RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= CIRT_02186 cimm2 CIRG_02183 Broad_Institute ""
         (567 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245               93   4e-22
1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAM...    88   9e-21
1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273                 85   7e-20
1kuuA [d.153.2.1] CONSERVED PROTEIN                                    80   3e-18
1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273                     79   4e-18
1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1...    75   6e-17
1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414                       69   5e-15
1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273                  68   7e-15
1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE...    67   2e-14
1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177    66   3e-14
1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345        65   5e-14
1h12A [a.102.1.2] ENDO-1,4-BETA-XYLANASE                               46   3e-08

>1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245
          Length = 206

 Score = 92.5 bits (229), Expect = 4e-22
 Identities = 34/187 (18%), Positives = 67/187 (35%), Gaps = 10/187 (5%)

Query: 119 GIVPHYSVNIQSTSDIQTAVKFAAQ---KELYLTVKNTGHDHLGRSSGQGAFSLWTHNMK 175
             +P   +   ST D+   +  A         +  +  GH  +G++   G   +   ++ 
Sbjct: 27  SALPAAVLYPSSTGDLVALLSAANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLG 86

Query: 176 GREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXX 235
                           +     V     + W+DV RA+   GV     +           
Sbjct: 87  DAAAP------PRINVSADGRYVDAGGEQVWIDVLRASLARGVAPRSWTDYLYLTVGGTL 140

Query: 236 XXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSV 295
                S  +  +G  + N+LE++++  +G   T ++  + + F A+ GG G  +GVIT  
Sbjct: 141 SNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDAVLGGLGQ-FGVITRA 199

Query: 296 TYKTHPS 302
                P+
Sbjct: 200 RIAVEPA 206


>1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE
           A:3 -- 200
          Length = 198

 Score = 87.9 bits (217), Expect = 9e-21
 Identities = 16/196 (8%), Positives = 43/196 (21%), Gaps = 20/196 (10%)

Query: 122 PHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHT 181
             + V  +    +  A ++A  +   + +   G + L     +G   +            
Sbjct: 15  AQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEP 74

Query: 182 SFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXXXXXXHS 241
                           + + AGE W  + +   + G+  +   A                
Sbjct: 75  DA------------WYLHVGAGENWHRLVKYTLQEGMPGLENLALIP----GCVGSSPIQ 118

Query: 242 PFSHFYGLAVDNLLEVNLVDANGTPRTI---NQYTDPEYFYALRGGGGSAWGVITSVTYK 298
               +          V+ V+     +      +          +         I +V  +
Sbjct: 119 NIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQD-RFAIVAVGLR 177

Query: 299 THPSPSHIQVGLVQFN 314
                  +        
Sbjct: 178 LPKEWQPVLTYGDLTR 193


>1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273
          Length = 268

 Score = 84.9 bits (209), Expect = 7e-20
 Identities = 24/222 (10%), Positives = 51/222 (22%), Gaps = 35/222 (15%)

Query: 110 SPRDAPCDQGIVPHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSL 169
            P         +    V  ++ +D+Q+ V  A +    L   + G +     +       
Sbjct: 54  DPHHVMDQDYFLASAIVAPRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGS 113

Query: 170 WTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIV-VGGSARTV 228
              +M         +               ++ G  + D++     N +   +      +
Sbjct: 114 VVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLHNYLEANNLRDKLWLDVPDL 166

Query: 229 XXXXXXXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRG----- 283
                             YG        + +V ANG          P+            
Sbjct: 167 GGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRPETMGLKPE 226

Query: 284 ----------------------GGGSAWGVITSVTYKTHPSP 303
                                    S  G++T +     P+P
Sbjct: 227 DQPWSKIAHLFPYGFGPYIDGLFSQSNMGIVTKIGIWLMPNP 268


>1kuuA [d.153.2.1] CONSERVED PROTEIN
          Length = 202

 Score = 79.7 bits (196), Expect = 3e-18
 Identities = 16/161 (9%), Positives = 39/161 (24%), Gaps = 20/161 (12%)

Query: 158 LGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENG 217
           LGR    G  S  +         +           T     ++Q     +        + 
Sbjct: 3   LGRILAVGRNSNGSFVAYRVSSRS-------FPNRT----TSIQEERVAVVPVEGHERDV 51

Query: 218 VIVVGGSARTVXXXXXXXXXXX-----HSPFSHFYGLAVDNLLEVNLVDANGTPRTINQY 272
                 +   +                        G+ + + + ++L+  +     +N  
Sbjct: 52  FRNPYIAYNCIRIVGDTAVVSNGSHTDTIADKVALGMNLRDAIGLSLLAMDYEKDELNTP 111

Query: 273 TDPEYFYALRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQF 313
                  A+ G      G++T+        P    V +  +
Sbjct: 112 ---RIAAAINGSEAF-IGIVTADGLMVSRVPEETPVYISTY 148


>1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273
          Length = 217

 Score = 78.9 bits (194), Expect = 4e-18
 Identities = 28/184 (15%), Positives = 54/184 (29%), Gaps = 17/184 (9%)

Query: 130 STSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSF-IPKGA 188
           +  D+     +A + +  +  +   H     +  +GA                  +  G 
Sbjct: 40  TPQDVVRLANWAHEHDYKIRPRGAMHGWTPLTVEKGANVEKVILADTMTHLNGITVNTGG 99

Query: 189 PQETTGIPAVTLQAGEQWLDVYRAAAENG----------VIVVGGSARTVXXXXXXXXXX 238
           P     +  VT  AG     +     ++           V+ +GG+              
Sbjct: 100 P-----VATVTAGAGASIEAIVTELQKHDLGWANLPAPGVLSIGGALAVNAHGAALPAVG 154

Query: 239 XHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYK 298
             +   H YG   + + E+  V  NGT   +  Y   +               +TSVT +
Sbjct: 155 QTTLPGHTYGSLSNLVTELTAVVWNGTTYALETYQRNDPRITPLLTNL-GRCFLTSVTMQ 213

Query: 299 THPS 302
             P+
Sbjct: 214 AGPN 217


>1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1 --
           176
          Length = 176

 Score = 75.1 bits (184), Expect = 6e-17
 Identities = 11/186 (5%), Positives = 35/186 (18%), Gaps = 21/186 (11%)

Query: 122 PHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQ-GAFSLWTHNMKGREWH 180
                   S  ++   +      +  +         L        +  +   N+      
Sbjct: 5   AFSYRAPASLQEVIQVLADD--PDARIIAGGQSLLPLLAFRLVYPSCLVDLRNVSELFEI 62

Query: 181 TSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXXXXXXH 240
           +         ++ GI  +++ A                + +                   
Sbjct: 63  S---------QSAGI--LSVGAMVTHFRNKTDPTVAKCVPILPKVLAHVAHQAVRNRGTL 111

Query: 241 S-----PFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSV 295
                   +      +   L   +  A+         +  ++          A  V+  V
Sbjct: 112 GGSLAHADAGAEMPFLMATLGATMYIASSAGVR--SVSATDFMKGHYFTDLEAGEVLVRV 169

Query: 296 TYKTHP 301
                 
Sbjct: 170 EIPIPA 175


>1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414
          Length = 191

 Score = 68.7 bits (167), Expect = 5e-15
 Identities = 14/194 (7%), Positives = 31/194 (15%), Gaps = 27/194 (13%)

Query: 122 PHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSG-QGAFSLWTHNMKGREWH 180
               +   +  ++          E  L V NT      +         +    +      
Sbjct: 10  RVTWIQASTLKELLDLKAQHP--EAKLVVGNTEIGIEMKFKNQLFPMIICPAWIPELNAV 67

Query: 181 TSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXXXXXXH 240
                            ++  A      V +   E    +                    
Sbjct: 68  E-------HGPEG----ISFGAACALSSVEKTLLEAVAKLPTQKTEVFRGVLEQLRWFAG 116

Query: 241 SPF---------SHFYGLAVDNLLEVNLVDANGTPRTINQY----TDPEYFYALRGGGGS 287
                               D            T  +         D  +F + R     
Sbjct: 117 KQVKSVASLGGNIITASPISDLNPVFMASGTKLTIVSRGTRRTVPMDHTFFPSYRKTLLG 176

Query: 288 AWGVITSVTYKTHP 301
              ++ S+      
Sbjct: 177 PEEILLSIEIPYSR 190


>1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273
          Length = 265

 Score = 68.2 bits (166), Expect = 7e-15
 Identities = 13/170 (7%), Positives = 33/170 (19%), Gaps = 20/170 (11%)

Query: 121 VPHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTH------NM 174
                V   S  ++   +K     +  + ++         S+  G              +
Sbjct: 37  DALAVVFPGSLLELWRVLKACVTADKIILMQAANTGLTEGSTPNGNDYDRDVVIISTLRL 96

Query: 175 KGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENG-VIVVGGSARTVXXXXX 233
                          +       V    G     + +A    G        +  +     
Sbjct: 97  DKLHVL--------GKGEQ----VLAYPGTTLYSLEKALKPLGREPHSVIGSSCIGASVI 144

Query: 234 XXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRG 283
                         G A   +     ++ +G    +N     +       
Sbjct: 145 GGICNNSGGSLVQRGPAYTEMSLFARINEDGKLTLVNH-LGIDLGETPEQ 193


>1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
           A:15 -- 208
          Length = 194

 Score = 66.8 bits (163), Expect = 2e-14
 Identities = 25/181 (13%), Positives = 52/181 (28%), Gaps = 22/181 (12%)

Query: 122 PHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHT 181
             + +      ++Q  VK+A Q E+ +T    G + + R  G     +   ++   E   
Sbjct: 35  ADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIE--- 91

Query: 182 SFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXXXXXXHS 241
                          A+   +G   +DV R A +  +  +  +                 
Sbjct: 92  -----------VSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGA-----VY 135

Query: 242 PFSHFYGLAV-DNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYKTH 300
             +  YG  V D +     V+  G+   +        +            V+    +   
Sbjct: 136 MNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNS--IIQKEHLVVLEAAFTLA 193

Query: 301 P 301
           P
Sbjct: 194 P 194


>1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177
          Length = 177

 Score = 66.3 bits (161), Expect = 3e-14
 Identities = 16/178 (8%), Positives = 37/178 (20%), Gaps = 18/178 (10%)

Query: 130 STSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAP 189
           S  +    +           +   GH  L     + A      ++           +G+ 
Sbjct: 13  SVGEAVALLGQLGSD---AKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGS- 68

Query: 190 QETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVXXXXXXXXXXXHS-----PFS 244
                   V + A     D+  +      + +   A  +                     
Sbjct: 69  -------TVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDP 121

Query: 245 HFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYKTHPS 302
                A+   +E + V      R         +F            V+  +      +
Sbjct: 122 GNDHPALSIAVEAHFVLEGPNGRRTVPA--DGFFLGTYMTLLEENEVMVEIRVPAFAA 177


>1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345
          Length = 167

 Score = 65.5 bits (159), Expect = 5e-14
 Identities = 17/173 (9%), Positives = 33/173 (19%), Gaps = 19/173 (10%)

Query: 130 STSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSG-QGAFSLWTHNMKGREWHTSFIPKGA 188
           ++  +          E  L    T        +        +  + K             
Sbjct: 7   TSDALADWYLAH--PEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIR------- 57

Query: 189 PQETTGIPAVTLQAGEQWLDVYRAAAENGVIV---VGGSARTVXXXXXXXXXXXHSPFSH 245
                      + AG     +   A      +   +   A               +    
Sbjct: 58  ETPDG----YGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPI 113

Query: 246 FYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYK 298
             G      +  +L    G  R        ++F   R         + SVT  
Sbjct: 114 GDGPPALIAMGASLTLRRGQERRRMPL--EDFFLEYRKQDRRPGEFVESVTLP 164


>1h12A [a.102.1.2] ENDO-1,4-BETA-XYLANASE
          Length = 404

 Score = 46.4 bits (109), Expect = 3e-08
 Identities = 8/106 (7%), Positives = 22/106 (20%), Gaps = 11/106 (10%)

Query: 459 AKRDETSTHPIWEQSRALLSFAANWRDDASANE-----KRNAKLSLVEISKKLGDIVG-- 511
              +  +   I           A     ++ N+           +     +++    G  
Sbjct: 276 QWYEFDAWRVIMNVGLDAHLMGAQAWHKSAVNKALGFLSYAKTNNSKNCYEQVYSYGGAQ 335

Query: 512 ----PGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLF 553
                G G     A             E +    ++ +       +
Sbjct: 336 NRGCAGEGQKAANAVALLASTNAGQANEFFNEFWSLSQPTGDYRYY 381


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.133    0.441 

Gapped
Lambda     K      H
   0.267   0.0677    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 18,910,611
Number of extensions: 1229569
Number of successful extensions: 3402
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 3321
Number of HSP's successfully gapped: 83
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)