BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81021.1 cper0 ddlA GIB00075CH01 "D-alanine-D-alanine ligase"
         (301 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1iovA [x.x.x] D-ALA\:D-ALA LIGASE                                     183   5e-49
1iowA [x.x.x] D-ALA\:D-ALA LIGASE                                     182   1e-48
1e4eA [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANC...   156   6e-41
3i12A [x.x.x] D-ALANINE-D-ALANINE LIGASE A                            155   1e-40
1e4eB [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANC...   152   1e-39
3i12D [x.x.x] D-ALANINE-D-ALANINE LIGASE A                            150   5e-39
3i12C [x.x.x] D-ALANINE-D-ALANINE LIGASE A                            147   3e-38
3i12B [x.x.x] D-ALANINE-D-ALANINE LIGASE A                            147   5e-38
2i80B [x.x.x] D-ALANINE-D-ALANINE LIGASE                              132   1e-33
2i80A [x.x.x] D-ALANINE-D-ALANINE LIGASE                              132   1e-33
2zdhA [x.x.x] D-ALANINE--D-ALANINE LIGASE                             127   4e-32
2fb9A [x.x.x] D-ALANINE:D-ALANINE LIGASE                              127   4e-32
2i87B [x.x.x] D-ALANINE-D-ALANINE LIGASE                              127   6e-32
1ehiA [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE                   127   6e-32
2yznA [x.x.x] D-ALANINE-D-ALANINE LIGASE                              122   1e-30
1ehiB [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE                   122   2e-30
2zdhC [x.x.x] D-ALANINE--D-ALANINE LIGASE                             120   5e-30
2zdgB [x.x.x] D-ALANINE--D-ALANINE LIGASE                             117   3e-29
2yznB [x.x.x] D-ALANINE-D-ALANINE LIGASE                              115   1e-28
3e5nA [x.x.x] D-ALANINE-D-ALANINE LIGASE A                            115   1e-28
2zdgA [x.x.x] D-ALANINE--D-ALANINE LIGASE                             115   2e-28
2zdhB [x.x.x] D-ALANINE--D-ALANINE LIGASE                             114   3e-28
2yznC [x.x.x] D-ALANINE-D-ALANINE LIGASE                              114   3e-28
2yzmB [x.x.x] D-ALANINE--D-ALANINE LIGASE                             113   6e-28
2yzmC [x.x.x] D-ALANINE--D-ALANINE LIGASE                             112   1e-27
2yzgA [x.x.x] D-ALANINE--D-ALANINE LIGASE                             110   4e-27
2zdgD [x.x.x] D-ALANINE--D-ALANINE LIGASE                             110   7e-27
2yzgC [x.x.x] D-ALANINE--D-ALANINE LIGASE                              98   3e-23
2yzgB [x.x.x] D-ALANINE--D-ALANINE LIGASE                              97   5e-23
2pvpA [x.x.x] D-ALANINE-D-ALANINE LIGASE                               86   2e-19
2pvpB [x.x.x] D-ALANINE-D-ALANINE LIGASE                               76   1e-16
1vkzA [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLAMINE--GLYCINE L...    55   3e-10
1bxrA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    40   1e-05
1m6vA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    39   3e-05
2qk4A [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN                38   4e-05
1ce8A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] PR...    38   4e-05
1c30A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    38   4e-05
2qk4B [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN                36   2e-04
1jdbK [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    36   2e-04
2dzdB [x.x.x] PYRUVATE CARBOXYLASE                                     33   8e-04

>1iovA [x.x.x] D-ALA\:D-ALA LIGASE
          Length = 306

 Score =  183 bits (465), Expect = 5e-49
 Identities = 106/300 (35%), Positives = 169/300 (56%), Gaps = 8/300 (2%)

Query: 2   KVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALH 61
           K+ V++GG S+ERE+S+ SG +V+  L +   +A P+   E +    K  G     +ALH
Sbjct: 4   KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALH 63

Query: 62  GKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARW------EMV 115
           G+ GEDGT+Q +L+ +G+P++G G ++SA+ MDK  +K +     +  A W      E  
Sbjct: 64  GRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFE 123

Query: 116 SSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYI 175
             + +    +I  LG PV VKP+  GSSV  + V ++ A++DA+  A ++D EV+IE+++
Sbjct: 124 KGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWL 183

Query: 176 KGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGDGGADEFI-VELNEDLHKEVEKMALE 234
            G E T  I+  ++LP + I+P G F+D  +KY       F    L       ++ + L+
Sbjct: 184 SGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQALVLK 243

Query: 235 TYKLLKCDVYARVD-MLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
            +  L C  + R+D ML  D   Y+LE NT PGMT +SL P +A    MSF +L+  I+E
Sbjct: 244 AWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILE 303


>1iowA [x.x.x] D-ALA\:D-ALA LIGASE
          Length = 306

 Score =  182 bits (461), Expect = 1e-48
 Identities = 105/300 (35%), Positives = 169/300 (56%), Gaps = 8/300 (2%)

Query: 2   KVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALH 61
           K+ V++GG S+ERE+S+ SG +V+  L +   +A P+   E +    K  G     +ALH
Sbjct: 4   KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALH 63

Query: 62  GKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARW------EMV 115
           G+ GEDGT+Q +L+ +G+P++G G ++SA+ MDK  +K +     +  A W      E  
Sbjct: 64  GRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFE 123

Query: 116 SSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYI 175
             + +    +I  LG PV VKP+  GSSV  + V ++ A++DA+  A ++D EV+IE+++
Sbjct: 124 KGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWL 183

Query: 176 KGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGDGGADEFI-VELNEDLHKEVEKMALE 234
            G E T  I+  ++LP + I+P G F+D  +K+       F    L       ++ + L+
Sbjct: 184 SGPEFTVAILGEEILPSIRIQPSGTFYDYEAKFLSDETQYFCPAGLEASQEANLQALVLK 243

Query: 235 TYKLLKCDVYARVD-MLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
            +  L C  + R+D ML  D   Y+LE NT PGMT +SL P +A    MSF +L+  I+E
Sbjct: 244 AWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILE 303


>1e4eA [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
           PROTEIN
          Length = 341

 Score =  156 bits (395), Expect = 6e-41
 Identities = 107/347 (30%), Positives = 170/347 (48%), Gaps = 58/347 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLN---------------EKED 45
           +KV ++ GG S E ++S++S   +   ++K+KYE + I +                E E+
Sbjct: 3   IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPCAEWENEN 62

Query: 46  ---------------LIEK-----VKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCG 85
                          L++K     +  +D A  ALHGK GEDG++Q + +  GIPF GC 
Sbjct: 63  CYSAVLSPDKKMHGLLVKKNHEYEINHVDVAFSALHGKSGEDGSIQGLFELSGIPFVGCD 122

Query: 86  PLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVA 145
             SSAICMDK +T  +     + T  + +++  D           YPVFVKP   GSS  
Sbjct: 123 IQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARSGSSFG 179

Query: 146 TTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIA 205
              V S + +  A+  A +YD++++IE+ + G E+ C ++      V+     G+   I 
Sbjct: 180 VKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVV-----GEVDQIR 234

Query: 206 SKYG----------DGGADEFIVELNEDLHKE----VEKMALETYKLLKCDVYARVDMLV 251
            +YG          + G++  ++ +  DL  E    +++   + YK L C   ARVDM +
Sbjct: 235 LQYGIFRIHQEVEPEKGSENAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFL 294

Query: 252 KDNIPYVL-EVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
           +DN   VL EVNTLPG T  S +P+  A   +S  EL+D +I  +LK
Sbjct: 295 QDNGRIVLNEVNTLPGFTSYSRYPRMMAAAGISLPELIDRLIVLALK 341


>3i12A [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 360

 Score =  155 bits (392), Expect = 1e-40
 Identities = 103/350 (29%), Positives = 184/350 (52%), Gaps = 56/350 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVL--------NEKEDLIE---- 48
           ++VG++ GG S+E E+S+QS  ++V A+DK +++ + + +        N+ E+ ++    
Sbjct: 3   LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQNADD 62

Query: 49  --------------KVKG-----------------IDFALLALHGKFGEDGTVQSVLKTL 77
                         +V G                 +D     +HG  GEDG++Q +L+  
Sbjct: 63  PAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVA 122

Query: 78  GIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDE--IDYEKIEN-LGYPVF 134
            +PF G   LSSA CMDKD+ KR+L    +  A +  ++  +     + ++E+ LG P+F
Sbjct: 123 NLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLF 182

Query: 135 VKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLA 194
           VKP N GSSV  + V ++   + AV  A ++D +V++E+ IKG EI C ++ G   P  +
Sbjct: 183 VKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-GNDNPQAS 241

Query: 195 ----IKPKGKFFDIASKYGDGGADEFIV--ELNEDLHKEVEKMALETYKLLKCDVYARVD 248
               I    +F+D  +KY D    + +V  ++  +++ ++  +A++ Y+ L C   ARVD
Sbjct: 242 TCGEIVLNSEFYD--TKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMARVD 299

Query: 249 M-LVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
           + L  DN   + E+NTLPG T  S++PK      + + +L+  +IE +L+
Sbjct: 300 VFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALE 349


>1e4eB [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
           PROTEIN
          Length = 340

 Score =  152 bits (384), Expect = 1e-39
 Identities = 105/346 (30%), Positives = 168/346 (48%), Gaps = 58/346 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLN---------------EKED 45
           +KV ++ GG S E ++S++S   +   ++K+KYE + I +                E E+
Sbjct: 3   IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPCAEWENEN 62

Query: 46  ---------------LIEK-----VKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCG 85
                          L++K     +  +D A  ALHGK GEDG++Q + +  GIPF GC 
Sbjct: 63  CYSAVLSPDKKMHGLLVKKNHEYEINHVDVAFSALHGKSGEDGSIQGLFELSGIPFVGCD 122

Query: 86  PLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVA 145
             SSAICMDK +T  +     + T  + +++  D           YPVFVKP   GSS  
Sbjct: 123 IQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARSGSSFG 179

Query: 146 TTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIA 205
              V S + +  A+  A +YD++++IE+ + G E+ C ++      V+     G+   I 
Sbjct: 180 VKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVV-----GEVDQIR 234

Query: 206 SKYG----------DGGADEFIVELNEDLHKE----VEKMALETYKLLKCDVYARVDMLV 251
            +YG          + G++  ++ +  DL  E    +++   + YK L C   ARVDM +
Sbjct: 235 LQYGIFRIHQEVEPEKGSENAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFL 294

Query: 252 KDNIPYVL-EVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           +D    VL EVNTLPG T  S +P+  A   +S  EL+D +I  +L
Sbjct: 295 QDRGRIVLNEVNTLPGFTSYSRYPRMMAAAGISLPELIDRLIVLAL 340


>3i12D [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 355

 Score =  150 bits (379), Expect = 5e-39
 Identities = 100/346 (28%), Positives = 179/346 (51%), Gaps = 52/346 (15%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVL--------NEKEDLIE---- 48
           ++VG++ GG S+E E+S+QS  ++V A+DK +++ + + +        N+ E+ ++    
Sbjct: 2   LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQNADD 61

Query: 49  --------------KVKG-----------------IDFALLALHGKFGEDGTVQSVLKTL 77
                         +V G                 +D     +HG  GEDG++Q +L+  
Sbjct: 62  PAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVA 121

Query: 78  GIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDE--IDYEKIEN-LGYPVF 134
            +PF G   LSSA CMDKD+ KR+L    +  A +  ++  +     + ++E+ LG P+F
Sbjct: 122 NLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLF 181

Query: 135 VKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLA 194
           VKP N GSSV  + V ++   + AV  A ++D +V++E+ IKG EI C ++ G   P   
Sbjct: 182 VKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-GNDNP--Q 238

Query: 195 IKPKGKFFDIASKYGDGGADEFIV--ELNEDLHKEVEKMALETYKLLKCDVYARVDM-LV 251
               G+    +  Y D    + +V  ++  +++ ++  +A++ Y+ L C   ARVD+ L 
Sbjct: 239 ASTCGEIVLNSEFYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVFLT 298

Query: 252 KDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
            DN   + E+NTLPG T  S++PK      + + +L+  +IE +L+
Sbjct: 299 ADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALE 344


>3i12C [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 348

 Score =  147 bits (372), Expect = 3e-38
 Identities = 99/347 (28%), Positives = 175/347 (50%), Gaps = 63/347 (18%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVL--------NEKEDLIE---- 48
           ++VG++ GG S+E E+S+QS  ++V A+DK +++ + + +        N+ E+ ++    
Sbjct: 3   LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQNADD 62

Query: 49  --------------KVKG-----------------IDFALLALHGKFGEDGTVQSVLKTL 77
                         +V G                 +D     +HG  GEDG++Q +L+  
Sbjct: 63  PAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVA 122

Query: 78  GIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDE--IDYEKIEN-LGYPVF 134
            +PF G   LSSA CMDKD+ KR+L    +  A +  ++  +     + ++E+ LG P+F
Sbjct: 123 NLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLF 182

Query: 135 VKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLA 194
           VKP N GSSV  + V ++   + AV  A ++D +V++E+ IKG EI C ++         
Sbjct: 183 VKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL--------- 233

Query: 195 IKPKGKFFDIASKYGD---GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDM-L 250
               G     AS  G+   G       ++  +++ ++  +A++ Y+ L C   ARVD+ L
Sbjct: 234 ----GNDNPQASTCGEIVLGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVFL 289

Query: 251 VKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
             DN   + E+NTLPG T  S++PK      + + +L+  +IE +L+
Sbjct: 290 TADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALE 336


>3i12B [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 346

 Score =  147 bits (370), Expect = 5e-38
 Identities = 98/345 (28%), Positives = 175/345 (50%), Gaps = 61/345 (17%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVL--------NEKEDLIE---- 48
           ++VG++ GG S+E E+S+QS  ++V A+DK +++ + + +        N+ E+ ++    
Sbjct: 4   LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQNADD 63

Query: 49  --------------KVKG-----------------IDFALLALHGKFGEDGTVQSVLKTL 77
                         +V G                 +D     +HG  GEDG++Q +L+  
Sbjct: 64  PAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVA 123

Query: 78  GIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDE--IDYEKIEN-LGYPVF 134
            +PF G   LSSA CMDKD+ KR+L    +  A +  ++  +     + ++E+ LG P+F
Sbjct: 124 NLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLF 183

Query: 135 VKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLA 194
           VKP N GSSV  + V ++   + AV  A ++D +V++E+ IKG EI C ++         
Sbjct: 184 VKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL--------- 234

Query: 195 IKPKGKFFDIASKYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDM-LVK 252
               G     AS  G+      +  ++  +++ ++  +A++ Y+ L C   ARVD+ L  
Sbjct: 235 ----GNDNPQASTCGEIVLQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVFLTA 290

Query: 253 DNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
           DN   + E+NTLPG T  S++PK      + + +L+  +IE +L+
Sbjct: 291 DNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALE 335


>2i80B [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 347

 Score =  132 bits (333), Expect = 1e-33
 Identities = 101/331 (30%), Positives = 157/331 (47%), Gaps = 52/331 (15%)

Query: 5   VIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKED------LIEKVKGIDFALL 58
           ++ GG S+E E+SI +  +V++A+DKDKY    I +    D      +  ++K  D   L
Sbjct: 6   IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEIKSTDELHL 65

Query: 59  A--------------------------LHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAIC 92
                                      LHG  GEDGT+Q + + L +P+ G G LS+A  
Sbjct: 66  ENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNGVLSAASS 125

Query: 93  MDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIEN---------LGYPVFVKPNNGGSS 143
           MDK + K++     +    +    S    +YEK E+         L YPVFVKP N GSS
Sbjct: 126 MDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHNILKLVNDKLNYPVFVKPANLGSS 182

Query: 144 VATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFD 203
           V  +   ++  +K+ + EA ++D +++IE+ +   EI   ++ G   P  A  P     D
Sbjct: 183 VGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKD 240

Query: 204 IASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLV-KDNIPYVLEVN 262
           +A       AD     L+ED+   +  MALE +K   C    R D  V +DN  Y+ E N
Sbjct: 241 VAFVQLQIPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDNQIYINETN 295

Query: 263 TLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
            +PG T  S++PK    + +S+ EL+  +IE
Sbjct: 296 AMPGFTAFSMYPKLWENMGLSYPELITKLIE 326


>2i80A [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 345

 Score =  132 bits (333), Expect = 1e-33
 Identities = 101/331 (30%), Positives = 157/331 (47%), Gaps = 52/331 (15%)

Query: 5   VIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKED------LIEKVKGIDFALL 58
           ++ GG S+E E+SI +  +V++A+DKDKY    I +    D      +  ++K  D   L
Sbjct: 6   IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEIKSTDELHL 65

Query: 59  A--------------------------LHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAIC 92
                                      LHG  GEDGT+Q + + L +P+ G G LS+A  
Sbjct: 66  ENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNGVLSAASS 125

Query: 93  MDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIEN---------LGYPVFVKPNNGGSS 143
           MDK + K++     +    +    S    +YEK E+         L YPVFVKP N GSS
Sbjct: 126 MDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHNILKLVNDKLNYPVFVKPANLGSS 182

Query: 144 VATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFD 203
           V  +   ++  +K+ + EA ++D +++IE+ +   EI   ++ G   P  A  P     D
Sbjct: 183 VGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKD 240

Query: 204 IASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLV-KDNIPYVLEVN 262
           +A       AD     L+ED+   +  MALE +K   C    R D  V +DN  Y+ E N
Sbjct: 241 VAFVQLQIPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDNQIYINETN 295

Query: 263 TLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
            +PG T  S++PK    + +S+ EL+  +IE
Sbjct: 296 AMPGFTAFSMYPKLWENMGLSYPELITKLIE 326


>2zdhA [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 319

 Score =  127 bits (319), Expect = 4e-32
 Identities = 95/331 (28%), Positives = 160/331 (48%), Gaps = 48/331 (14%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F+D  +
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYET 227

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
           KY  G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 228 KYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 287

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 288 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 318


>2fb9A [x.x.x] D-ALANINE:D-ALANINE LIGASE
          Length = 322

 Score =  127 bits (319), Expect = 4e-32
 Identities = 95/331 (28%), Positives = 160/331 (48%), Gaps = 48/331 (14%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 4   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 63

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 64  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 114

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 115 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 170

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F+D  +
Sbjct: 171 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYET 230

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
           KY  G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 231 KYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 290

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 291 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 321


>2i87B [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 344

 Score =  127 bits (318), Expect = 6e-32
 Identities = 100/330 (30%), Positives = 156/330 (47%), Gaps = 53/330 (16%)

Query: 5   VIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKED------LIEKVKGIDFALL 58
           ++ GG S+E E+SI +  +V++A+DKDKY    I +    D      +  ++K  D   L
Sbjct: 6   IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEIKSTDELHL 65

Query: 59  A-------------------------LHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAICM 93
                                     LHG   EDGT+Q + + L +P+ G G LS+A  M
Sbjct: 66  ENGELEISQLLKESSSGQPYDAVFPLLHGP--EDGTIQGLFEVLDVPYVGNGVLSAASSM 123

Query: 94  DKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIEN---------LGYPVFVKPNNGGSSV 144
           DK + K++     +    +    S    +YEK E+         L YPVFVKP N GSSV
Sbjct: 124 DKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHNILKLVNDKLNYPVFVKPANLGSSV 180

Query: 145 ATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDI 204
             +   ++  +K+ + EA ++D +++IE+ +   EI   ++ G   P  A  P     D+
Sbjct: 181 GISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKDV 238

Query: 205 ASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLV-KDNIPYVLEVNT 263
           A       AD     L+ED+   +  MALE +K   C    R D  V +DN  Y+ E N 
Sbjct: 239 AFVQLQIPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDNQIYINETNA 293

Query: 264 LPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
           +PG T  S++PK    + +S+ EL+  +IE
Sbjct: 294 MPGFTAFSMYPKLWENMGLSYPELITKLIE 323


>1ehiA [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
          Length = 360

 Score =  127 bits (318), Expect = 6e-32
 Identities = 98/345 (28%), Positives = 171/345 (49%), Gaps = 53/345 (15%)

Query: 2   KVGVIMGGISSEREISIQSGNSVVHALDKD-KYEAIP------------------IVLNE 42
           +V +I GG SSE ++S +S  +  +A++   KYE I                   + L +
Sbjct: 3   RVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQNGFFLDTESSKKILALED 62

Query: 43  KEDLIE-------------------KVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSG 83
           ++ +++                        D     +HG  GEDGT+Q + K L  P+ G
Sbjct: 63  EQPIVDAFMKTVDASDPLARIHALKSAGDFDIFFPVVHGNLGEDGTLQGLFKLLDKPYVG 122

Query: 84  CGPLSSAICMDKDMTKRILAFGNVRTARWEMV--SSVDEIDYEKI-ENLGYPVFVKPNNG 140
                 A+  DK +TK +L    +R  ++ +V   S +   ++KI   LG  VFVK  N 
Sbjct: 123 APLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFVKAANQ 182

Query: 141 GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLA------ 194
           GSSV  + V + E   +A+ ++ +YD +V+IEE + G       + G   P+++      
Sbjct: 183 GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGAHT 242

Query: 195 IKPKGK---FFDIASKYGDGGADEFIV--ELNEDLHKEVEKMALETYKLLKCDVYARVDM 249
           +  +G    ++D  +K+ D  A  F +  +L+ ++ KEV++MAL+ YK+L     AR+D 
Sbjct: 243 VPNQGSGDGWYDYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDF 302

Query: 250 LV-KDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
           L+ ++N+PY+ E NTLPG T  SLF +     +++  +L+D +I+
Sbjct: 303 LLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLID 347


>2yznA [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 317

 Score =  122 bits (306), Expect = 1e-30
 Identities = 92/331 (27%), Positives = 158/331 (47%), Gaps = 50/331 (15%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V         +                +SV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRK------GEXXXXXXXXXXXXXXANTSVGISRVE 165

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F+D  +
Sbjct: 166 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYET 225

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
           KY  G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 226 KYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 285

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 286 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 316


>1ehiB [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
          Length = 347

 Score =  122 bits (305), Expect = 2e-30
 Identities = 96/335 (28%), Positives = 161/335 (48%), Gaps = 55/335 (16%)

Query: 2   KVGVIMGGISSEREISIQSGNSVVHALDKD-KYEAIP------------------IVLNE 42
           +V +I GG SSE ++S +S  +  +A++   KYE I                   + L +
Sbjct: 4   RVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQNGFFLDTESSKKILALED 63

Query: 43  KEDLIE-------------------KVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSG 83
           ++ +++                        D     +HG  GEDGT+Q + K L  P+ G
Sbjct: 64  EQPIVDAFMKTVDASDPLARIHALKSAGDFDIFFPVVHGNLGEDGTLQGLFKLLDKPYVG 123

Query: 84  CGPLSSAICMDKDMTKRILAFGNVRTARWEMV--SSVDEIDYEKI-ENLGYPVFVKPNNG 140
                 A+  DK +TK +L    +R  ++ +V   S +   ++KI   LG  VFVK  N 
Sbjct: 124 APLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFVKAANQ 183

Query: 141 GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIIDGKMLPVLAIKPKG 199
           GSSV  + V + E   +A+ ++ +YD +V+IEE + G  E+   +I      V  I    
Sbjct: 184 GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGAHT 243

Query: 200 KFFDIASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLV-KDNIPYV 258
             F I +            +L+ ++ KEV++MAL+ YK+L     AR+D L+ ++N+PY+
Sbjct: 244 VHFQIPA------------QLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYL 291

Query: 259 LEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
            E NTLPG T  SLF +     +++  +L+D +I+
Sbjct: 292 GEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLID 326


>2zdhC [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 316

 Score =  120 bits (301), Expect = 5e-30
 Identities = 94/331 (28%), Positives = 159/331 (48%), Gaps = 51/331 (15%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F+   +
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFY---T 224

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
           KY  G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 225 KYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 284

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 285 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 315


>2zdgB [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 303

 Score =  117 bits (294), Expect = 3e-29
 Identities = 92/327 (28%), Positives = 153/327 (46%), Gaps = 56/327 (17%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD 210
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G+
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 211 GGAD-EFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTK 269
              + E ++    D  + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+PG T 
Sbjct: 216 VRYEAELLIPAPLDTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTP 275

Query: 270 NSLFPKSAAGINMSFEELLDTIIEKSL 296
            S++P+      +++ ELL  ++E +L
Sbjct: 276 TSMYPRLFEAGGVAYPELLRRLVELAL 302


>2yznB [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 313

 Score =  115 bits (289), Expect = 1e-28
 Identities = 93/331 (28%), Positives = 156/331 (47%), Gaps = 54/331 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F     
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPF----- 222

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
            Y  G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 223 -YTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 281

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 282 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 312


>3e5nA [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 340

 Score =  115 bits (289), Expect = 1e-28
 Identities = 94/349 (26%), Positives = 151/349 (43%), Gaps = 71/349 (20%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKED--------------- 45
           ++VG+I GG S+E E+S+QS  +++ ALD  ++E + I ++++                 
Sbjct: 3   IRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKQGQWHVNDPDSFLLHADD 62

Query: 46  -----LIEKVKGI---------------------DFALLALHGKFGEDGTVQSVLKTLGI 79
                L    +G+                     D     +HG  GEDG++Q +L+   +
Sbjct: 63  PARIALHRSGRGVALLPGXXXXXXXXXXXXXXXXDVVFPIVHGTLGEDGSLQGLLRMANL 122

Query: 80  PFSGCGPLSSAICMDKDMTKRILAFGNVRTARW----EMVSSVDEIDYEKIENLGYPVFV 135
           PF G G L SA+ MDKDM KR+L    +  A +       ++  ++D   I  LG P+FV
Sbjct: 123 PFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAAHADVD-TLIAQLGLPLFV 181

Query: 136 KPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAI 195
           KP N GSSV  + V +             YD +V++E  + G EI C ++ G  +P  ++
Sbjct: 182 KPANQGSSVGVSQVRTXXXXXXXXXXXXXYDHKVLVEAAVAGREIECAVL-GNAVPHASV 240

Query: 196 KPKGKFFDIASKYGDGGADEFIVEL------NEDLHKEVEKMALETYKLLKCDVYARVDM 249
                              E +VE+                        L C   ARVD+
Sbjct: 241 -----------------CGEVVVEIVIPXXXXXXXXXXXXXXXXXXXXXLGCAGMARVDV 283

Query: 250 -LVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSLK 297
            L  D    + EVNTLPG T+ S++PK      + +  L+  +IE +L+
Sbjct: 284 FLCADGRIVINEVNTLPGFTRISVYPKLWQASGLDYRGLITRLIELALE 332


>2zdgA [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 302

 Score =  115 bits (288), Expect = 2e-28
 Identities = 91/326 (27%), Positives = 150/326 (46%), Gaps = 55/326 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD 210
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G+
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 211 GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKN 270
                    L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+PG T  
Sbjct: 216 VRELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPT 275

Query: 271 SLFPKSAAGINMSFEELLDTIIEKSL 296
           S++P+      +++ ELL  ++E +L
Sbjct: 276 SMYPRLFEAGGVAYPELLRRLVELAL 301


>2zdhB [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 312

 Score =  114 bits (286), Expect = 3e-28
 Identities = 92/331 (27%), Positives = 156/331 (47%), Gaps = 55/331 (16%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIAS 206
             + ++ A+  A +YD + ++E+ +    E+   ++    G+  PV  ++ +  F+    
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFY---- 223

Query: 207 KYGDGGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLP 265
               G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+P
Sbjct: 224 ---PGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIP 280

Query: 266 GMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           G T  S++P+      +++ ELL  ++E +L
Sbjct: 281 GFTPTSMYPRLFEAGGVAYPELLRRLVELAL 311


>2yznC [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 309

 Score =  114 bits (286), Expect = 3e-28
 Identities = 94/333 (28%), Positives = 154/333 (46%), Gaps = 62/333 (18%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD 210
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G+
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 211 ------GGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNT 263
                 G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT
Sbjct: 216 VRYEAPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNT 275

Query: 264 LPGMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           +PG T  S++P+      +++ ELL  ++E +L
Sbjct: 276 IPGFTPTSMYPRLFEAGGVAYPELLRRLVELAL 308


>2yzmB [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 312

 Score =  113 bits (283), Expect = 6e-28
 Identities = 94/336 (27%), Positives = 154/336 (45%), Gaps = 65/336 (19%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD 210
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G+
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 211 ---------GGADEFI-VELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLE 260
                    G A+  I   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E
Sbjct: 216 VRYEAPFTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNE 275

Query: 261 VNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           +NT+PG T  S++P+      +++ ELL  ++E +L
Sbjct: 276 LNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELAL 311


>2yzmC [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 308

 Score =  112 bits (281), Expect = 1e-27
 Identities = 92/332 (27%), Positives = 153/332 (46%), Gaps = 61/332 (18%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYG- 209
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G 
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 210 ---DGGADEFIV--ELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTL 264
              +    E ++   L+    + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+
Sbjct: 216 VRYEAPRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTI 275

Query: 265 PGMTKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           PG T  S++P+      +++ ELL  ++E +L
Sbjct: 276 PGFTPTSMYPRLFEAGGVAYPELLRRLVELAL 307


>2yzgA [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 315

 Score =  110 bits (276), Expect = 4e-27
 Identities = 79/248 (31%), Positives = 129/248 (52%), Gaps = 12/248 (4%)

Query: 54  DFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWE 113
           D     LHG+FGEDGTVQ  L+ LG P+ G G  +SA+C DKD++KR+LA   V    W 
Sbjct: 74  DVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWV 132

Query: 114 MVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEE 173
            V   +                   N GSSV  + VE  + ++ A+  A +YD + ++E+
Sbjct: 133 AVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEK 188

Query: 174 YIKG-DEITCPIID---GKMLPVLAIKPKGKFFDIASKYGDGGADEFI-VELNEDLHKEV 228
            +    E+   ++    G+  PV  ++ +  F+D  +KY  G A+  I   L+    + V
Sbjct: 189 ALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETV 248

Query: 229 EKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELL 288
           +++AL+ YK+L     ARVD  + +   Y+ E+NT+PG T  S +P+      +++ ELL
Sbjct: 249 QELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAGGVAYPELL 306

Query: 289 DTIIEKSL 296
             ++E +L
Sbjct: 307 RRLVELAL 314


>2zdgD [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 304

 Score =  110 bits (274), Expect = 7e-27
 Identities = 91/329 (27%), Positives = 151/329 (45%), Gaps = 59/329 (17%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHALD------------------------------K 30
           M+V +I GG+S E E+S+ S   V+  +                               +
Sbjct: 1   MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWXXXXXXXXXXXXXXXPE 60

Query: 31  DKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSA 90
            ++   P +  E+ D++       F LL  HG+FGEDGTVQ  L+ LG P+ G G  +SA
Sbjct: 61  GEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTVQGFLELLGKPYVGAGVAASA 111

Query: 91  ICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVE 150
           +CMDKD++KR+LA   V    W  V   +                   N GSSV  + VE
Sbjct: 112 LCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVE 167

Query: 151 SKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD 210
             + ++ A+  A +YD + ++E+ +       P+ +      L +   G  F  AS  G+
Sbjct: 168 RFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE 215

Query: 211 ---GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGM 267
                  E ++       + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+PG 
Sbjct: 216 VRYEAPAELLIPA-PLTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGF 274

Query: 268 TKNSLFPKSAAGINMSFEELLDTIIEKSL 296
           T  S++P+      +++ ELL  ++E +L
Sbjct: 275 TPTSMYPRLFEAGGVAYPELLRRLVELAL 303


>2yzgC [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 305

 Score = 98.2 bits (243), Expect = 3e-23
 Identities = 78/250 (31%), Positives = 123/250 (49%), Gaps = 26/250 (10%)

Query: 54  DFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWE 113
           D     LHG+FGEDGTVQ  L+ LG P+ G G  +SA+C DKD++KR+LA   V    W 
Sbjct: 74  DVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWV 132

Query: 114 MVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEE 173
            V   +                   N GSSV  + VE  + ++ A+  A +YD + ++E+
Sbjct: 133 AVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEK 188

Query: 174 YIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD------GGADEFI-VELNEDLHK 226
            +       P+ +      L +   G  F  AS  G+      G A+  I   L+    +
Sbjct: 189 ALS------PVRE------LEVGVLGNVFGEASPVGEVRYEAPGRAELLIPAPLDPGTQE 236

Query: 227 EVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEE 286
            V+++AL+ YK+L     ARVD  + +   Y+ E+NT+PG T  S +P+      +++ E
Sbjct: 237 TVQELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAGGVAYPE 294

Query: 287 LLDTIIEKSL 296
           LL  ++E +L
Sbjct: 295 LLRRLVELAL 304


>2yzgB [x.x.x] D-ALANINE--D-ALANINE LIGASE
          Length = 307

 Score = 97.4 bits (241), Expect = 5e-23
 Identities = 78/252 (30%), Positives = 123/252 (48%), Gaps = 28/252 (11%)

Query: 54  DFALLALHGKFGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWE 113
           D     LHG+FGEDGTVQ  L+ LG P+ G G  +SA+C DKD++KR+LA   V    W 
Sbjct: 74  DVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWV 132

Query: 114 MVSSVDEIDYEKIENLGYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEE 173
            V   +                   N GSSV  + VE  + ++ A+  A +YD + ++E+
Sbjct: 133 AVRKGE----XXXXXXXXXXXXXXANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEK 188

Query: 174 YIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD--------GGADEFI-VELNEDL 224
            +       P+ +      L +   G  F  AS  G+        G A+  I   L+   
Sbjct: 189 ALS------PVRE------LEVGVLGNVFGEASPVGEVRYEAPFPGRAELLIPAPLDPGT 236

Query: 225 HKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMSF 284
            + V+++AL+ YK+L     ARVD  + +   Y+ E+NT+PG T  S +P+      +++
Sbjct: 237 QETVQELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAGGVAY 294

Query: 285 EELLDTIIEKSL 296
            ELL  ++E +L
Sbjct: 295 PELLRRLVELAL 306


>2pvpA [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 329

 Score = 85.5 bits (210), Expect = 2e-19
 Identities = 80/316 (25%), Positives = 136/316 (43%), Gaps = 46/316 (14%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHAL-DKDKY-------------------------- 33
           M+  V+ GG S E EISI S  ++   L D+ KY                          
Sbjct: 2   MEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI 61

Query: 34  ---EAIPIVLN-----EKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCG 85
              +  P++L      +   L  K+  +   +  +HG  GEDG + S+L+   I F G  
Sbjct: 62  KEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR 121

Query: 86  PLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVA 145
             +S +  +K +TK       ++T  + +++  +  +   + N  +P  VKP+N GSS+ 
Sbjct: 122 IEASVLSYNKYLTKLYAKDLGIKTLDYVLLNEKNRANALDLMNFNFPFIVKPSNAGSSLG 181

Query: 146 TTLVESKEAVKDAVLEALKYDTEVMIEEYIKG----DEITCPIIDGKMLPVLAIKPKGKF 201
             +V+ ++ +  A+  A +Y  EV+IE +I+G    +   C I        +    K +F
Sbjct: 182 VNVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYIEEPNKQEF 241

Query: 202 FDIASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVY----ARVDMLVKDNIPY 257
            D   KY D   ++        L   +E+   E +K L  D++     R D  V +N  Y
Sbjct: 242 LDFKQKYLDFSRNK---APKASLSNALEEQLKENFKKLYSDLFDGAIIRCDFFVIENEVY 298

Query: 258 VLEVNTLPGMTKNSLF 273
           + E+N +PG   N LF
Sbjct: 299 LNEINPIPGSLANYLF 314


>2pvpB [x.x.x] D-ALANINE-D-ALANINE LIGASE
          Length = 315

 Score = 76.3 bits (186), Expect = 1e-16
 Identities = 79/316 (25%), Positives = 133/316 (42%), Gaps = 63/316 (19%)

Query: 1   MKVGVIMGGISSEREISIQSGNSVVHAL-DKDKY-------------------------- 33
           M+  V+ GG S E EISI S  ++   L D+ KY                          
Sbjct: 2   MEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI 61

Query: 34  ---EAIPIVLN-----EKEDLIEKVKGIDFALLALHGKFGEDGTVQSVLKTLGIPFSGCG 85
              +  P++L      +   L  K+  +   +  +HG  GEDG + S+L+   I F G  
Sbjct: 62  KEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR 121

Query: 86  PLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGSSVA 145
             +S +  +K +TK       ++T  + +++  +  +   + N  +P  VKP+N GSS+ 
Sbjct: 122 IEASVLSYNKYLTKLYAKDLGIKTLDYVLLNEKNRANALDLMNFNFPFIVKPSNAGSSLG 181

Query: 146 TTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIA 205
             +V+ ++ +  A+  A +Y  EV+IE +I+G          K   +   K K  F    
Sbjct: 182 VNVVKEEKELIYALDSAFEYSKEVLIEPFIQG---------VKEYNLAGCKIKKDF---- 228

Query: 206 SKYGDGGADEFIVELNE----DLHKEVEKMALETYKLLKCDVY----ARVDMLVKDNIPY 257
                     +I E N+     L   +E+   E +K L  D++     R D  V +N  Y
Sbjct: 229 -------CFSYIEEPNKQPKASLSNALEEQLKENFKKLYSDLFDGAIIRCDFFVIENEVY 281

Query: 258 VLEVNTLPGMTKNSLF 273
           + E+N +PG   N LF
Sbjct: 282 LNEINPIPGSLANYLF 297


>1vkzA [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLAMINE--GLYCINE
           LIGASE
          Length = 384

 Score = 54.7 bits (130), Expect = 3e-10
 Identities = 53/221 (23%), Positives = 103/221 (46%), Gaps = 20/221 (9%)

Query: 85  GPLSSAICMD--KDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNGGS 142
           GP+     ++  K   KR   +G +RTAR+E+  + +E+  EKI+    P  +K +    
Sbjct: 75  GPVKEVARLEGSKVYAKRFKKYG-IRTARFEVAETPEELR-EKIKKFSPPYVIKADGLAR 132

Query: 143 SVATTLVESKEAV-----KDAVLEALK-YDTEVMIEEYIKGDEITCPIIDGKMLPVLAIK 196
                +++SKE       K  + E +K     V+I+E++ G+E++  +++G+   +L   
Sbjct: 133 GKGVLILDSKEETIEKGSKLIIGELIKGVKGPVVIDEFLAGNELSAAVVNGRNFVILPFV 192

Query: 197 PKGKFFDIASKYGDGGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDM----LVK 252
              K  D       GG     VE+  D  K++E++  +T   ++ + YA        L+ 
Sbjct: 193 RDYKRLDGDRGPNTGGGSWGPVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLYLGLLH 252

Query: 253 DNIPYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIE 293
           D  PY+LE N   G       P++   + ++ E  ++ ++E
Sbjct: 253 DGDPYILEYNVRLG------DPETEVIVTLNPEGFVNAVLE 287


>1bxrA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL-PHOSPHATE SYNTHASE
          Length = 1073

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 47/218 (21%), Positives = 96/218 (44%), Gaps = 17/218 (7%)

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L+  G+P  G  P +     D++  +  +    ++      V+++ E+  EK + +GYP+
Sbjct: 654 LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPL 712

Query: 134 FVKPNN--GGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDGKM 189
            V+P+   GG ++     E+          ++  D  V+++ ++    +     I DG+M
Sbjct: 713 VVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFLDDAVEVDVDAICDGEM 772

Query: 190 LPVLAIKPKGKFFDIASKYGDGG----ADEFIVELNEDLHKEVEKMALETYKLLKCDVYA 245
           + +  I    +   + S  GD      A     E+ + + ++V+K+A E    L+     
Sbjct: 773 VLIGGIMEHIEQAGVHS--GDSACSLPAYTLSQEIQDVMRQQVQKLAFE----LQVRGLM 826

Query: 246 RVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMS 283
            V   VK+N  Y++EVN  P   +   F   A G+ ++
Sbjct: 827 NVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGVPLA 862


>1m6vA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL PHOSPHATE SYNTHETASE LARGE CHAIN
          Length = 1059

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 47/216 (21%), Positives = 93/216 (43%), Gaps = 27/216 (12%)

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L+  G+P  G  P +     D++  +  +    ++      V+++ E+  EK + +GYP+
Sbjct: 654 LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPL 712

Query: 134 FVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDGKMLP 191
            V+P+            + E V D       + T V+++ ++    +     I DG+M+ 
Sbjct: 713 VVRPS------------AMEIVYDEADLRRYFQTAVLLDHFLDDAVEVDVDAICDGEMVL 760

Query: 192 VLAIKPKGKFFDIASKYGDGG----ADEFIVELNEDLHKEVEKMALETYKLLKCDVYARV 247
           +  I    +   + S  GD      A     E+ + + ++V+K+A E    L+      V
Sbjct: 761 IGGIMEHIEQAGVHS--GDSACSLPAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNV 814

Query: 248 DMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMS 283
              VK+N  Y++EVN  P   +   F   A G+ ++
Sbjct: 815 QFAVKNNEVYLIEVN--PRAARTVPFVSKATGVPLA 848


>2qk4A [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN
          Length = 420

 Score = 37.7 bits (86), Expect = 4e-05
 Identities = 40/176 (22%), Positives = 77/176 (43%), Gaps = 7/176 (3%)

Query: 14  REISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSV 73
           +++ +  GN+     +K    AI I  +       K K I+F ++           +   
Sbjct: 29  KQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAG--IVGN 86

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L++ G+   G    ++ +   K   K  +    + TA+W+  +  +E     I +  +P 
Sbjct: 87  LRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEA-CSFILSADFPA 145

Query: 134 FVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITC-PIIDGK 188
            V   +G   V   + +SKE    AV E ++ +T ++IEE + G+E++C    DGK
Sbjct: 146 LVVKASGLKGVI--VAKSKEEACKAVQEIMQEET-IVIEELLDGEEVSCLCFTDGK 198


>1ce8A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           PROTEIN (CARBAMOYL-PHOSPHATE SYNTHASE)
          Length = 1058

 Score = 37.7 bits (86), Expect = 4e-05
 Identities = 47/216 (21%), Positives = 92/216 (42%), Gaps = 28/216 (12%)

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L+  G+P  G  P +     D++  +  +    ++      V+++ E+  EK + +GYP+
Sbjct: 654 LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPL 712

Query: 134 FVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDGKMLP 191
            V+P             + E V D       + T V+++ ++    +     I DG+M+ 
Sbjct: 713 VVRP-------------AMEIVYDEADLRRYFQTAVLLDHFLDDAVEVDVDAICDGEMVL 759

Query: 192 VLAIKPKGKFFDIASKYGDGG----ADEFIVELNEDLHKEVEKMALETYKLLKCDVYARV 247
           +  I    +   + S  GD      A     E+ + + ++V+K+A E    L+      V
Sbjct: 760 IGGIMEHIEQAGVHS--GDSACSLPAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNV 813

Query: 248 DMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMS 283
              VK+N  Y++EVN  P   +   F   A G+ ++
Sbjct: 814 QFAVKNNEVYLIEVN--PRAARTVPFVSKATGVPLA 847


>1c30A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
          Length = 1058

 Score = 37.7 bits (86), Expect = 4e-05
 Identities = 47/216 (21%), Positives = 92/216 (42%), Gaps = 28/216 (12%)

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L+  G+P  G  P +     D++  +  +    ++      V+++ E+  EK + +GYP+
Sbjct: 654 LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPL 712

Query: 134 FVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDGKMLP 191
            V+P             + E V D       + T V+++ ++    +     I DG+M+ 
Sbjct: 713 VVRP-------------AMEIVYDEADLRRYFQTAVLLDHFLDDAVEVDVDAICDGEMVL 759

Query: 192 VLAIKPKGKFFDIASKYGDGG----ADEFIVELNEDLHKEVEKMALETYKLLKCDVYARV 247
           +  I    +   + S  GD      A     E+ + + ++V+K+A E    L+      V
Sbjct: 760 IGGIMEHIEQAGVHS--GDSACSLPAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNV 813

Query: 248 DMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMS 283
              VK+N  Y++EVN  P   +   F   A G+ ++
Sbjct: 814 QFAVKNNEVYLIEVN--PRAARTVPFVSKATGVPLA 847


>2qk4B [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN
          Length = 424

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 40/178 (22%), Positives = 78/178 (43%), Gaps = 8/178 (4%)

Query: 14  REISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTVQSV 73
           +++ +  GN+     +K    AI I  +       K K I+F ++           +   
Sbjct: 29  KQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAG--IVGN 86

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L++ G+   G    ++ +   K   K  +    + TA+W+  +  +E     I +  +P 
Sbjct: 87  LRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEA-CSFILSADFPA 145

Query: 134 FVKPNNG--GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITC-PIIDGK 188
            V   +G  G  VA +  E+ +AV++ + E  K    ++IEE + G+E++C    DGK
Sbjct: 146 LVVKASGLAGVIVAKSKEEACKAVQEIMQE--KAGETIVIEELLDGEEVSCLCFTDGK 201


>1jdbK [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL PHOSPHATE SYNTHETASE
          Length = 1060

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 46/214 (21%), Positives = 93/214 (43%), Gaps = 22/214 (10%)

Query: 74  LKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPV 133
           L+  G+P  G  P +     D++  +  +    ++      V+++ E+  EK + +GYP+
Sbjct: 654 LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPL 712

Query: 134 FVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVL 193
            V+P       A  +V  +  ++     A     +  +++ ++ D     I DG+M+ + 
Sbjct: 713 VVRP-------AMEIVYDEADLRRYFQTAAPVLLDHFLDDAVEVD--VDAICDGEMVLIG 763

Query: 194 AIKPKGKFFDIASKYGDGG----ADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDM 249
            I    +   + S  GD      A     E+ + + ++V+K+A E    L+      V  
Sbjct: 764 GIMEHIEQAGVHS--GDSACSLPAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQF 817

Query: 250 LVKDNIPYVLEVNTLPGMTKNSLFPKSAAGINMS 283
            VK+N  Y++EVN  P   +   F   A G+ ++
Sbjct: 818 AVKNNEVYLIEVN--PRAARTVPFVSKATGVPLA 849


>2dzdB [x.x.x] PYRUVATE CARBOXYLASE
          Length = 453

 Score = 33.5 bits (75), Expect = 8e-04
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 130 GYPVFVKPNNGGSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIK 176
           GYP+ +K   GG      +V SK  VK+A   A     EV +E+ I+
Sbjct: 155 GYPIIIKAALGGGGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIE 201


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.139    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 994,870,621
Number of extensions: 42185834
Number of successful extensions: 109008
Number of sequences better than 1.0e-03: 1538
Number of HSP's gapped: 107679
Number of HSP's successfully gapped: 1985
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)