BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81560.1 cper0 CPE1854 GIB00075CH01 "conserved hypothetical
protein"
         (219 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1w8gA [x.x.x] HYPOTHETICAL UPF0001 PROTEIN YGGS                       100   7e-24
1b54A [x.x.x] YEAST HYPOTHETICAL PROTEIN                               88   3e-20
1ct5A [c.1.6] PROTEIN (YEAST HYPOTHETICAL PROTEIN, SELENOMET)          76   1e-16
3cpgA [x.x.x] UNCHARACTERIZED PROTEIN                                  64   3e-13

>1w8gA [x.x.x] HYPOTHETICAL UPF0001 PROTEIN YGGS
          Length = 226

 Score = 99.8 bits (247), Expect = 7e-24
 Identities = 83/227 (36%), Positives = 111/227 (48%), Gaps = 16/227 (7%)

Query: 2   DIKENLTKFTEKI----------PSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEI 51
           DI  NL +  +KI          P  + L+AVSKT+    + EA + G R+FGEN VQE 
Sbjct: 1   DIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEG 60

Query: 52  IRKFDEFHQ----DVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKI 107
           + K   F +     +EWH IG LQ+NK + + +      ++D +++   +          
Sbjct: 61  VDKIRHFQELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPP 120

Query: 108 ANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXCNNVNVLGIMTIIPKGTEEECRKYFSKT 167
            N LIQ+NI  E  K G                  + + G+M I     E E  + F   
Sbjct: 121 LNVLIQINISDENSKSGIQXXXXXXXXXXXXXXPRLRLRGLMAI--PAPESEYVRQFEVA 178

Query: 168 HXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQGIFG 214
                           +D LS+GMS D E A   GS MVRIG  IFG
Sbjct: 179 RQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFG 225


>1b54A [x.x.x] YEAST HYPOTHETICAL PROTEIN
          Length = 230

 Score = 87.8 bits (216), Expect = 3e-20
 Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 16/192 (8%)

Query: 31  EMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYI--VDKVHLIQSL 88
           +++  Y+ G+R+FGEN VQE+I K      D++WH IG LQTNK K +  V  ++ ++++
Sbjct: 47  DIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGLQTNKCKDLAKVPNLYSVETI 106

Query: 89  DSIKLLKEIEKVYGKHNKIANTL---IQVNIGREEQKYG---XXXXXXXXXXXXXXXCNN 142
           DS+K  K++ +   K     N +   +Q+N   E+QK G                  C  
Sbjct: 107 DSLKKAKKLNESRAKFQPDCNPILCNVQINTSHEDQKSGLNNEAEIFEVIDFFLSEECKY 166

Query: 143 VNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEG 202
           + + G+MTI   G+ E   + F+               ++K   LSMGMS D+  A  +G
Sbjct: 167 IKLNGLMTI---GSWE--NRDFATLVEWKKKIDAKFGTSLK---LSMGMSADFREAIRQG 218

Query: 203 SNMVRIGQGIFG 214
           +  VRIG  IFG
Sbjct: 219 TAEVRIGTDIFG 230


>1ct5A [c.1.6] PROTEIN (YEAST HYPOTHETICAL PROTEIN, SELENOMET)
          Length = 225

 Score = 75.9 bits (185), Expect = 1e-16
 Identities = 57/199 (28%), Positives = 91/199 (45%), Gaps = 34/199 (17%)

Query: 31  EMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYI--VDKVHLIQSL 88
           +++  Y+ G+R+FGEN VQE+I K      D++WH IG LQTNK K +  V  ++ ++++
Sbjct: 46  DIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGLQTNKCKDLAKVPNLYSVETI 105

Query: 89  DSIKLLKEIEKVYGKHNKIANTL---IQVNIGREEQKYGXXXXXXXXXXXXXXXCNNVNV 145
           DS+K  K++ +   K     N +   +Q+N   E+QK G                   N 
Sbjct: 106 DSLKKAKKLNESRAKFQPDCNPILCNVQINTSHEDQKSGLN-----------------NE 148

Query: 146 LGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNI-----KMDI-----LSMGMSGDY 195
             I  +I     EEC+  + K +             +     K+D      L +  S D+
Sbjct: 149 AEIFEVIDFFLSEECK--YIKLNGLTIGSWNRDFATLVEWKKKIDAKFGTSLKLSGSADF 206

Query: 196 EIATEEGSNMVRIGQGIFG 214
             A  +G+  VRIG  IFG
Sbjct: 207 REAIRQGTAEVRIGTDIFG 225


>3cpgA [x.x.x] UNCHARACTERIZED PROTEIN
          Length = 247

 Score = 64.3 bits (155), Expect = 3e-13
 Identities = 59/215 (27%), Positives = 94/215 (43%), Gaps = 25/215 (11%)

Query: 17  NVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFH---------------QD 61
           +V+L+A +KTR I E+  A + G+R  GEN+ QE+  K +                  + 
Sbjct: 40  SVRLLAATKTRDIGEIA-AIDAGVR-IGENRPQEVTAKAEGLARRCAERGFSLGVAAAEH 97

Query: 62  VEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQ 121
           + +HLIG LQ+NK+  ++  V  I+S+DSI L ++I +           L++VN   EE 
Sbjct: 98  IPFHLIGQLQSNKIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEVNESGEES 157

Query: 122 KYGXXXXXXXXXXXXXXXCNNVNVLGIMTIIPKGTEEECRKYFS---KTHXXXXXXXXXX 178
           K G                + + + G+        E   R+ FS   KT           
Sbjct: 158 KSGCDPAHAIRIAQKIGTLDGIELQGLTIGAHVHDETVIRRGFSHLRKTRDLILASGEPG 217

Query: 179 XXNIKMDILSMGMSGDYEIATEEGSNMVRIGQGIF 213
               +     +  +GD E+A  EGS +VR+G  IF
Sbjct: 218 TDRCR----ELSGTGD-ELAIAEGSTIVRVGTAIF 247


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.136    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 857,086,052
Number of extensions: 36395906
Number of successful extensions: 94750
Number of sequences better than 1.0e-03: 1300
Number of HSP's gapped: 93921
Number of HSP's successfully gapped: 1457
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)