BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB80734.1 cper0 CPE1028 GIB00075CH01 "conserved hypothetical
protein"
         (113 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y666_PYRAB RecName: Full=UPF0166 protein PYRAB06660;                   59   2e-11
Y1503_PYRHO RecName: Full=UPF0166 protein PH1503;                      59   2e-11
Y1524_METJA RecName: Full=UPF0166 protein MJ1524;                      51   4e-09
Y7045_STRCO RecName: Full=UPF0166 protein SCO7045;                     43   2e-06
Y021_THEMA RecName: Full=UPF0166 protein TM_0021;                      42   3e-06
Y450_AQUAE RecName: Full=UPF0166 protein aq_450;                       40   1e-05

>Y666_PYRAB RecName: Full=UPF0166 protein PYRAB06660;
          Length = 127

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 33/90 (36%), Positives = 48/90 (53%)

Query: 10  LKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLP 69
           L+I+I E+D++ G+PLY  I++ L++  I GATV RGI G     +IHS  +  L+ +LP
Sbjct: 12  LRIYIGENDRWEGKPLYKAIVEKLREMGIAGATVYRGIYGFGKKSRIHSSDVLRLSTDLP 71

Query: 70  XXXXXXXXXXXXXXXXXXXXPMIETGTITV 99
                               PMI+ G ITV
Sbjct: 72  IVIEVVDRGHNIEKAVNVIKPMIKDGMITV 101


>Y1503_PYRHO RecName: Full=UPF0166 protein PH1503;
          Length = 127

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 33/90 (36%), Positives = 47/90 (52%)

Query: 10  LKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLP 69
           L+I+I E+DK+ G PLY  I++ L++  I GATV RGI G     ++HS  +  L+ +LP
Sbjct: 12  LRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKKSRVHSSDVIRLSTDLP 71

Query: 70  XXXXXXXXXXXXXXXXXXXXPMIETGTITV 99
                               PMI+ G ITV
Sbjct: 72  IIVEVVDRGHNIEKVVNVIKPMIKDGMITV 101


>Y1524_METJA RecName: Full=UPF0166 protein MJ1524;
          Length = 108

 Score = 51.2 bits (121), Expect = 4e-09
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 6  KGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILA 65
          K   LKI++ E DK+ GE +Y  I+K+LK+E I GATV +GI G         D    L+
Sbjct: 3  KAKILKIYLREGDKFEGELMYKHIMKILKREGISGATVYKGICGYGVRGVAEFDIFR-LS 61

Query: 66 RNLP 69
           NLP
Sbjct: 62 VNLP 65


>Y7045_STRCO RecName: Full=UPF0166 protein SCO7045;
          Length = 114

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 19/60 (31%), Positives = 35/60 (58%)

Query: 10 LKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLP 69
          L +++ E+D ++  PLY EI+       + GA+V RG+EG  +   +H+  +  L+ +LP
Sbjct: 11 LTVYVGENDTWHHRPLYSEIVHRAHAAGLAGASVFRGVEGFGASSIVHTTRLLSLSEDLP 70


>Y021_THEMA RecName: Full=UPF0166 protein TM_0021;
          Length = 102

 Score = 41.6 bits (96), Expect = 3e-06
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 10 LKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIH-SDFIEILARNL 68
          LKI++ E DK++G+PL+  ++K   +  + G TV RGI G      +H SDF   L+ +L
Sbjct: 4  LKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHKRHMHRSDFFS-LSPDL 62

Query: 69 P 69
          P
Sbjct: 63 P 63


>Y450_AQUAE RecName: Full=UPF0166 protein aq_450;
          Length = 105

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 21/64 (32%), Positives = 32/64 (50%)

Query: 6  KGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILA 65
          K   L+IF  E + + G+P Y  +L+  K+  + GATV R I G     +I    +  L 
Sbjct: 5  KKKLLRIFTSEDESFEGKPFYKYLLERAKERGLEGATVFRAIAGYGKTKEIRKHKLFQLR 64

Query: 66 RNLP 69
           +LP
Sbjct: 65 SSLP 68


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.317    0.137    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,270,757,428
Number of extensions: 391708458
Number of successful extensions: 1074516
Number of sequences better than 1.0e-03: 19341
Number of HSP's gapped: 1054629
Number of HSP's successfully gapped: 21768
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.7 bits)