BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81490.1 cper0 nifU GIB00075CH01 "probable nitrogen fixation
protein"
         (142 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2z7eC [x.x.x] NIFU-LIKE PROTEIN                                       144   1e-37
2z7eB [x.x.x] NIFU-LIKE PROTEIN                                       144   1e-37
2z7eA [x.x.x] NIFU-LIKE PROTEIN                                       144   1e-37
1q48A [d.224.1] NIFU-LIKE PROTEIN                                     134   2e-34
1wfzA [d.224.1] NITROGEN FIXATION CLUSTER-LIKE                        115   1e-28
1xjsA [d.224.1] NIFU-LIKE PROTEIN                                      87   3e-20
2qq4I [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU            82   1e-18
2qq4F [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU            82   1e-18
2qq4B [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU            82   1e-18
2qq4A [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU            82   1e-18
1su0B [d.224.1] NIFU LIKE PROTEIN ISCU                                 65   9e-14

>2z7eC [x.x.x] NIFU-LIKE PROTEIN
          Length = 137

 Score =  144 bits (364), Expect = 1e-37
 Identities = 67/123 (54%), Positives = 91/123 (73%), Gaps = 2/123 (1%)

Query: 3   YSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKI--ENNIVEDVKFETYGCG 60
           Y+EKV+DHF NPRNVG ++DANG+G+ GN  CG  M   +K+  EN+++EDV+F+T+GCG
Sbjct: 4   YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNPENDVIEDVRFKTFGCG 63

Query: 61  SAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQ 120
           SAIA SSM TE++KGK ++ A  L+ K + E L GLPP K+HC+ L  E +H AI DY  
Sbjct: 64  SAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLM 123

Query: 121 RQG 123
           +QG
Sbjct: 124 KQG 126


>2z7eB [x.x.x] NIFU-LIKE PROTEIN
          Length = 140

 Score =  144 bits (364), Expect = 1e-37
 Identities = 67/123 (54%), Positives = 91/123 (73%), Gaps = 2/123 (1%)

Query: 3   YSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKI--ENNIVEDVKFETYGCG 60
           Y+EKV+DHF NPRNVG ++DANG+G+ GN  CG  M   +K+  EN+++EDV+F+T+GCG
Sbjct: 3   YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNPENDVIEDVRFKTFGCG 62

Query: 61  SAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQ 120
           SAIA SSM TE++KGK ++ A  L+ K + E L GLPP K+HC+ L  E +H AI DY  
Sbjct: 63  SAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLM 122

Query: 121 RQG 123
           +QG
Sbjct: 123 KQG 125


>2z7eA [x.x.x] NIFU-LIKE PROTEIN
          Length = 139

 Score =  144 bits (364), Expect = 1e-37
 Identities = 67/123 (54%), Positives = 91/123 (73%), Gaps = 2/123 (1%)

Query: 3   YSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKI--ENNIVEDVKFETYGCG 60
           Y+EKV+DHF NPRNVG ++DANG+G+ GN  CG  M   +K+  EN+++EDV+F+T+GCG
Sbjct: 5   YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVNPENDVIEDVRFKTFGCG 64

Query: 61  SAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQ 120
           SAIA SSM TE++KGK ++ A  L+ K + E L GLPP K+HC+ L  E +H AI DY  
Sbjct: 65  SAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLM 124

Query: 121 RQG 123
           +QG
Sbjct: 125 KQG 127


>1q48A [d.224.1] NIFU-LIKE PROTEIN
          Length = 134

 Score =  134 bits (337), Expect = 2e-34
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 11/141 (7%)

Query: 1   MIYSEKVMDHFKNPRNVGEI--KDAN-GIGEVGNAKCGDIMRIYLKIENN-IVEDVKFET 56
           M YSEKV+DH++NPRNVG +  KD+N G G VG   CGD+M++ +K+++N I+ED KF+T
Sbjct: 1   MAYSEKVIDHYENPRNVGSLDKKDSNVGTGMVGAPACGDVMQLQIKVDDNGIIEDAKFKT 60

Query: 57  YGCGSAIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAIN 116
           YGCGSAIASSS+ TE +KGK++EEA  + N  +AE L+ LPPVK+HCS+L          
Sbjct: 61  YGCGSAIASSSLITEWVKGKSLEEAGAIKNSQIAEELE-LPPVKVHCSILXXXXXXXXXX 119

Query: 117 DYRQRQGLEPWDMKEHSHDIH 137
                QGL      EH H  H
Sbjct: 120 XXXXXQGL------EHHHHHH 134


>1wfzA [d.224.1] NITROGEN FIXATION CLUSTER-LIKE
          Length = 130

 Score =  115 bits (287), Expect = 1e-28
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 5/115 (4%)

Query: 12  KNPRNVGEIKDAN---GIGEVGNAKCGDIMRIYLKI-ENNIVEDVKFETYGCGSAIASSS 67
           +NPRNVG +   +   G G VG   CGD+M++ +++ E   + D +F+T+GCGSAIASSS
Sbjct: 8   ENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSS 67

Query: 68  MATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQ 122
           +ATE +KGKTVEEA  + N  +A+ L  LPPVK+HCS+LAE+AI  A+ DY+ +Q
Sbjct: 68  LATEWVKGKTVEEALTIKNTDIAKEL-CLPPVKLHCSMLAEDAIKAALADYKLKQ 121


>1xjsA [d.224.1] NIFU-LIKE PROTEIN
          Length = 147

 Score = 87.0 bits (214), Expect = 3e-20
 Identities = 47/132 (35%), Positives = 77/132 (58%), Gaps = 19/132 (14%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y + +MDH+KNPRN G + D+  + ++ N  CGD +R+ +K++ +IVED KFE  GC  
Sbjct: 10  LYRQVIMDHYKNPRNKGVLNDSIVV-DMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSI 68

Query: 62  AIASSSMATELIKGKTVEEAWELS----------------NKAVAEALDGLP--PVKMHC 103
           ++AS+SM T+ IKGK +E A  +S                +    EAL G+   P ++ C
Sbjct: 69  SMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVSKFPARIKC 128

Query: 104 SVLAEEAIHKAI 115
           + L+ +A+ K +
Sbjct: 129 ATLSWKALEKGV 140


>2qq4I [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
          Length = 134

 Score = 81.6 bits (200), Expect = 1e-18
 Identities = 40/112 (35%), Positives = 65/112 (58%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y E ++DH+++PRN G +  A       N  CGD + + + +E + + D++F+  GC  
Sbjct: 3   LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAI 62

Query: 62  AIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHK 113
           + AS+S+ TE +KGK V EA ELS K  A  ++G PP      +LA + + K
Sbjct: 63  STASASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK 114


>2qq4F [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
          Length = 136

 Score = 81.6 bits (200), Expect = 1e-18
 Identities = 40/112 (35%), Positives = 65/112 (58%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y E ++DH+++PRN G +  A       N  CGD + + + +E + + D++F+  GC  
Sbjct: 5   LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAI 64

Query: 62  AIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHK 113
           + AS+S+ TE +KGK V EA ELS K  A  ++G PP      +LA + + K
Sbjct: 65  STASASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK 116


>2qq4B [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
          Length = 137

 Score = 81.6 bits (200), Expect = 1e-18
 Identities = 40/112 (35%), Positives = 65/112 (58%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y E ++DH+++PRN G +  A       N  CGD + + + +E + + D++F+  GC  
Sbjct: 6   LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAI 65

Query: 62  AIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHK 113
           + AS+S+ TE +KGK V EA ELS K  A  ++G PP      +LA + + K
Sbjct: 66  STASASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK 117


>2qq4A [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
          Length = 138

 Score = 81.6 bits (200), Expect = 1e-18
 Identities = 40/112 (35%), Positives = 65/112 (58%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y E ++DH+++PRN G +  A       N  CGD + + + +E + + D++F+  GC  
Sbjct: 7   LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAI 66

Query: 62  AIASSSMATELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHK 113
           + AS+S+ TE +KGK V EA ELS K  A  ++G PP      +LA + + K
Sbjct: 67  STASASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK 118


>1su0B [d.224.1] NIFU LIKE PROTEIN ISCU
          Length = 136

 Score = 65.5 bits (158), Expect = 9e-14
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 19/132 (14%)

Query: 2   IYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGS 61
           +Y   V DH K P + G++     + ++ N  CGD++ + +K + + +ED+ F   GC  
Sbjct: 4   LYMAVVADHSKRPHHHGQLDGVEAV-QLNNPTCGDVISLTVKFDEDKIEDIAFAGNGCTI 62

Query: 62  AIASSSMATELIKGKTVEEAWELSN----------------KAVAEALDGLP--PVKMHC 103
           + ASSSM T+ + GK+ EEA  L++                   AE L G+   P ++ C
Sbjct: 63  STASSSMMTDAVIGKSKEEALALADIFSEMVQGQENPAQKELGEAELLAGVAKFPQRIKC 122

Query: 104 SVLAEEAIHKAI 115
           S LA  A+ +AI
Sbjct: 123 STLAWNALKEAI 134


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.136    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 857,086,052
Number of extensions: 36395906
Number of successful extensions: 94750
Number of sequences better than 1.0e-03: 1300
Number of HSP's gapped: 93921
Number of HSP's successfully gapped: 1457
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)