RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= CIRT_01210 cimm2 CIRG_01208 Broad_Institute ""
         (551 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00581 Rhodanese "Rhodanese-like domain"                              35   9e-05

>PF00581 Rhodanese "Rhodanese-like domain"
          Length = 108

 Score = 34.7 bits (79), Expect = 9e-05
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 25/107 (23%)

Query: 368 IMIIDCRFEYEYEGGHINGAVN-----------YTDKEHLAAELFDQ--EPKPSTALIFH 414
           ++++D R   EY  GHI GAVN              K+ LAA L     E      ++ +
Sbjct: 13  VVLLDVRSPEEYAEGHIPGAVNIPLPSLPLNGLLLSKDELAAALAAAGIELDKDKPIVVY 72

Query: 415 CEYSAHRAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFA 461
           C          A +++            +L +P +Y+L+GG+ ++ A
Sbjct: 73  CRSGIRSGAAAAAWLK------------ELGFPNVYVLDGGWKAWAA 107


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.318    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0629    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,181,676
Number of extensions: 898021
Number of successful extensions: 121402
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2185
Number of HSP's successfully gapped: 271
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)