BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81544.1 cper0 CPE1838 GIB00075CH01 "hypothetical protein"
         (216 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1xipA [b.69.14] NUCLEOPORIN NUP159                                     33   6e-04

>1xipA [b.69.14] NUCLEOPORIN NUP159
          Length = 364

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 37/132 (28%), Positives = 62/132 (46%), Gaps = 25/132 (18%)

Query: 66  QLIRDRFFN-YTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKD-FSLTFPELKN- 122
           QL+RD   +  TPL      K+ K +  +++   C    + L+  R   +SL   EL   
Sbjct: 65  QLLRDHITSDSTPLT----FKWEKEIPDVIFV--CFHGDQVLVSTRNALYSLDLEELSEF 118

Query: 123 KNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKD--------- 173
           + + SF+K  F+LKN      +   LV+L SV D + +++  +S K L ++         
Sbjct: 119 RTVTSFEKPVFQLKN------VNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNS 172

Query: 174 -FGVSLKDFTFK 184
              V LKD +F+
Sbjct: 173 QLAVLLKDRSFQ 184


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.136    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 857,086,052
Number of extensions: 36395906
Number of successful extensions: 94750
Number of sequences better than 1.0e-03: 1300
Number of HSP's gapped: 93921
Number of HSP's successfully gapped: 1457
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)