BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81145.1 cper0 asrB.1 GIB00075CH01 "anaerobic sulfite
reductase subunit B"
         (263 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ep1B [b.43.4 - c.25.1] DIHYDROOROTATE DEHYDROGENASE B (PYRK SUB...    70   9e-15
2eixA [x.x.x] NADH-CYTOCHROME B5 REDUCTASE                             68   3e-14
1umkA [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE                   44   4e-07
2rc5C [x.x.x] FERREDOXIN-NADP REDUCTASE                                43   1e-06
1qx4A [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE                   43   1e-06
1i7pA [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE                   43   1e-06
2rc5A [x.x.x] FERREDOXIN-NADP REDUCTASE                                41   3e-06
1ndhA [x.x.x] CYTOCHROME B5 REDUCTASE                                  41   3e-06
1tvcA [b.43.4 - c.25.1] METHANE MONOOXYGENASE COMPONENT C              41   5e-06
2rc5D [x.x.x] FERREDOXIN-NADP REDUCTASE                                41   5e-06
1qfjA [b.43.4 - c.25.1] PROTEIN (FLAVIN REDUCTASE)                     40   6e-06
2rc5B [x.x.x] FERREDOXIN-NADP REDUCTASE                                40   8e-06
1krhA [d.15.4 - b.43.4 - c.25.1] BENZOATE 1,2-DIOXYGENASE REDUCTASE    37   5e-05
1a8pA [x.x.x] NADPH\:FERREDOXIN OXIDOREDUCTASE                         37   5e-05
2b5oA [x.x.x] FERREDOXIN--NADP REDUCTASE                               37   7e-05
2qdxA [x.x.x] FERREDOXIN REDUCTASE                                     37   9e-05
2bmwA [x.x.x] FERREDOXIN--NADP REDUCTASE                               37   9e-05
2vyqA [x.x.x] FERREDOXIN-NADP REDUCTASE                                34   4e-04
1ogiA [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE                    34   4e-04
1h42A [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE                    34   4e-04
1bqeA [b.43.4 - c.25.1] FERREDOXIN--NADP REDUCTASE                     34   4e-04
1gawB [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE                     33   0.001
1gawA [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE                     33   0.001
1gaqA [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE                     33   0.001

>1ep1B [b.43.4 - c.25.1] DIHYDROOROTATE DEHYDROGENASE B (PYRK
           SUBUNIT)
          Length = 261

 Score = 69.7 bits (169), Expect = 9e-15
 Identities = 69/265 (26%), Positives = 114/265 (43%), Gaps = 33/265 (12%)

Query: 9   ISKILNVKKHTDIEYT-FRMEFKGDVK-----PGQFFEVSLPKFG---EAPISVSGIGED 59
           + +++ V    ++ Y  F M  KG +      PGQF  +++P        PIS+S   + 
Sbjct: 3   LQEMMTVVSQREVAYNIFEMVLKGTLVDEMDLPGQFLHLAVPNGAMLLRRPISISSWDKR 62

Query: 60  YVELTIR-RVGVVTNEIFE--KYE-GDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSP 115
               TI  R+G  T   ++  K E G K+ + GP GNGF V      +           P
Sbjct: 63  AKTCTILYRIGDETTGTYKLSKLESGAKVDVMGPLGNGFPVAEVTSTDKXXXXXXXXXVP 122

Query: 116 VKGIVDYFSQNPKDAESFTLISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNT 175
              + +   Q  K     T++ GF      + +++     KN+ + I  D    G +G+ 
Sbjct: 123 P--LYELAKQLEKTGCQMTILLGFASENVKILENEFSNL-KNVTLKIATDDGSYGTKGHV 179

Query: 176 GLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLEFLKRGIKEENIWISQERKMCCGLGK 235
           G++   I      D +   +   G P M+K       K+  + E ++IS E +M CG+G 
Sbjct: 180 GMLMNEI------DFEVDALYTCGAPAMLKAVA----KKYDQLERLYISMESRMACGIGA 229

Query: 236 CGHC----KIDDTY---ICLDGPVF 253
           C  C    K D+++   +C DGPVF
Sbjct: 230 CYACVEHDKEDESHALKVCEDGPVF 254


>2eixA [x.x.x] NADH-CYTOCHROME B5 REDUCTASE
          Length = 243

 Score = 67.8 bits (164), Expect = 3e-14
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 17/218 (7%)

Query: 3   NEYTPFISKILNVKKHTDIEYTFRMEFKGDVKP---GQFFEVSLPKFGE------APISV 53
           NEY  F+ +   +  H    + F +    DV     GQ   V     G+       P+S 
Sbjct: 9   NEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATVDGKEIYRPYTPVS- 67

Query: 54  SGIGEDYVELTIR--RVGVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGT 111
           S   + Y +L I+    G ++  I     GD L +RGP G  FD      KE+ ++AGGT
Sbjct: 68  SDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQ-FDYKPNMVKEMGMIAGGT 126

Query: 112 GLSPVKGIVDYFSQNPKDAESFTLISGFKGPKDILFK---DDMKEWEKNMNMIITVDSAE 168
           G++P+  +     +NPK+     LI       DIL +   DDM +   N  +   +++  
Sbjct: 127 GITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKKYSNFKVYYVLNNPP 186

Query: 169 EGYEGNTGLVT-KYIPELEIKDMDNVQVIVVGPPMMMK 205
            G+ G  G V+   I +       +++V++ GPPMM K
Sbjct: 187 AGWTGGVGFVSADMIKQHFSPPSSDIKVMMCGPPMMNK 224


>1umkA [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
          Length = 271

 Score = 44.3 bits (103), Expect = 4e-07
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 24/151 (15%)

Query: 81  GDKLFLRGPYGNGFDVNNYKGKEVI-----------------VVAGGTGLSPVKGIVDYF 123
           GD +  RGP  +G  V   KGK  I                 ++AGGTG++P+  ++   
Sbjct: 107 GDTIEFRGP--SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAI 164

Query: 124 SQNPKDAESFTLISGFKGPKDILFKDDMKEWEK----NMNMIITVDSAEEGYEGNTGLVT 179
            ++P D     L+   +  KDIL + +++E          +  T+D A E ++   G V 
Sbjct: 165 MKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVN 224

Query: 180 -KYIPELEIKDMDNVQVIVVGPPMMMKFTVL 209
            + I +          V++ GPP M+++  L
Sbjct: 225 EEMIRDHLXXXXXXXLVLMCGPPPMIQYACL 255


>2rc5C [x.x.x] FERREDOXIN-NADP REDUCTASE
          Length = 304

 Score = 42.7 bits (99), Expect = 1e-06
 Identities = 43/189 (22%), Positives = 84/189 (44%), Gaps = 38/189 (20%)

Query: 16  KKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRR-------- 67
           KK  D+ YT R+           + ++ P +        G+ ED +E  I+R        
Sbjct: 74  KKAKDVGYTVRL-----------YSIASPSYS------FGMKEDNIEFIIKRDNIYDENG 116

Query: 68  ----VGVVTNEIFEKYEGDKLFLRGPYGNGFDVNN--YKGKEVIVVAGGTGLSPVKGIVD 121
                GV +N + +   GD++ + GP G  F + N  + G +++ +A GTG++P  G+ +
Sbjct: 117 NIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSG-DIMFLATGTGIAPFIGMSE 175

Query: 122 YFSQNP--KDAESFTLISGFKGPKDILFKDDMKEWE---KNMNMIITVDSAEE-GYEGNT 175
              ++   K   + TL+ G     +++  D +K  E   KN  +I  +   E+  ++G  
Sbjct: 176 ELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGR 235

Query: 176 GLVTKYIPE 184
             ++  + E
Sbjct: 236 MYISHRVRE 244


>1qx4A [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
          Length = 264

 Score = 42.7 bits (99), Expect = 1e-06
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 32/160 (20%)

Query: 81  GDKLFLRGPYGNGFDVNNYKGKEVI-----------------VVAGGTGLSPVKGIVDYF 123
           GD +  RGP  NG  V   KGK  I                 ++AGGTG++P+  ++   
Sbjct: 100 GDTIEFRGP--NGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAV 157

Query: 124 SQNPKDAESFTLISGFKGPKDILFKDDMKEW----EKNMNMIITVDSAEEGYEGNTGLVT 179
            ++P D     L+   +  KDI                  +  TVD A + ++ + G   
Sbjct: 158 LKDPNDHTVCYLLFANQSEKDIXXXXXXXXXXXXHSSRFKLWYTVDKAPDAWDYSQG--- 214

Query: 180 KYIPELEIKDM-----DNVQVIVVGPPMMMKFTVLEFLKR 214
            ++ E  I+D      +   +++ GPP M++F  L  L+R
Sbjct: 215 -FVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLER 253


>1i7pA [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
          Length = 272

 Score = 42.7 bits (99), Expect = 1e-06
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 32/160 (20%)

Query: 81  GDKLFLRGPYGNGFDVNNYKGKEVI-----------------VVAGGTGLSPVKGIVDYF 123
           GD +  RGP  NG  V   KGK  I                 ++AGGTG++P+  ++   
Sbjct: 108 GDTIEFRGP--NGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAV 165

Query: 124 SQNPKDAESFTLISGFKGPKDILFKDDMKEW----EKNMNMIITVDSAEEGYEGNTGLVT 179
            ++P D     L+   +  KDI                  +  TVD A + ++ + G   
Sbjct: 166 LKDPNDHTVCYLLFANQSEKDIXXXXXXXXXXXXHSSRFKLWYTVDKAPDAWDYSQG--- 222

Query: 180 KYIPELEIKDM-----DNVQVIVVGPPMMMKFTVLEFLKR 214
            ++ E  I+D      +   +++ GPP M++F  L  L+R
Sbjct: 223 -FVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLER 261


>2rc5A [x.x.x] FERREDOXIN-NADP REDUCTASE
          Length = 306

 Score = 41.2 bits (95), Expect = 3e-06
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 19/148 (12%)

Query: 55  GIGEDYVELTIRR----------VGVVTNEIFEKYEGDKLFLRGPYGNGFDVNN--YKGK 102
           G+ ED +E  I+R           GV +N + +   GD++ + GP G  F + N  + G 
Sbjct: 100 GMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSG- 158

Query: 103 EVIVVAGGTGLSPVKGIVDYFSQNP--KDAESFTLISGFKGPKDILFKDDMKEWE---KN 157
           +++ +A GTG++P  G+ +   ++   K   + TL+ G     +++  D +K  E   KN
Sbjct: 159 DIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKN 218

Query: 158 MNMIITVDSAEE-GYEGNTGLVTKYIPE 184
             +I  +   E+  ++G    ++  + E
Sbjct: 219 FKLITAISREEKNSFDGGRMYISHRVRE 246


>1ndhA [x.x.x] CYTOCHROME B5 REDUCTASE
          Length = 270

 Score = 41.2 bits (95), Expect = 3e-06
 Identities = 40/156 (25%), Positives = 64/156 (41%), Gaps = 24/156 (15%)

Query: 81  GDKLFLRGPYGNGFDVNNYKGKEVI-----------------VVAGGTGLSPVKGIVDYF 123
           GD +  RGP  NG  V   KGK  I                 ++AGGTG++P+  ++   
Sbjct: 106 GDTIEFRGP--NGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAI 163

Query: 124 SQNPKDAESFTLISGFKGPKDILFKDDMKEW----EKNMNMIITVDSAEEGYEGNTGLVT 179
            ++P D     L+   +  KDI                  +  TVD A E ++ + G V 
Sbjct: 164 MKDPDDHTVCHLLFANQTEKDIXXXXXXXXXXXXHSARFKLWYTVDRAPEAWDYSQGFVN 223

Query: 180 -KYIPELEIKDMDNVQVIVVGPPMMMKFTVLEFLKR 214
            + I +          V++ GPP M+++  L  L+R
Sbjct: 224 EEMIRDHLXXXXXXXLVLMCGPPPMIQYACLPNLER 259


>1tvcA [b.43.4 - c.25.1] METHANE MONOOXYGENASE COMPONENT C
          Length = 250

 Score = 40.8 bits (94), Expect = 5e-06
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 21/206 (10%)

Query: 34  KPGQFFEVSLP----KFGEAPISVSGIGEDYVELTIRRVGVVTNEIFEKY------EGDK 83
           +PGQF ++++P        +P ++    E  +E  IR   V+    F  Y       G  
Sbjct: 45  EPGQFMDLTIPGTDVSRSYSPANLPN-PEGRLEFLIR---VLPEGRFSDYLRNDARVGQV 100

Query: 84  LFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFKGPK 143
           L ++GP G  F +          VAGGTGL+PV  +V    +     E+  +  G     
Sbjct: 101 LSVKGPLGV-FGLKERGMAPRYFVAGGTGLAPVVSMVRQMQEWTAPNET-RIYFGVNTEP 158

Query: 144 DILFKDDMKEWEKNMNMIIT---VDSAEEGYEGNTGLVTKYIPE-LEIKDMDNVQVIVVG 199
           ++ + D++K  E++M  +     V      +EG  G     + E LE  D  N  + + G
Sbjct: 159 ELFYIDELKSLERSMRNLTVKACVWHPSGDWEGEQGSPIDALREDLESSDA-NPDIYLCG 217

Query: 200 PPMMMKFTVLEFLKRGIKEENIWISQ 225
           PP M+         RGI  E ++  +
Sbjct: 218 PPGMIDAACELVRSRGIPGEQVFFEK 243


>2rc5D [x.x.x] FERREDOXIN-NADP REDUCTASE
          Length = 306

 Score = 40.8 bits (94), Expect = 5e-06
 Identities = 37/153 (24%), Positives = 72/153 (47%), Gaps = 21/153 (13%)

Query: 52  SVSGIGEDYVELTIRR------------VGVVTNEIFEKYEGDKLFLRGPYGNGFDVNN- 98
           S  G+ ED +E  I+R             GV +N + +   GD++ + GP G  F + N 
Sbjct: 95  SYFGMKEDNIEFIIKRDNIYDENGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNT 154

Query: 99  -YKGKEVIVVAGGTGLSPVKGIVDYFSQNP--KDAESFTLISGFKGPKDILFKDDMKEWE 155
            + G +++ +A GTG++P  G+ +   ++   K   + TL+ G     +++  D +K  E
Sbjct: 155 DFSG-DIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLE 213

Query: 156 ---KNMNMIITVDSAEE-GYEGNTGLVTKYIPE 184
              KN  +I  +   E+  ++G    ++  + E
Sbjct: 214 SKHKNFKLITAISREEKNSFDGGRMYISHRVRE 246


>1qfjA [b.43.4 - c.25.1] PROTEIN (FLAVIN REDUCTASE)
          Length = 226

 Score = 40.4 bits (93), Expect = 6e-06
 Identities = 39/181 (21%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 6   TPFISKILNVKKHTDIEYTFRM--EFKGDVKPGQFFEVSLPKFGEAPISVSGIGED--YV 61
           T    K+ +V+  TD  Y  R+  +     + GQ+  V + +  + P S++   ++  ++
Sbjct: 1   TTLSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEKGFI 60

Query: 62  ELTIRRVGVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGI-V 120
           EL I     V + I + ++   + +  P+G  + + + + + +I++AGGTG S  + I +
Sbjct: 61  ELHIGYAKAVMDRILKDHQ---IVVDIPHGEAW-LRDDEERPMILIAGGTGFSYARSILL 116

Query: 121 DYFSQNPKDAESFTLISGFKGPK---DILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGL 177
              ++NP      T+  G +  +   D+   + +      + ++  V+  E G+ G TG 
Sbjct: 117 TALARNPN--RDITIYWGGREEQHLYDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTGT 174

Query: 178 V 178
           V
Sbjct: 175 V 175


>2rc5B [x.x.x] FERREDOXIN-NADP REDUCTASE
          Length = 301

 Score = 40.0 bits (92), Expect = 8e-06
 Identities = 42/189 (22%), Positives = 83/189 (43%), Gaps = 41/189 (21%)

Query: 16  KKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRR-------- 67
           KK  D+ YT R+           + ++ P +         + ED +E  I+R        
Sbjct: 74  KKAKDVGYTVRL-----------YSIASPSY---------MKEDNIEFIIKRDNIYDENG 113

Query: 68  ----VGVVTNEIFEKYEGDKLFLRGPYGNGFDVNN--YKGKEVIVVAGGTGLSPVKGIVD 121
                GV +N + +   GD++ + GP G  F + N  + G +++ +A GTG++P  G+ +
Sbjct: 114 NIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSG-DIMFLATGTGIAPFIGMSE 172

Query: 122 YFSQNP--KDAESFTLISGFKGPKDILFKDDMKEWE---KNMNMIITVDSAEE-GYEGNT 175
              ++   K   + TL+ G     +++  D +K  E   KN  +I  +   E+  ++G  
Sbjct: 173 ELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGR 232

Query: 176 GLVTKYIPE 184
             ++  + E
Sbjct: 233 MYISHRVRE 241


>1krhA [d.15.4 - b.43.4 - c.25.1] BENZOATE 1,2-DIOXYGENASE REDUCTASE
          Length = 337

 Score = 37.4 bits (85), Expect = 5e-05
 Identities = 35/142 (24%), Positives = 66/142 (46%), Gaps = 6/142 (4%)

Query: 81  GDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK 140
           GDK+   GP+G+ F + + K + V+++AGGTG++P   ++    Q   +     L+ G  
Sbjct: 191 GDKMSFTGPFGS-FYLRDVK-RPVLMLAGGTGIAPFLSMLQVLEQKGSE-HPVRLVFGVT 247

Query: 141 GPKDILFKDDMKEWEKNMNMI--ITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVV 198
              D++  + +   ++ +      TV +  E      G VT +I E +  +   V V + 
Sbjct: 248 QDCDLVALEQLDALQQKLPWFEYRTVVAHAESQHERKGYVTGHI-EYDWLNGGEVDVYLC 306

Query: 199 GPPMMMKFTVLEFLKRGIKEEN 220
           GP  M++        +GI+  N
Sbjct: 307 GPVPMVEAVRSWLDTQGIQPAN 328


>1a8pA [x.x.x] NADPH\:FERREDOXIN OXIDOREDUCTASE
          Length = 257

 Score = 37.4 bits (85), Expect = 5e-05
 Identities = 37/157 (23%), Positives = 73/157 (46%), Gaps = 16/157 (10%)

Query: 9   ISKILNVKKHTDIEYTFRMEFKGDVK--PGQFFEVSLPKFGEAPISVSGIG----EDYVE 62
           + ++L+V    D  ++F+      ++   GQF  + L   G   +    I     E+++E
Sbjct: 5   VERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYEEHLE 64

Query: 63  LTIRRV--GVVTNEIFEKYEGDKLFL-RGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGI 119
               +V  G +T+ +    EGD+L + R P G     +   GK + +++ GTGL+P   +
Sbjct: 65  FFSIKVQNGPLTSRLQHLKEGDELMVSRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSL 124

Query: 120 VDYFSQNPKDAESF---TLISGFKGPKDILFKDDMKE 153
           +    Q+P+  E F    LI G +   ++ ++  + E
Sbjct: 125 I----QDPEVYERFEKVVLIHGVRQVNELAYQQFITE 157


>2b5oA [x.x.x] FERREDOXIN--NADP REDUCTASE
          Length = 292

 Score = 37.0 bits (84), Expect = 7e-05
 Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 26/167 (15%)

Query: 82  DKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIV-DYFSQNPKDAE---SFTLIS 137
           D + + GP G    + + +   V+++A GTG++P +  +   F +  +D +      LI 
Sbjct: 121 DDVKITGPVGKEMLLPDDEDATVVMLATGTGIAPFRAFLWRMFKEQHEDYKFKGKAWLIF 180

Query: 138 GFKGPKDILFKDDMK----EWEKNMNMIITVDSAEEGYEGN----TGLVTKYIPEL-EIK 188
           G     +IL+KDD +    E   N  +   +   ++  +G        V++Y  EL E+ 
Sbjct: 181 GVPYTANILYKDDFEKMAAENPDNFRLTYAISREQKTADGGKVYVQSRVSEYADELFEMI 240

Query: 189 DMDNVQVIVVG-----PPMMMKFTV--------LEFLKRGIKEENIW 222
              N  V + G     PP+   FT          E ++R +K+E+ W
Sbjct: 241 QKPNTHVYMCGLKGMQPPIDETFTAEAEKRGLNWEEMRRSMKKEHRW 287


>2qdxA [x.x.x] FERREDOXIN REDUCTASE
          Length = 257

 Score = 36.6 bits (83), Expect = 9e-05
 Identities = 35/154 (22%), Positives = 71/154 (46%), Gaps = 16/154 (10%)

Query: 8   FISKILNVKKHTDIEYTFRMEFKGDV--KPGQFFEVSLPKFGEAPISVSGIG----EDYV 61
           +  ++L+V    D  ++F+      +  K GQF  + L   G   +    I     E+++
Sbjct: 4   YTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHL 63

Query: 62  ELTIRRV--GVVTNEIFEKYEGDKLFL-RGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKG 118
           E    +V  G +T+ +    EGD+L + R P G     +   GK + +++ GTG++P   
Sbjct: 64  EFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLS 123

Query: 119 IVDYFSQNPKDAESF---TLISGFKGPKDILFKD 149
           ++    Q+P+  E +    L+ G +   ++ + D
Sbjct: 124 VI----QDPETYERYEKVILVHGVRWVSELAYAD 153


>2bmwA [x.x.x] FERREDOXIN--NADP REDUCTASE
          Length = 295

 Score = 36.6 bits (83), Expect = 9e-05
 Identities = 35/181 (19%), Positives = 71/181 (39%), Gaps = 23/181 (12%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +  +     G ++ + GP G    + +     VI++AGGTG++P++    Y  +  K
Sbjct: 107 GVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFK 163

Query: 129 DAESFT-----------LISGFKGPKDILFKDDMKE----WEKNMNMIITVDSAEEGYEG 173
           DAE              L+ G     +IL+K++++E    +  N  +   +   ++  +G
Sbjct: 164 DAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQG 223

Query: 174 NTGLVTKYIPE-----LEIKDMDNVQVIVVGPPMMMKFTVLEFLKRGIKEENIWISQERK 228
               +   + E      ++         + GPP M +           KE   W   ++ 
Sbjct: 224 GRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKD 283

Query: 229 M 229
           +
Sbjct: 284 L 284


>2vyqA [x.x.x] FERREDOXIN-NADP REDUCTASE
          Length = 295

 Score = 34.3 bits (77), Expect = 4e-04
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +  +     G ++ + GP G    + +     VI++AGGTG++P++    Y  +  K
Sbjct: 107 GVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFK 163

Query: 129 DAESFT-----------LISGFKGPKDILFKDDMKE----WEKNMNMIITVDSAEEGYEG 173
           DAE              L+ G     +IL+K++++E    +  N  +   +   ++  +G
Sbjct: 164 DAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQG 223

Query: 174 NTGLVTKYIPE 184
               +   + E
Sbjct: 224 GRMYIQDRVAE 234


>1ogiA [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE
          Length = 295

 Score = 34.3 bits (77), Expect = 4e-04
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +  +     G ++ + GP G    + +     VI++AGGTG++P++    Y  +  K
Sbjct: 107 GVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFK 163

Query: 129 DAESFT-----------LISGFKGPKDILFKDDMKE----WEKNMNMIITVDSAEEGYEG 173
           DAE              L+ G     +IL+K++++E    +  N  +   +   ++  +G
Sbjct: 164 DAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQG 223

Query: 174 NTGLVTKYIPE 184
               +   + E
Sbjct: 224 GRMYIQDRVAE 234


>1h42A [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE
          Length = 295

 Score = 34.3 bits (77), Expect = 4e-04
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +  +     G ++ + GP G    + +     VI++AGGTG++P++    Y  +  K
Sbjct: 107 GVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFK 163

Query: 129 DAESFT-----------LISGFKGPKDILFKDDMKE----WEKNMNMIITVDSAEEGYEG 173
           DAE              L+ G     +IL+K++++E    +  N  +   +   ++  +G
Sbjct: 164 DAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQG 223

Query: 174 NTGLVTKYIPE 184
               +   + E
Sbjct: 224 GRMYIQDRVAE 234


>1bqeA [b.43.4 - c.25.1] FERREDOXIN--NADP REDUCTASE
          Length = 295

 Score = 34.3 bits (77), Expect = 4e-04
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +  +     G ++ + GP G    + +     VI++AGGTG++P++    Y  +  K
Sbjct: 107 GVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGIAPMR---TYLWRMFK 163

Query: 129 DAESFT-----------LISGFKGPKDILFKDDMKE----WEKNMNMIITVDSAEEGYEG 173
           DAE              L+ G     +IL+K++++E    +  N  +   +   ++  +G
Sbjct: 164 DAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQG 223

Query: 174 NTGLVTKYIPE 184
               +   + E
Sbjct: 224 GRMYIQDRVAE 234


>1gawB [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
          Length = 305

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 4/118 (3%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +N + +   GD + + GP G    +       +I++A GTG++P +  +        
Sbjct: 121 GVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKH 180

Query: 129 DAESFT----LISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYI 182
           D   F     L  G      +L+K++  + ++       VD A    + N      YI
Sbjct: 181 DDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI 238


>1gawA [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
          Length = 304

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 4/118 (3%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +N + +   GD + + GP G    +       +I++A GTG++P +  +        
Sbjct: 120 GVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKH 179

Query: 129 DAESFT----LISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYI 182
           D   F     L  G      +L+K++  + ++       VD A    + N      YI
Sbjct: 180 DDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI 237


>1gaqA [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
          Length = 296

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 4/118 (3%)

Query: 69  GVVTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPK 128
           GV +N + +   GD + + GP G    +       +I++A GTG++P +  +        
Sbjct: 112 GVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKH 171

Query: 129 DAESFT----LISGFKGPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYI 182
           D   F     L  G      +L+K++  + ++       VD A    + N      YI
Sbjct: 172 DDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI 229


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.139    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 877,514,893
Number of extensions: 37068958
Number of successful extensions: 100389
Number of sequences better than 1.0e-03: 1394
Number of HSP's gapped: 99463
Number of HSP's successfully gapped: 1803
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)