RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= CIRT_00379 cimm2 CIRG_00379 Broad_Institute ""
         (390 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1okcA [f.42.1.1] ADP, ATP CARRIER PROTEIN HEART ISOFORM T1            196   4e-53
2axoA1 [c.47.1.19] HYPOTHETICAL PROTEIN ATU2684 A:38 -- 262           123   3e-31
3ecfA1 [d.17.4.21] NTF2-LIKE PROTEIN A:2 -- 129                        81   3e-18

>1okcA [f.42.1.1] ADP, ATP CARRIER PROTEIN HEART ISOFORM T1
          Length = 292

 Score =  196 bits (499), Expect = 4e-53
 Identities = 64/335 (19%), Positives = 115/335 (34%), Gaps = 47/335 (14%)

Query: 50  AVKPWAHFFAGAVGGMTAATLTSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLS 109
           A+     F AG V    + T  +P++ +K  LQ      Q                    
Sbjct: 3   ALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQ-------------------- 42

Query: 110 RSAMVHFSETVQILRSIHVHEGWRALFKGLGPNLTGVVPARAINFYVYGNGKRILNDYFG 169
            SA   +   +  +  I   +G+ + ++G   N+    P +A+NF      K+I      
Sbjct: 43  ISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVD 102

Query: 170 YIPTET-PASIHLXXXXXXXXXXXXXXNPIWLVKTRLQLDKSNASNIPGRGRQYKNSLDC 228
                    + +L               P+   +TRL  D           R++    +C
Sbjct: 103 RHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD----VGKGAAQREFTGLGNC 158

Query: 229 IRQTVRHEGIRGLYRGLTASYLG-VTESSLQWVMYEEMKRILXXXXXXXXXDPAHVRGWT 287
           I +  + +G+RGLY+G   S  G +   +  + +Y+  K +L                  
Sbjct: 159 ITKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGML----------------PD 202

Query: 288 DTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRV 347
               H + +              +YP + VR R+                YTG + C+R 
Sbjct: 203 PKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADI----MYTGTVDCWRK 258

Query: 348 IWKEEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMI 382
           I K+EG    + G   ++LR +   A +  +Y+ I
Sbjct: 259 IAKDEGPKAFFKGAWSNVLRGMGG-AFVLVLYDEI 292



 Score =  117 bits (295), Expect = 2e-29
 Identities = 42/191 (21%), Positives = 75/191 (39%), Gaps = 17/191 (8%)

Query: 196 NPIWLVKTRLQLDKSNASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVT-E 254
            PI  VK  LQ+  ++        +QYK  +DC+ +  + +G    +RG  A+ +     
Sbjct: 25  APIERVKLLLQVQHASKQ--ISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT 82

Query: 255 SSLQWVMYEEMKRILXXXXXXXXXDPAHVRGWTDTAEHWVGTITXXXXXXXXXXXXTYPH 314
            +L +   ++ K+I              V        ++ G +              YP 
Sbjct: 83  QALNFAFKDKYKQIFLG----------GVDRHKQFWRYFAGNLASGGAAGATSLCFVYPL 132

Query: 315 EVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWKEEGMAGLYGGLTPHLLRVVPSAAI 374
           +  RTRL  A        +   ++TGL  C   I+K +G+ GLY G    +  ++   A 
Sbjct: 133 DFARTRL-AADVGKGAAQR---EFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIIIYRAA 188

Query: 375 MFGMYEMILRL 385
            FG+Y+    +
Sbjct: 189 YFGVYDTAKGM 199


>2axoA1 [c.47.1.19] HYPOTHETICAL PROTEIN ATU2684 A:38 -- 262
          Length = 218

 Score =  123 bits (311), Expect = 3e-31
 Identities = 13/221 (5%), Positives = 38/221 (17%), Gaps = 36/221 (16%)

Query: 49  PAVKPWAHFFAGAVGGMTAATLTSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSL 108
            +  P        +       L+  +D       +D                        
Sbjct: 18  ASCPPADEALRKXIQKGDVVGLSYHVDYWNYLGWTDSL---------------------- 55

Query: 109 SRSAMVHFSETVQILRSIHVHEGWRALFKGLGPNLTGVVPARAINFYVYGNGKRILNDYF 168
                    E  +         G   ++              A    +Y        +  
Sbjct: 56  ------ASKENTERQYGYXRALGRNGVYTPQAILNGRDHVKGADVRGIYDRLDAFKREGQ 109

Query: 169 GYIPTETPASIHLXXXXXXXXXXXXXXNPIWLVKTRLQLDKSNASNIPGRGRQYKNSLDC 228
                                          +V      +++       +   Y +S+  
Sbjct: 110 ----GLNVPVSSKFAGDEVEIDIGAGNGKADVVVAYFTREQTV----DVKKXSYWHSVYD 161

Query: 229 IRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRIL 269
           ++     +G     +   +    V +     ++        
Sbjct: 162 VQTVGXWDGSPXTVKLPASVVAKVKKGGCAVLLQTANASGD 202



 Score =  105 bits (262), Expect = 1e-25
 Identities = 16/244 (6%), Positives = 39/244 (15%), Gaps = 42/244 (17%)

Query: 147 VPARAINFYVYGNGKRILNDYFGYIPTETPASIHLXXXXXXXXXXXXXXNPIWLVKTRLQ 206
                +  +                    P +                   +        
Sbjct: 4   AVKGVVELFTSQGCASC------------PPADEALRKXIQKGDVVGLSYHVDYWNYLGW 51

Query: 207 LDKSNASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLG-VTESSLQWVMYEEM 265
            D              K + +      R  G  G+Y            + +    +Y+ +
Sbjct: 52  TD----------SLASKENTERQYGYXRALGRNGVYTPQAILNGRDHVKGADVRGIYDRL 101

Query: 266 KRILXXXXXXXXXDPAHVRGWTDTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAP 325
                          +   G     +   G                   +VV        
Sbjct: 102 DAFKREGQGLNVPVSSKFAGDEVEIDIGAGN---------------GKADVVVAYFT--- 143

Query: 326 TIPAGGGKVQMKYTGLMQCFRVIWKEEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRL 385
                    +  Y   +   + +   +G           + +V      +          
Sbjct: 144 -REQTVDVKKXSYWHSVYDVQTVGXWDGSPXTVKLPASVVAKVKKGGCAVLLQTANASGD 202

Query: 386 CGTT 389
               
Sbjct: 203 PAAI 206



 Score = 59.2 bits (143), Expect = 8e-12
 Identities = 12/117 (10%), Positives = 24/117 (20%), Gaps = 22/117 (18%)

Query: 53  PWAHFFAGAVGGMTAATLTSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSA 112
           P +  FAG    +         DV+      +                            
Sbjct: 114 PVSSKFAGDEVEIDIGAGNGKADVVVAYFTREQT----------------------VDVK 151

Query: 113 MVHFSETVQILRSIHVHEGWRALFKGLGPNLTGVVPARAINFYVYGNGKRILNDYFG 169
              +  +V  ++++   +G     K     +  V            N         G
Sbjct: 152 KXSYWHSVYDVQTVGXWDGSPXTVKLPASVVAKVKKGGCAVLLQTANASGDPAAIVG 208


>3ecfA1 [d.17.4.21] NTF2-LIKE PROTEIN A:2 -- 129
          Length = 128

 Score = 80.7 bits (199), Expect = 3e-18
 Identities = 15/157 (9%), Positives = 37/157 (23%), Gaps = 36/157 (22%)

Query: 227 DCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILXXXXXXXXXDPAH-VRG 285
           +   + ++ +       G  +         +Q+    E    +         +    ++G
Sbjct: 3   EKYHEILK-KYFLSFETGDFSQ--------VQFSCNLEFLSPISGNTLKGTEEVIPFLKG 53

Query: 286 WTDTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCF 345
            T                       +   E  R                     G +   
Sbjct: 54  VTTRVAEVNIX--------------STTVEYPRASGVWQX----------RTTKGTLYTL 89

Query: 346 RVIWK--EEGMAGLYGGLTPHLLRVVPSAAIMFGMYE 380
              ++  EEG+  ++    P  +   P A I +   +
Sbjct: 90  HNFFRLDEEGIVYVWPXFDPKAVXENPDALIQWLTGK 126



 Score = 72.6 bits (178), Expect = 7e-16
 Identities = 13/147 (8%), Positives = 35/147 (23%), Gaps = 25/147 (17%)

Query: 121 QILRSIHVHEGWRALFKGLGPNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIH 180
           +    I + + + +   G             + F         ++               
Sbjct: 3   EKYHEI-LKKYFLSFETG---------DFSQVQFSCNLEFLSPISGNTL--KGTEEVIPF 50

Query: 181 LXXXXXXXXXXXXXXNPIWLVKTRLQLDKSNASNIPGRGRQYKNSLDCIRQTV--RHEGI 238
           L                +   +               + R  K +L  +        EGI
Sbjct: 51  LKGVTTRVAEVNIXSTTVEYPRASGVW----------QXRTTKGTLYTLHNFFRLDEEGI 100

Query: 239 RGLYRGLTASYLG-VTESSLQWVMYEE 264
             ++       +    ++ +QW+  ++
Sbjct: 101 VYVWPXFDPKAVXENPDALIQWLTGKD 127



 Score = 59.1 bits (143), Expect = 8e-12
 Identities = 9/118 (7%), Positives = 24/118 (20%), Gaps = 31/118 (26%)

Query: 43  LETKSKPAVKPWAHFFAGAVGGMTAATL-TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQ 101
           +   +    +    F  G    +    + ++ ++  +                       
Sbjct: 36  ISGNTLKGTEEVIPFLKGVTTRVAEVNIXSTTVEYPRASGVWQXR--------------- 80

Query: 102 SHSILSLSRSAMVHFSETVQILRSIHV--HEGWRALFKGLGPNLTGVVPARAINFYVY 157
                            T+  L +      EG   ++    P      P   I +   
Sbjct: 81  -------------TTKGTLYTLHNFFRLDEEGIVYVWPXFDPKAVXENPDALIQWLTG 125



 Score = 36.8 bits (85), Expect = 4e-05
 Identities = 5/43 (11%), Positives = 10/43 (23%), Gaps = 10/43 (23%)

Query: 343 QCFRVIWKEEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRL 385
           + +  I K+        G           + + F      L  
Sbjct: 3   EKYHEILKK-YFLSFETG---------DFSQVQFSCNLEFLSP 35


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0620    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,390,280
Number of extensions: 1073006
Number of successful extensions: 4024
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 3547
Number of HSP's successfully gapped: 394
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)