RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= CIRT_00337 cimm2 CIRG_00337 Broad_Institute ""
         (462 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2i7nA2 [c.55.1.14] PANTOTHENATE KINASE 1 A:382 -- 593                 134   2e-34
2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267                     101   2e-24
2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119      35   2e-04

>2i7nA2 [c.55.1.14] PANTOTHENATE KINASE 1 A:382 -- 593
          Length = 212

 Score =  134 bits (339), Expect = 2e-34
 Identities = 84/229 (36%), Positives = 120/229 (52%), Gaps = 25/229 (10%)

Query: 196 PNEVFTYSETSPMEFA---EARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXX 252
           P   +  + T+P           + YP LLVN+GSGVS++ V +   ++RV         
Sbjct: 2   PECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGT 61

Query: 253 XXXXMSLLTGARTFDEMLAMAELGDNSGVDMLVGDIYGTDYTKIGLKSSTIASTFGKVFK 312
                 LLTG  TF+E L MA  GD++ VD LV DIYG DY + GL+ S +AS+FG +  
Sbjct: 62  FLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMS 121

Query: 313 MQRLAERSAQGXXXXXXXXXXXXRDVSQFRREDISRSLLFAISNNIGQIAYLQSEKHQIK 372
            ++                           +ED++R+ L  I+NNIG IA + +    I 
Sbjct: 122 KEKRDS----------------------ISKEDLARATLVTITNNIGSIARMCALNENID 159

Query: 373 HIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFL 421
            + F G+F+R +  +M  L+YA+ FWSKG+ +A FL HEGY GAVGA L
Sbjct: 160 RVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALL 208


>2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267
          Length = 260

 Score =  101 bits (251), Expect = 2e-24
 Identities = 50/334 (14%), Positives = 101/334 (30%), Gaps = 78/334 (23%)

Query: 88  HVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENHRKLNGSA 147
            V +D GG+L K+V             +  F    T+ ID  +++L              
Sbjct: 2   KVGIDAGGTLIKIVQE--------QDNQRTFKTELTKNIDQVVEWLN------------- 40

Query: 148 PGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSP 207
                I             + E + +      E +    GL   + E             
Sbjct: 41  --QQQIEKLCLTGGNAGV-IAENINIPAQIFVEFDAASQGLGILLKEQG----------- 86

Query: 208 MEFAEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXXXXXXMSLLTGARTFD 267
                   D+  Y+  N+G+G S+       +  RV               LL+    + 
Sbjct: 87  -------HDLADYIFANVGTGTSLHYFDGQSQR-RVGGIGTGGGMIQGLGYLLSQITDYK 138

Query: 268 EMLAMAELGDNSGVDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGXXXX 327
           ++  MA+ GD + +D+ V  I   D           A+ FG V                 
Sbjct: 139 QLTDMAQHGDRNTIDLKVRHIIPGDL---------TAANFGHVLHHLD------------ 177

Query: 328 XXXXXXXXRDVSQFRREDISRSLLFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQT 387
                      + F   +   +++  +   +  +A   + + + ++I + GS    +   
Sbjct: 178 -----------ADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALL 226

Query: 388 MNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAFL 421
              +     +      + Y++ +  + GA+GA  
Sbjct: 227 RKVVE---DYTVLRGCKPYYVENGAFSGAIGALY 257


>2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
          Length = 119

 Score = 34.7 bits (79), Expect = 2e-04
 Identities = 14/104 (13%), Positives = 32/104 (30%), Gaps = 22/104 (21%)

Query: 89  VAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFET-------ERIDLCIDFLKQLKENHR 141
           +A+DIGG+               DG   +     T          D     +  L+ + +
Sbjct: 4   LAIDIGGTKLAAALIGA------DGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQ 57

Query: 142 KLNGSAPGPLCIMAT---------GGGAYKYYDRLKEELGVDII 176
           ++  ++ G +   +          G   +     L++   +  I
Sbjct: 58  RVAIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTI 101


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.315    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0531    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 19,591,419
Number of extensions: 1410621
Number of successful extensions: 4912
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 4785
Number of HSP's successfully gapped: 135
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)