PNTQLCPALVAHYHAQPSQGTEQERMDYALNNK 522



 Score =  110 bits (274), Expect = 5e-27
 Identities = 36/224 (16%), Positives = 59/224 (26%), Gaps = 10/224 (4%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGREN- 64
             F       +  +        L +G  LF +GD G   Y V+ G + +  + +   ++ 
Sbjct: 28  KAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDA 87

Query: 65  -LLAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXX 123
             +  +G G  FGE  L +  PR AT+     S    +  ED     E            
Sbjct: 88  VTICTLGIGTAFGESILDN-TPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAP 146

Query: 124 XXXXXXXXNDVVADLVFSDVPGRVAKALLDLA-------DRFGRTADDGVHVHHDLTQEE 176
                   ++ V           +  A+L  A           +T          +    
Sbjct: 147 PYGVMETGSNNVPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMI 206

Query: 177 LAQLVGASRETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
                  SR             G L    +     D     R  
Sbjct: 207 QQTSCVHSRTQAVGMWQVLLEDGVLNHVDQERHFQDKYLFYRFL 250


>3e5uA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 215

 Score =  118 bits (296), Expect = 2e-29
 Identities = 33/215 (15%), Positives = 72/215 (33%), Gaps = 7/215 (3%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
              +    E +             +G  +   G+    +  +++GK+KL     DG E L
Sbjct: 7   IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKL 66

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L   G   + G+L        +   TA+  +     S + L         +         
Sbjct: 67  LYYAGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYL 123

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                    VA++   +   R+ +   +L    G+   D   +   L+Q+ + ++ G   
Sbjct: 124 TKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHH 183

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRA 220
            TV++ LA       L      +++ ++  +   +
Sbjct: 184 VTVSRVLASLKRENIL----DKIIVYNLGELKHLS 214


>3e6bA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 208

 Score =  116 bits (291), Expect = 6e-29
 Identities = 32/212 (15%), Positives = 70/212 (33%), Gaps = 6/212 (2%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +    E +             +G  +   G+    +  +++GK+KL     DG E LL  
Sbjct: 2   NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYY 61

Query: 69  MGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXX 128
            G   + G+L        +   TA+  +     S + L         +            
Sbjct: 62  AGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKV 118

Query: 129 XXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETV 188
                 VA++  +    R+   L     +      D   +   L+Q+ + ++ G    TV
Sbjct: 119 AYYARQVAEMNPTIRILRLFYELCSSQGKRV---GDTYEITMPLSQKSIGEITGVHHVTV 175

Query: 189 NKALADFASRGWLRLEPRSVVIMDIERMARRA 220
           ++ LA       L  +   +++ ++  +   +
Sbjct: 176 SRVLASLKRENILDKKKNKIIVYNLGELKHLS 207


>3e6dA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 202

 Score =  116 bits (291), Expect = 6e-29
 Identities = 28/212 (13%), Positives = 65/212 (30%), Gaps = 10/212 (4%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +    E +             +G  +   G+    +  +++GK+KL     DG E LL  
Sbjct: 1   NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYY 60

Query: 69  MGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXX 128
            G   + G+L        +   TA+  +     S + L         +            
Sbjct: 61  AGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKV 117

Query: 129 XXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETV 188
                 V  +    +   +  +                 +   L+Q+ + ++ G    TV
Sbjct: 118 AYYARQVPTIRILRLFYELCSSQGKRVGDTY-------EITMPLSQKSIGEITGVHHVTV 170

Query: 189 NKALADFASRGWLRLEPRSVVIMDIERMARRA 220
           ++ LA       L  +   +++ ++  +   +
Sbjct: 171 SRVLASLKRENILDKKKNKIIVYNLGELKHLS 202


>3e5qC [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 203

 Score =  115 bits (288), Expect = 1e-28
 Identities = 32/212 (15%), Positives = 67/212 (31%), Gaps = 9/212 (4%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +    E +             +G  +   G+    +  +++GK+KL     DG E LL  
Sbjct: 1   NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYY 60

Query: 69  MGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXX 128
            G   + G+L        +   TA+  +     S + L         +            
Sbjct: 61  AGGNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKV 117

Query: 129 XXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETV 188
                 VA  +              L    G+   D   +   L+Q+ + ++ G    TV
Sbjct: 118 AYYARQVAPTIRILRLFYE------LCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTV 171

Query: 189 NKALADFASRGWLRLEPRSVVIMDIERMARRA 220
           ++ LA       L  +   +++ ++  +   +
Sbjct: 172 SRVLACLKRENILDKKKNKIIVYNLGELKHLS 203


>2bgcH [x.x.x] PRFA
          Length = 223

 Score =  115 bits (287), Expect = 2e-28
 Identities = 24/215 (11%), Positives = 58/215 (26%), Gaps = 9/215 (4%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +  ++         +   +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 1   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 60

Query: 69  MGPGQMFGELSLFDPGPR--SATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 61  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 120

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRE 186
                     D   +   G +   LL L   +G           D  +  L  L      
Sbjct: 121 QVSYSLAKFNDFSINGKLGSICSQLLILTYVYG-------KETPDGIKITLDNLTMQELS 173

Query: 187 TVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
            V++ ++       +  +     + +++ + R A 
Sbjct: 174 AVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 208


>3e5qF [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 203

 Score =  114 bits (286), Expect = 2e-28
 Identities = 30/210 (14%), Positives = 64/210 (30%), Gaps = 8/210 (3%)

Query: 11  LDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG 70
              E +             +G  +   G+    +  +++GK+KL     DG E LL   G
Sbjct: 2   FPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG 61

Query: 71  PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXX 130
              + G+L        +   TA+  +     S + L         +              
Sbjct: 62  GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAY 118

Query: 131 XNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNK 190
               VA+     +                    D   +   L+Q+ + ++ G    TV++
Sbjct: 119 YARQVAEPTIRILRLFYELCSSQGKRV-----GDTYEITMPLSQKSIGEITGVHHVTVSR 173

Query: 191 ALADFASRGWLRLEPRSVVIMDIERMARRA 220
            LA       L  +   +++ ++  +   +
Sbjct: 174 VLACLKRENILDKKKNKIIVYNLGELKHLS 203


>2bgcF [x.x.x] PRFA
          Length = 235

 Score =  114 bits (286), Expect = 2e-28
 Identities = 29/217 (13%), Positives = 65/217 (29%), Gaps = 6/217 (2%)

Query: 11  LDDESMTALHASMA--ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
              E       +      +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 2   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 61

Query: 69  MGPGQMFGELSLF--DPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 62  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 121

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHV-HHDLTQEELAQLVGAS- 184
                     D   +   G +   LL L   +G+   DG+ +   +LT +EL    G + 
Sbjct: 122 QVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAH 181

Query: 185 RETVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
              V++ ++       +  +     + +++ + R A 
Sbjct: 182 SSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 218


>3d0sA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 224

 Score =  113 bits (282), Expect = 7e-28
 Identities = 113/216 (52%), Positives = 146/216 (67%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
            +F  ++  ++ AL   +      RG  +F EG+ GD+LY++I GKVK+GR + DGRENL
Sbjct: 9   GIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENL 68

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXX 125
           L IMGP  MFGELS+FDPGPR+++ T +T+    S+  + L  W+  RP +         
Sbjct: 69  LTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLA 128

Query: 126 XXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASR 185
                 N+ +ADL+F+DVPGRVAK LL LA RFG      + V HDLTQEE+AQLVGASR
Sbjct: 129 RRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASR 188

Query: 186 ETVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
           ETVNKALADFA RGW+RLE +SV+I D ER+ARRAR
Sbjct: 189 ETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR 224


>2bgcB [x.x.x] PRFA
          Length = 236

 Score =  111 bits (279), Expect = 1e-27
 Identities = 30/219 (13%), Positives = 67/219 (30%), Gaps = 6/219 (2%)

Query: 9   SALDDESMTALHASMA--ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLL 66
           S    E       +      +  + E++F++ D  +    + DG  KL   S +G    L
Sbjct: 1   SNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNL 60

Query: 67  AIMGPGQMFGELSLF--DPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXX 124
                  +     +                 +    +   +L + L              
Sbjct: 61  QYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTL 120

Query: 125 XXXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVH-HDLTQEELAQLVGA 183
                       D   +   G +   LL L   +G+   DG+ +   +LT +EL    G 
Sbjct: 121 QKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGI 180

Query: 184 SRET-VNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
           +  + V++ ++       +  +     + +++ + R A 
Sbjct: 181 AHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 219


>2bgcD [x.x.x] PRFA
          Length = 226

 Score =  109 bits (274), Expect = 6e-27
 Identities = 21/215 (9%), Positives = 57/215 (26%), Gaps = 8/215 (3%)

Query: 9   SALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAI 68
           +  ++         +   +  + E++F++ D  +    + DG  KL   S +G    L  
Sbjct: 1   AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQY 60

Query: 69  MGPGQMFGELSLFDPGPRSAT--VTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                +     +                 +    +   +L + L                
Sbjct: 61  YKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK 120

Query: 127 XXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRE 186
                     D   +   G +   LL L   +G+           +        +     
Sbjct: 121 QVSYSLAKFNDFSINGKLGSICSQLLILTYVYGK------ETPDGIKITLDNLTMQELGS 174

Query: 187 TVNKALADFASRGWLRLEPRSVVIMDIERMARRAR 221
            V++ ++       +  +     + +++ + R A 
Sbjct: 175 AVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAP 209


>3cf6E [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR (GEF) 4
          Length = 627

 Score =  108 bits (269), Expect = 2e-26
 Identities = 33/215 (15%), Positives = 62/215 (28%), Gaps = 10/215 (4%)

Query: 6   PLFSALDDESMTALHASMA-ESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGREN 64
              S L       L   +  ES  + G VLF++G+ G   Y+++ G V          + 
Sbjct: 28  KALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVN----VVIYGKG 83

Query: 65  LLAIMGPGQMFGELSLFDPGPRSA-TVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXX 123
           ++  +  G  FG+L+L +  PR+A  V    +  F  +  ED  + L             
Sbjct: 84  VVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEH 143

Query: 124 XXXXXXXXNDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGA 183
                         ++       +   L  +                 L    +   V  
Sbjct: 144 DQDVLVLEKVQKYTVMSGTPEKILEHFLETIRLEPS----LNEATDSVLNDFVMMHCVFM 199

Query: 184 SRETVNKALADFASRGWLRLEPRSVVIMDIERMAR 218
               +  AL         +   +  +   +    R
Sbjct: 200 PNTQLCPALVAHYHAQPSQGTEQERMDYALNNKRR 234


>1cx4A [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE REGULATORY
           SUBUNIT
          Length = 275

 Score = 87.9 bits (216), Expect = 3e-20
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 1/109 (0%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
            LF  LD E M+ +  +M E  ++ GE +  +GD GD  YV+  G   +     DG    
Sbjct: 22  LLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRC 80

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
           +        FGEL+L    PR+AT+TA +  A   L      + +    
Sbjct: 81  VGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNN 129



 Score = 38.6 bits (88), Expect = 2e-05
 Identities = 17/105 (16%), Positives = 30/105 (28%)

Query: 35  FHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMGPGQMFGELSLFDPGPRSATVTAVT 94
                        I    ++  T        +A    GQ FGEL+L    PR+A+  A+ 
Sbjct: 171 QIIAQGDSADSFFIVESGEVRITMKRNGAVEIARCLRGQYFGELALVTNKPRAASAHAIG 230

Query: 95  DSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXXNDVVADLV 139
                ++  +   + L     +                    D+V
Sbjct: 231 TVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIV 275


>3dn7B [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN
          Length = 145

 Score = 85.2 bits (210), Expect = 2e-19
 Identities = 22/109 (20%), Positives = 37/109 (33%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
             F  L DE    L A     K+R+ E L   G+     Y V+ G ++L      G E  
Sbjct: 12  RKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQT 71

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                      + +     P    + +V +    S+++ +     E  P
Sbjct: 72  TQFAIENWWLSDYAFQKQQPADFYIQSVENCELLSITYTEQENLFERIP 120


>3cl1A [x.x.x] MLL3241 PROTEIN
          Length = 130

 Score = 82.1 bits (202), Expect = 1e-18
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 15  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVE---- 70

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
              +GPG  FGE++L    PRSATV+A T  +  SL   D        P
Sbjct: 71  ---LGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSP 116


>3co2A [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
          Length = 126

 Score = 81.7 bits (201), Expect = 2e-18
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 14  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVEL--- 70

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
               GPG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 71  ----GPGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP 115


>2d93A [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 6
          Length = 134

 Score = 81.3 bits (200), Expect = 3e-18
 Identities = 21/111 (18%), Positives = 40/111 (36%), Gaps = 7/111 (6%)

Query: 6   PLFSALDDESMTALHASMAESK-LRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGREN 64
           P F+ +       L + M      + G ++  +G   D  YV+++G V++        + 
Sbjct: 22  PAFANMTMSVRRELCSVMIFEVVEQAGAIILEDGQELDSWYVILNGTVEI-----SHPDG 76

Query: 65  LLAIMGPGQMFGELSLFDPGPRSAT-VTAVTDSAFASLSHEDLLKWLEGRP 114
            +  +  G  FG     D         T V D  F  ++ +D  + L    
Sbjct: 77  KVENLFMGNSFGITPTLDKQYMHGIVRTKVDDCQFVCIAQQDYWRILNHVE 127


>3dn7A [x.x.x] CYCLIC NUCLEOTIDE BINDING REGULATORY PROTEIN
          Length = 143

 Score = 79.5 bits (195), Expect = 9e-18
 Identities = 22/109 (20%), Positives = 37/109 (33%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
             F  L DE    L A     K+R+ E L   G+     Y V+ G ++L      G E  
Sbjct: 9   RKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQT 68

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                      + +     P    + +V +    S+++ +     E  P
Sbjct: 69  TQFAIENWWLSDYAFQKQQPADFYIQSVENCELLSITYTEQENLFERIP 117


>3bpzA [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
          Length = 194

 Score = 79.5 bits (195), Expect = 9e-18
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 5/109 (4%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF+  D   +TA+   +     + G+ +  EG  G K+Y +  G V +       + N 
Sbjct: 74  PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV-----LTKGNK 128

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
              +  G  FGE+ L   G R+A+V A T     SLS ++  + LE  P
Sbjct: 129 EMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP 177


>3co2D [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
          Length = 129

 Score = 79.3 bits (195), Expect = 1e-17
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 16  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-- 73

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                PG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 74  -----PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP 117


>3co2B [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
          Length = 128

 Score = 74.8 bits (183), Expect = 2e-16
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 16  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-- 73

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                PG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 74  -----PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP 117


>3cl1B [x.x.x] MLL3241 PROTEIN
          Length = 131

 Score = 74.7 bits (183), Expect = 2e-16
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 16  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELG-- 73

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                PG  FGE++L    PRSATV+A T  +  SL   D        P
Sbjct: 74  -----PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSP 117


>3clpC [x.x.x] MLL3241 PROTEIN
          Length = 133

 Score = 74.7 bits (183), Expect = 2e-16
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 17  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPV----- 71

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
              +GPG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 72  --ELGPGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSP 118


>3clpA [x.x.x] MLL3241 PROTEIN
          Length = 132

 Score = 74.0 bits (181), Expect = 4e-16
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 17  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVEL--- 73

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
               GPG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 74  ----GPGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSP 118


>3co2C [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
          Length = 119

 Score = 74.0 bits (181), Expect = 4e-16
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF  L    +  +  ++    +  G V+   G+ GD+++ V++G V +   +       
Sbjct: 16  PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVE---- 71

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
              +GPG  FGE++L    P SATV+A T  +  SL   D        P
Sbjct: 72  ---LGPGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSP 117


>3bpzC [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
          Length = 193

 Score = 73.7 bits (180), Expect = 5e-16
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 6   PLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENL 65
           PLF+  D   +TA+   +     + G+ +  EG  G K+Y +  G V +   + + +   
Sbjct: 74  PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKNKEMKL-- 131

Query: 66  LAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRP 114
                 G  FGE+ L   G R+A+V A T     SLS ++  + LE  P
Sbjct: 132 ----SDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP 176


>3bwwA [x.x.x] PROTEIN OF UNKNOWN FUNCTION DUF692/COG3220
          Length = 246

 Score = 71.7 bits (175), Expect = 2e-15
 Identities = 12/145 (8%), Positives = 27/145 (18%), Gaps = 18/145 (12%)

Query: 7   LFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLL 66
           L   +  E+ +      +E+     E L       +    +    + +            
Sbjct: 118 LEIQISVENTSYY--LHSETSTNEVEFLNAIVQEANCGIHLDVNNIYV------------ 163

Query: 67  AIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXX 126
                  +       D                  L      +      ++          
Sbjct: 164 -NAVNHGLLDPHVFIDNVDLKRVNYIHIAGTVWDLLEYTYARLSHPPTLL---ERFPPFE 219

Query: 127 XXXXXNDVVADLVFSDVPGRVAKAL 151
                 D++  L    V  R    L
Sbjct: 220 KLCKEVDIIHQLQQKYVKKRGLSWL 244


>1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
          Length = 294

 Score = 36.6 bits (84), Expect = 7e-05
 Identities = 8/35 (22%), Positives = 14/35 (40%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPR 206
            + E+L + +G SR  +NK +      G       
Sbjct: 19  HSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVP 53


>3bwgA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 221

 Score = 36.4 bits (83), Expect = 8e-05
 Identities = 8/36 (22%), Positives = 13/36 (36%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
           L   E       S+ T+ K+L     +G +     S
Sbjct: 22  LPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS 57


>3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 222

 Score = 36.1 bits (82), Expect = 1e-04
 Identities = 8/36 (22%), Positives = 13/36 (36%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
           L   E       S+ T+ K+L     +G +     S
Sbjct: 24  LPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS 59


>3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 225

 Score = 35.7 bits (81), Expect = 1e-04
 Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 1/55 (1%)

Query: 154 LADRFGRTADDGVHVHHD-LTQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
           +A       ++      D L   E       S+ T+ K+L     +G +     S
Sbjct: 6   IATEIETYIEEHQLQQGDKLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGS 60


>2dk8A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
          Length = 81

 Score = 34.1 bits (78), Expect = 4e-04
 Identities = 7/39 (17%), Positives = 15/39 (38%), Gaps = 1/39 (2%)

Query: 170 HDLTQEELA-QLVGASRETVNKALADFASRGWLRLEPRS 207
           H +T + +  ++     +    A+    S G L L   +
Sbjct: 28  HGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSN 66


>3edpB [x.x.x] LIN2111 PROTEIN
          Length = 214

 Score = 34.1 bits (77), Expect = 4e-04
 Identities = 6/35 (17%), Positives = 15/35 (42%)

Query: 173 TQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
            +  L ++  +SR T+ +A+      G +  +   
Sbjct: 25  NETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGV 59


>2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
          Length = 231

 Score = 33.8 bits (76), Expect = 5e-04
 Identities = 8/39 (20%), Positives = 18/39 (46%)

Query: 173 TQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVIM 211
           ++  L++ +G SR ++ +AL    + G +     S    
Sbjct: 29  SERALSETLGVSRSSLREALRVLEALGTISTATGSGPRS 67


>1e2xA [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
          Length = 222

 Score = 33.7 bits (76), Expect = 5e-04
 Identities = 11/35 (31%), Positives = 20/35 (57%)

Query: 173 TQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
            + EL++L+G +R T+ + L   A  GWL ++   
Sbjct: 28  AERELSELIGVTRTTLREVLQRLARDGWLTIQHGK 62


>2b7oA [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
          Length = 438

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 5/38 (13%), Positives = 10/38 (26%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVV 209
           L   + A+    +   +   +        L      VV
Sbjct: 82  LQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPVV 119


>2acjA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 53

 Score = 33.2 bits (76), Expect = 7e-04
 Identities = 9/36 (25%), Positives = 19/36 (52%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
            T  +L+  +G  ++ +N+ L   A +G L+ E  +
Sbjct: 10  TTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT 45


>2b7oB [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
          Length = 438

 Score = 33.0 bits (74), Expect = 8e-04
 Identities = 3/36 (8%), Positives = 8/36 (22%)

Query: 172 LTQEELAQLVGASRETVNKALADFASRGWLRLEPRS 207
           L   + A+    +   +   +        L      
Sbjct: 82  LQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASP 117


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0645    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 27,713,854
Number of extensions: 1745204
Number of successful extensions: 19489
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8984
Number of HSP's successfully gapped: 510
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)