RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= CIRT_02911 cimm2 CIRG_02908 Broad_Institute ""
         (537 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF10382 DUF2439 "Protein of unknown function (DUF2439)"                58   8e-12

>PF10382 DUF2439 "Protein of unknown function (DUF2439)"
          Length = 79

 Score = 58.2 bits (140), Expect = 8e-12
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 27 FSCLFTYDIKRKAKRWQDGFLRFHTFNRRVMVYGTSGDFVGDLHMRESSTVRDGDQ 82
          F+ L+T    +K K W DG+L+ HTFN RVM+Y   G  +G   +  S  V+DGD+
Sbjct: 3  FTVLYTKQKTKKHKTWHDGYLKLHTFNNRVMLYDEDGKLLGSTFLNNSEDVQDGDE 58


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.324    0.135    0.424 

Gapped
Lambda     K      H
   0.267   0.0529    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 20,836,205
Number of extensions: 1217896
Number of successful extensions: 148081
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3054
Number of HSP's successfully gapped: 217
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)