BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81146.1 cper0 asrA.1 GIB00075CH01 "anaerobic sulfite
reductase subunit A"
         (338 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ASRA_SALTY RecName: Full=Anaerobic sulfite reductase subunit A;A...   280   1e-77
BXCN_CLOBO RecName: Full=Botulinum neurotoxin type C1 nontoxic c...    36   4e-04
HYFH_ECOLI RecName: Full=Hydrogenase-4 component H;                    36   6e-04
EFG_SYNR3 RecName: Full=Elongation factor G;         Short=EF-G;       36   6e-04
Y437_STAAM RecName: Full=Uncharacterized lipoprotein SAV0437;Fla...    35   0.001
Y411_STAA3 RecName: Full=Uncharacterized lipoprotein SAUSA300_04...    35   0.001
Y397_STAAN RecName: Full=Uncharacterized lipoprotein SA0397;Flag...    35   0.001

>ASRA_SALTY RecName: Full=Anaerobic sulfite reductase subunit
           A;AltName: Full=Anaerobic sulfite reductase iron-sulfur
           subunit;
          Length = 347

 Score =  280 bits (717), Expect = 1e-77
 Identities = 141/342 (41%), Positives = 206/342 (60%), Gaps = 10/342 (2%)

Query: 1   MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDF 60
           M +++T D F  +I  L K+++++AP      GRFSDTD   Y  I    D+ + +KS  
Sbjct: 1   MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRDLIWHEKSHM 60

Query: 61  SYKEVLLPITQTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPY- 119
           S   ++ PIT+TLF+F +D    A  +   I+IF R+CD++++ R+D +YL NG    Y 
Sbjct: 61  SPNTIIAPITETLFYFDKDTIQIAETDTSPIIIFARACDINAMSRLDYMYLSNGNNSDYS 120

Query: 120 YKKLREKAKFIVMGCENSFDNCFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFE 179
           Y+ LRE  +F+++ CE SF+NCFCVSMGTNKTD YSA +   ++  L+ I+D  +    +
Sbjct: 121 YQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSDEGALVSIRDPFIEAAIQ 180

Query: 180 AVESNKEEVSPKFVEENETKVEVPEGI--DLNIIKS-----TVWNEYSERCIACGRCNFV 232
            +   + + +P FV EN   V  P+ +  D   I+       +W+ Y  RCI+       
Sbjct: 181 GL-GQEADYTPSFVSENRETVVTPDSVCHDPQKIRDILTHHPLWDAYDSRCISXXXXXXX 239

Query: 233 CPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDKGQRMRFKVMHKV 292
                 +++ DV Y +N   GERRR WASC V G++DMAGGH FR+  G+R+R++ +HKV
Sbjct: 240 XXXXXXYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKPGERLRYRALHKV 299

Query: 293 YDYKKRWGY-HMCVGCGRCDDICPEYISFSECVNKLKDAVEE 333
            DYK R G  HMCVGCGRCDD CP+YI FS  +NK+  AV +
Sbjct: 300 NDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVRQ 341


>BXCN_CLOBO RecName: Full=Botulinum neurotoxin type C1 nontoxic
           component;
          Length = 1196

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 17/154 (11%)

Query: 42  RYGEIDSINDIEFSKKSDFSYKEVLLPITQTLFFFTEDKFSEA--SVEEKNILIFLRSCD 99
           ++ +I SI +  F+ + +   KE+L P  Q L F ++   S     +  KN LI      
Sbjct: 809 KFLDIQSIKNF-FNSQVEQVMKEILSPY-QLLLFASKGPNSNIIEDISGKNTLI------ 860

Query: 100 MHSLRRIDDIYLRNGFEDPYYKKLREKAKF----IVMGCENSFDNCFCVSMGTNKTDEYS 155
                 I+ +Y  NG E  Y K   E  KF       G  N+F  CF +   T K D+ +
Sbjct: 861 -QYTESIELVYGVNG-ESLYLKSPNETIKFSNKFFTNGLTNNFTICFWLRF-TGKNDDKT 917

Query: 156 AYIGLDNDEVLLDIKDEELSKIFEAVESNKEEVS 189
             IG   +    +I  E+   +FE ++SN  + S
Sbjct: 918 RLIGNKVNNCGWEIYFEDNGLVFEIIDSNGNQES 951


>HYFH_ECOLI RecName: Full=Hydrogenase-4 component H;
          Length = 181

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 14/23 (60%), Positives = 14/23 (60%)

Query: 213 STVWNEYSERCIACGRCNFVCPT 235
           S  W  Y  RCI CGRC  VCPT
Sbjct: 65  SRTWQLYLGRCIYCGRCEEVCPT 87


>EFG_SYNR3 RecName: Full=Elongation factor G;         Short=EF-G;
          Length = 691

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 122 KLREKAKFIVMGCENSFDNCFCVSMGTNKTDEYSAYIGLDNDEVLL--DIKDEEL---SK 176
           +L+ KA  I +      D    + +  NK   Y   +G D +E  +  D+ DE     +K
Sbjct: 154 RLKAKAAPIQLPIGAEGDLSGIIDLVANKAYIYKNDLGTDIEEAEIPADMADEAAEWRAK 213

Query: 177 IFEAVESNKEEVSPKFVEENE-TKVEVPEGIDLNIIK 212
           + E+V  N EE+  KF+E  E T+ E+ +GI   ++K
Sbjct: 214 LMESVAENDEELIEKFLETGELTEAELKKGIRDGVLK 250


>Y437_STAAM RecName: Full=Uncharacterized lipoprotein SAV0437;Flags:
           Precursor;
          Length = 264

 Score = 35.0 bits (79), Expect = 0.001
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 77  TEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKK 122
           T +K  E S EE+    F ++ DM+ ++ ++D+Y + G+ D  +KK
Sbjct: 29  TAEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKK 74


>Y411_STAA3 RecName: Full=Uncharacterized lipoprotein
           SAUSA300_0411;Flags: Precursor;
          Length = 266

 Score = 35.0 bits (79), Expect = 0.001
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 77  TEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKK 122
           T +K  E S EE+    F ++ DM+ ++ ++D+Y + G+ D  +KK
Sbjct: 29  TGEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDSEFKK 74


>Y397_STAAN RecName: Full=Uncharacterized lipoprotein SA0397;Flags:
           Precursor;
          Length = 264

 Score = 35.0 bits (79), Expect = 0.001
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 77  TEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKK 122
           T +K  E S EE+    F ++ DM+ ++ ++D+Y + G+ D  +KK
Sbjct: 29  TAEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKK 74


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.319    0.139    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,223,791,418
Number of extensions: 385661437
Number of successful extensions: 1142820
Number of sequences better than 1.0e-03: 21546
Number of HSP's gapped: 1122896
Number of HSP's successfully gapped: 30427
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)