BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81626.1 cper0 CPE1920 GIB00075CH01 "hypothetical protein"
         (116 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAG1_HUMAN RecName: Full=Sperm-associated antigen 1;AltName: Fu...    58   4e-11
TOM71_YEAST RecName: Full=Protein TOM71;AltName: Full=71 kDa mit...    57   1e-10
STUB1_CHICK RecName: Full=STIP1 homology and U box-containing pr...    52   2e-09
IFT88_HUMAN RecName: Full=Intraflagellar transport protein 88 ho...    52   2e-09
TOM70_YEAST RecName: Full=Mitochondrial import receptor subunit ...    52   3e-09
TOM70_YEAS7 RecName: Full=Mitochondrial import receptor subunit ...    52   3e-09
SPAG1_RAT RecName: Full=Sperm-associated antigen 1;AltName: Full...    50   1e-08
STUB1_HUMAN RecName: Full=STIP1 homology and U box-containing pr...    48   4e-08
SPAG1_MOUSE RecName: Full=Sperm-associated antigen 1;AltName: Fu...    47   6e-08
IFT88_MOUSE RecName: Full=Intraflagellar transport protein 88 ho...    47   6e-08
CNS1_YEAST RecName: Full=Hsp70/Hsp90 co-chaperone CNS1;AltName: ...    47   6e-08
STI1L_PLAF7 RecName: Full=STI1-like protein;                           47   8e-08
PPP5_ARATH RecName: Full=Serine/threonine protein phosphatase 5;...    47   1e-07
TOM34_PONAB RecName: Full=Mitochondrial import receptor subunit ...    46   1e-07
TOM34_HUMAN RecName: Full=Mitochondrial import receptor subunit ...    46   1e-07
STUB1_MOUSE RecName: Full=STIP1 homology and U box-containing pr...    46   1e-07
DYXC1_MOUSE RecName: Full=Dyslexia susceptibility 1 candidate ge...    46   1e-07
RAPI_BACSU RecName: Full=Response regulator aspartate phosphatas...    46   2e-07
STI1_SCHPO RecName: Full=Heat shock protein sti1 homolog;              45   3e-07
SGTA_BOVIN RecName: Full=Small glutamine-rich tetratricopeptide ...    45   4e-07
Y425_SYNP2 RecName: Full=TPR repeat-containing protein SYNPCC700...    44   9e-07
CYC8_DICDI RecName: Full=General transcriptional corepressor trfA;     44   9e-07
YRRB_BACSU RecName: Full=TPR repeat-containing protein yrrB;           43   2e-06
SGTA_RAT RecName: Full=Small glutamine-rich tetratricopeptide re...    43   2e-06
SGTA_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide ...    43   2e-06
SGTA_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide ...    43   2e-06
TOM34_RAT RecName: Full=Mitochondrial import receptor subunit TO...    42   2e-06
DNJC7_SCHPO RecName: Full=DnaJ homolog subfamily C member 7 homo...    42   2e-06
CYC8_SCHPO RecName: Full=General transcriptional corepressor ssn6;     42   2e-06
CTR9_MOUSE RecName: Full=RNA polymerase-associated protein CTR9 ...    42   2e-06
CTR9_HUMAN RecName: Full=RNA polymerase-associated protein CTR9 ...    42   2e-06
Y1428_METJA RecName: Full=TPR repeat-containing protein MJ1428;        42   4e-06
TOM34_MOUSE RecName: Full=Mitochondrial import receptor subunit ...    42   4e-06
STIP1_CRIGR RecName: Full=Stress-induced-phosphoprotein 1;      ...    42   4e-06
STIP1_RAT RecName: Full=Stress-induced-phosphoprotein 1;        ...    41   5e-06
STIP1_MOUSE RecName: Full=Stress-induced-phosphoprotein 1;      ...    41   5e-06
STIP1_HUMAN RecName: Full=Stress-induced-phosphoprotein 1;      ...    41   5e-06
STIP1_BOVIN RecName: Full=Stress-induced-phosphoprotein 1;      ...    41   5e-06
RAPC_BACSU RecName: Full=Response regulator aspartate phosphatas...    41   5e-06
PPP5_SOLLC RecName: Full=Serine/threonine protein phosphatase 5;...    41   5e-06
STIP_SOYBN RecName: Full=Heat shock protein STI;         Short=G...    41   6e-06
STIP1_MACFA RecName: Full=Stress-induced-phosphoprotein 1;      ...    41   6e-06
F10AL_ARATH RecName: Full=FAM10 family protein At4g22670;              41   6e-06
TFC4_YEAST RecName: Full=Transcription factor tau 131 kDa subuni...    40   8e-06
Z3H7B_HUMAN RecName: Full=Zinc finger CCCH domain-containing pro...    40   1e-05
TTC6_HUMAN RecName: Full=Tetratricopeptide repeat protein 6;    ...    40   1e-05
TTC12_MACFA RecName: Full=Tetratricopeptide repeat protein 12;  ...    40   1e-05
RAPSN_TORCA RecName: Full=43 kDa receptor-associated protein of ...    40   1e-05
BBS4_BOVIN RecName: Full=Bardet-Biedl syndrome 4 protein homolog;      40   1e-05
UN45A_PONAB RecName: Full=Protein unc-45 homolog A;         Shor...    39   2e-05
SGT_DICDI RecName: Full=Small glutamine-rich tetratricopeptide r...    39   2e-05
RAPF_BACSU RecName: Full=Response regulator aspartate phosphatas...    39   2e-05
EIF3L_PANTR RecName: Full=Eukaryotic translation initiation fact...    39   2e-05
EIF3L_MOUSE RecName: Full=Eukaryotic translation initiation fact...    39   2e-05
EIF3L_HUMAN RecName: Full=Eukaryotic translation initiation fact...    39   2e-05
EIF3L_CHICK RecName: Full=Eukaryotic translation initiation fact...    39   2e-05
EIF3L_BOVIN RecName: Full=Eukaryotic translation initiation fact...    39   2e-05
TTC12_MOUSE RecName: Full=Tetratricopeptide repeat protein 12;  ...    39   2e-05
PPP5_RAT RecName: Full=Serine/threonine-protein phosphatase 5;  ...    39   2e-05
PPP5_HUMAN RecName: Full=Serine/threonine-protein phosphatase 5;...    39   2e-05
DNJC7_MOUSE RecName: Full=DnaJ homolog subfamily C member 7;AltN...    39   2e-05
DNJC7_HUMAN RecName: Full=DnaJ homolog subfamily C member 7;AltN...    39   2e-05
CDC23_DICDI RecName: Full=Anaphase-promoting complex subunit 8; ...    39   2e-05
APC8_SCHPO RecName: Full=Anaphase-promoting complex subunit 8;Al...    39   2e-05
TT21B_HUMAN RecName: Full=Tetratricopeptide repeat protein 21B; ...    39   3e-05
STIP1_DICDI RecName: Full=Protein STIP1 homolog;                       39   3e-05
DNJC7_PONAB RecName: Full=DnaJ homolog subfamily C member 7;           39   3e-05
BBS4_HUMAN RecName: Full=Bardet-Biedl syndrome 4 protein;              39   3e-05
Y798_METJA RecName: Full=TPR repeat-containing protein MJ0798;         38   4e-05
RAPSN_CHICK RecName: Full=43 kDa receptor-associated protein of ...    38   4e-05
PPP5_MOUSE RecName: Full=Serine/threonine-protein phosphatase 5;...    38   4e-05
EIF3L_XENTR RecName: Full=Eukaryotic translation initiation fact...    38   4e-05
CTR9_XENTR RecName: Full=RNA polymerase-associated protein CTR9 ...    38   4e-05
CTR9_XENLA RecName: Full=RNA polymerase-associated protein CTR9 ...    38   4e-05
TOM70_NEUCR RecName: Full=Mitochondrial import receptor subunit ...    38   5e-05
PPT1_YEAST RecName: Full=Serine/threonine-protein phosphatase T;...    38   5e-05
FKBP5_RHIOR RecName: Full=FK506-binding protein 5;         EC=5....    38   5e-05
UN45A_RAT RecName: Full=Protein unc-45 homolog A;         Short=...    37   7e-05
UN45A_MOUSE RecName: Full=Protein unc-45 homolog A;         Shor...    37   7e-05
UN45A_HUMAN RecName: Full=Protein unc-45 homolog A;         Shor...    37   7e-05
TTC12_HUMAN RecName: Full=Tetratricopeptide repeat protein 12;  ...    37   7e-05
TOM70_SCHPO RecName: Full=Probable mitochondrial import receptor...    37   7e-05
SGTB_RAT RecName: Full=Small glutamine-rich tetratricopeptide re...    37   7e-05
SGTB_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide ...    37   7e-05
PPT1_SCHPO RecName: Full=Serine/threonine-protein phosphatase T;...    37   7e-05
FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase;     ...    37   7e-05
BBS4_DROME RecName: Full=Bardet-Biedl syndrome 4 protein homolog;      37   7e-05
TTC28_HUMAN RecName: Full=Tetratricopeptide repeat protein 28;  ...    37   9e-05
SPY_ARATH RecName: Full=Probable UDP-N-acetylglucosamine--peptid...    37   9e-05
SGTB_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide ...    37   9e-05
EIF3L_XENLA RecName: Full=Eukaryotic translation initiation fact...    37   9e-05
EIF3L_DANRE RecName: Full=Eukaryotic translation initiation fact...    37   9e-05
CYC8_YEAST RecName: Full=General transcriptional corepressor CYC...    37   9e-05
TTC30_ANOGA RecName: Full=Tetratricopeptide repeat protein 30 ho...    37   1e-04
TMTC3_MOUSE RecName: Full=Transmembrane and TPR repeat-containin...    37   1e-04
SWA2_YEAST RecName: Full=Auxilin-like clathrin uncoating factor ...    37   1e-04
SUGT1_DICDI RecName: Full=Protein SUGT1 homolog;                       37   1e-04
CTR9_YEAST RecName: Full=RNA polymerase-associated protein CTR9;...    37   1e-04
CDC23_YEAST RecName: Full=Anaphase-promoting complex subunit CDC...    37   1e-04
BBS4_XENTR RecName: Full=Bardet-Biedl syndrome 4 protein homolog;      37   1e-04
APC3_SCHPO RecName: Full=Anaphase-promoting complex subunit 3;Al...    37   1e-04
STI1_YEAST RecName: Full=Heat shock protein STI1;                      36   1e-04
SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptid...    36   1e-04
FKBP5_MOUSE RecName: Full=FK506-binding protein 5;         EC=5....    36   1e-04
DNJC7_DICDI RecName: Full=DnaJ homolog subfamily C member 7 homo...    36   1e-04
CDC23_HUMAN RecName: Full=Cell division cycle protein 23 homolog...    36   1e-04
CDC23_BOVIN RecName: Full=Cell division cycle protein 23 homolog...    36   1e-04
Y1088_AQUAE RecName: Full=Uncharacterized protein aq_1088;             36   2e-04
GPSM2_MOUSE RecName: Full=G-protein-signaling modulator 2;AltNam...    36   2e-04
STI1L_PLAFA RecName: Full=STI1-like protein;Flags: Fragment;           35   3e-04
SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptid...    35   3e-04
SGT2_SCHPO RecName: Full=Small glutamine-rich tetratricopeptide ...    35   3e-04
RAPSN_MOUSE RecName: Full=43 kDa receptor-associated protein of ...    35   3e-04
PEX5_CHICK RecName: Full=Peroxisomal targeting signal 1 receptor...    35   3e-04
GPSM2_HUMAN RecName: Full=G-protein-signaling modulator 2;AltNam...    35   3e-04
DNJC3_CHICK RecName: Full=DnaJ homolog subfamily C member 3;Flag...    35   3e-04
BBS4_MOUSE RecName: Full=Bardet-Biedl syndrome 4 protein homolog;      35   3e-04
YCF3_CYAME RecName: Full=Photosystem I assembly protein ycf3;          35   3e-04
SPY_SOLLC RecName: Full=Probable UDP-N-acetylglucosamine--peptid...    35   3e-04
PPID_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase D; ...    35   3e-04
CDC27_YEAST RecName: Full=Anaphase-promoting complex subunit CDC...    35   3e-04
CDC23_MOUSE RecName: Full=Cell division cycle protein 23 homolog...    35   3e-04
TTC9B_MOUSE RecName: Full=Tetratricopeptide repeat protein 9B;  ...    35   4e-04
SPY_ORYSJ RecName: Full=Probable UDP-N-acetylglucosamine--peptid...    35   4e-04
SKI3_SCHPO RecName: Full=Superkiller protein 3;                        35   4e-04
YCF3_SYNJA RecName: Full=Photosystem I assembly protein ycf3;          34   6e-04
YCF3_EMIHU RecName: Full=Photosystem I assembly protein ycf3;          34   6e-04
Y8921_DICDI RecName: Full=Putative uncharacterized protein DDB_G...    34   6e-04
Y856_MIMIV RecName: Full=Putative TPR repeat-containing protein ...    34   6e-04
Y1345_METJA RecName: Full=TPR repeat-containing protein MJ1345;        34   6e-04
TEX11_MOUSE RecName: Full=Testis-expressed sequence 11 protein;        34   6e-04
SOLR_CLOAB RecName: Full=Sol locus transcriptional repressor;          34   6e-04
RPAP3_XENTR RecName: Full=RNA polymerase II-associated protein 3;      34   6e-04
RPAP3_XENLA RecName: Full=RNA polymerase II-associated protein 3;      34   6e-04
RAPSN_HUMAN RecName: Full=43 kDa receptor-associated protein of ...    34   6e-04
RAPH_BACSU RecName: Full=Response regulator aspartate phosphatas...    34   6e-04
PEX5_PICPA RecName: Full=Peroxisomal targeting signal receptor; ...    34   6e-04
FKB70_ARATH RecName: Full=70 kDa peptidyl-prolyl isomerase;     ...    34   6e-04
TTC14_HUMAN RecName: Full=Tetratricopeptide repeat protein 14;  ...    34   7e-04
TMTC3_DROME RecName: Full=Transmembrane and TPR repeat-containin...    34   7e-04
PEX5_MOUSE RecName: Full=Peroxisomal targeting signal 1 receptor...    34   7e-04
PEX5_HUMAN RecName: Full=Peroxisomal targeting signal 1 receptor...    34   7e-04
PEX5_DEBHA RecName: Full=Peroxisomal targeting signal receptor; ...    34   7e-04
PEX5_CRIGR RecName: Full=Peroxisomal targeting signal 1 receptor...    34   7e-04
PEX5_CAVPO RecName: Full=Peroxisomal targeting signal 1 receptor...    34   7e-04
PEX5_BOVIN RecName: Full=Peroxisomal targeting signal 1 receptor...    34   7e-04
FKBP6_DICDI RecName: Full=FK506-binding protein 6;         EC=5....    34   7e-04
EIF3L_USTMA RecName: Full=Eukaryotic translation initiation fact...    34   7e-04
TTC30_AEDAE RecName: Full=Tetratricopeptide repeat protein 30 ho...    33   0.001
TAH1_YEAST RecName: Full=TPR repeat-containing protein associate...    33   0.001
SYR_XANC5 RecName: Full=Arginyl-tRNA synthetase;         EC=6.1....    33   0.001
SYR_XANAC RecName: Full=Arginyl-tRNA synthetase;         EC=6.1....    33   0.001
SNAA_VITVI RecName: Full=Alpha-soluble NSF attachment protein;  ...    33   0.001
LBA1_MOUSE RecName: Full=Lupus brain antigen 1;                        33   0.001
FKBP5_SAIBB RecName: Full=FK506-binding protein 5;         EC=5....    33   0.001
FKBP5_SAGOE RecName: Full=FK506-binding protein 5;         EC=5....    33   0.001
FKBP5_HUMAN RecName: Full=FK506-binding protein 5;         EC=5....    33   0.001
FKBP5_CERAE RecName: Full=FK506-binding protein 5;         EC=5....    33   0.001
FKBP5_AOTNA RecName: Full=FK506-binding protein 5;         EC=5....    33   0.001
FKBP4_HUMAN RecName: Full=FK506-binding protein 4;         EC=5....    33   0.001
DYHA_CHLRE RecName: Full=Dynein alpha chain, flagellar outer arm...    33   0.001

>SPAG1_HUMAN RecName: Full=Sperm-associated antigen 1;AltName:
           Full=Infertility-related sperm protein Spag-1;AltName:
           Full=HSD-3.8;
          Length = 926

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN+  N +NY DA++ Y + L  +  +C  Y N  +CY+KL Q+E+A +   +AL+L  
Sbjct: 629 EGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLAD 688

Query: 66  DS-KYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCE 104
            + K F+  A  +  + N  K+L   N    LD + I+ +
Sbjct: 689 GNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPSIIEAK 728



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           KGNE +N+ +Y +A+ YY +++        +Y N     IKL+ +  A +   K LEL
Sbjct: 215 KGNEAFNSGDYEEAVMYYTRSISALPTVV-AYNNRAQAEIKLQNWNSAFQDCEKVLEL 271


>TOM71_YEAST RecName: Full=Protein TOM71;AltName: Full=71 kDa
           mitochondrial outer membrane protein;
          Length = 639

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GN  +  +N+++AI YY+ A++ D  +   Y N   CYI     EK IE  TKALE+ 
Sbjct: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADID 102
            D SK     A     + N + A+  F+L+    N D D
Sbjct: 192 PDHSKALLRRASANESLGNFTDAM--FDLSVLSLNGDFD 228


>STUB1_CHICK RecName: Full=STIP1 homology and U box-containing
           protein 1;         EC=6.3.2.-;
          Length = 314

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 5/93 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GN L+  R Y +A   Y +A++ +      Y N  +CY+K++Q++KA+    +ALEL  
Sbjct: 42  QGNRLFGGRKYPEAAAAYGRAINRNPLVAVYYTNRALCYLKMQQHDKALADCKRALELDG 101

Query: 65  QDSKYFFNLAYCYSMINNNSKAL----RYFNLA 93
           Q  K  F L  C   + N  +A+    R +NLA
Sbjct: 102 QSVKAHFFLGQCQMEMENYDEAIANLQRAYNLA 134


>IFT88_HUMAN RecName: Full=Intraflagellar transport protein 88
           homolog;AltName: Full=Tetratricopeptide repeat protein
           10;         Short=TPR repeat protein 10;
          Length = 833

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGN ++   +Y  A  +YK+AL ND     + YN G+ Y KL + ++A++   K   + 
Sbjct: 498 NKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHAIL 557

Query: 65  QDS-KYFFNLAYCYSMINNNSKALRY 89
           ++S +  + +A  Y ++ N S+A+ +
Sbjct: 558 RNSAEVLYQIANIYELMENPSQAIEW 583



 Score = 50.4 bits (119), Expect = 8e-09
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 7   GNELYNTRNYSDAINYYKKALD-----NDECKCHSYYNAGVCYIKLKQYEKAIEMITKAL 61
           GN     RNYS AI +Y+ ALD     N + +     N GV +I+  QY  AI      +
Sbjct: 249 GNIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIM 308

Query: 62  ELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAIS 108
            +  + K  +NL  CY  I +  K  + F     +   +ID +K IS
Sbjct: 309 SMAPNLKAGYNLTICYFAIGDREKMKKAFQKLITVP-LEIDEDKYIS 354


>TOM70_YEAST RecName: Full=Mitochondrial import receptor subunit
           TOM70;AltName: Full=70 kDa mitochondrial outer membrane
           protein;AltName: Full=Translocase of outer membrane 70
           kDa subunit;
          Length = 617

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGN+ +  + Y DAI YY  AL+  E     Y N   CY+ +   +K +EM TKALEL  
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALELKEDPVF-YSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 66  D 66
           D
Sbjct: 164 D 164


>TOM70_YEAS7 RecName: Full=Mitochondrial import receptor subunit
           TOM70;AltName: Full=70 kDa mitochondrial outer membrane
           protein;AltName: Full=Translocase of outer membrane 70
           kDa subunit;
          Length = 617

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGN+ +  + Y DAI YY  AL+  E     Y N   CY+ +   +K +EM TKALEL  
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALELKEDPVF-YSNLSACYVSVGDLKKVVEMSTKALELKP 163

Query: 66  D 66
           D
Sbjct: 164 D 164


>SPAG1_RAT RecName: Full=Sperm-associated antigen 1;AltName:
           Full=Infertility-related sperm protein Spag-1;AltName:
           Full=HSD-3.8;
          Length = 893

 Score = 49.7 bits (117), Expect = 1e-08
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN+L   +NY DAI+ Y + L  +   C  Y N  +CY+KL Q+E+A     KAL++  
Sbjct: 611 EGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCDKALQI-- 668

Query: 66  DSK 68
           DSK
Sbjct: 669 DSK 671



 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           KGNE + + +Y +A+ YY ++L +      +Y N     IKL+++  A+E   KALEL
Sbjct: 219 KGNEAFYSGDYEEAVMYYTRSL-SALPTATAYNNRAQAEIKLQRWSSALEDCEKALEL 275


>STUB1_HUMAN RecName: Full=STIP1 homology and U box-containing
           protein 1;         EC=6.3.2.-;AltName: Full=Carboxy
           terminus of Hsp70-interacting protein;
          Length = 303

 Score = 48.1 bits (113), Expect = 4e-08
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GN L+  R Y +A   Y +A+  +      Y N  +CY+K++Q+E+A+    +ALEL  
Sbjct: 32  QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDG 91

Query: 65  QDSKYFFNLAYCYSMINNNSKALRYFNLAWAL 96
           Q  K  F L  C   + +  +A+     A++L
Sbjct: 92  QSVKAHFFLGQCQLEMESYDEAIANLQRAYSL 123


>SPAG1_MOUSE RecName: Full=Sperm-associated antigen 1;AltName:
           Full=Infertility-related sperm protein Spag-1;AltName:
           Full=TPR-containing protein involved in spermatogenesis;
          Length = 901

 Score = 47.4 bits (111), Expect = 6e-08
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +GN+L   +NY DAI+ Y + L  +   C  Y N  +CY+KL Q+E+A     +AL++
Sbjct: 612 EGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQI 669



 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           KGNE + + +Y +A+ YY ++L        +Y N     IKL+++  A+E   KALEL
Sbjct: 219 KGNEAFYSGDYEEAVMYYTRSLSALPTAI-AYNNRAQAEIKLQRWSSALEDCEKALEL 275


>IFT88_MOUSE RecName: Full=Intraflagellar transport protein 88
           homolog;AltName: Full=Tetratricopeptide repeat protein
           10;         Short=TPR repeat protein 10;
          Length = 824

 Score = 47.4 bits (111), Expect = 6e-08
 Identities = 23/86 (26%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGN ++   +Y  A  +YK+AL ND     + YN G+ Y KL + ++A++   K   + 
Sbjct: 489 NKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYKKLNRLDEALDSFLKLHAIL 548

Query: 65  QDS-KYFFNLAYCYSMINNNSKALRY 89
           ++S +    +A  Y ++ + ++A+ +
Sbjct: 549 RNSAQVLCQIANIYELMEDPNQAIEW 574



 Score = 43.5 bits (101), Expect = 9e-07
 Identities = 28/89 (31%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 7   GNELYNTRNYSDAINYYKKALD-----NDECKCHSYYNAGVCYIKLKQYEKAIEMITKAL 61
           GN     RNYS AI +Y+ ALD     + E +     N G+ +IK  QY  AI      +
Sbjct: 239 GNIYLKQRNYSKAIKFYRMALDQIPSVHKEMRIKIMQNIGITFIKTGQYSDAINSFEHIM 298

Query: 62  ELYQDSKYFFNLAYCYSMINNNSKALRYF 90
            +    K  FNL      I +  K  + F
Sbjct: 299 SMAPSLKAGFNLILSCFAIGDREKMKKAF 327


>CNS1_YEAST RecName: Full=Hsp70/Hsp90 co-chaperone CNS1;AltName:
           Full=Cyclophilin seven suppressor 1;AltName: Full=STI1
           stress-inducible protein homolog;
          Length = 385

 Score = 47.4 bits (111), Expect = 6e-08
 Identities = 33/85 (38%), Positives = 42/85 (49%), Gaps = 15/85 (17%)

Query: 3   NFSK-GNELYNTRNYSDAINYYKKALDNDECKCHS-----YYNAGVCYIKLKQYEKAIEM 56
           NF K GNELY  + + DA   Y K L   EC+  S     Y N   C ++LK Y + IE 
Sbjct: 85  NFKKQGNELYKAKRFKDARELYSKGLAV-ECEDKSINESLYANRAACELELKNYRRCIED 143

Query: 57  ITKALEL--------YQDSKYFFNL 73
            +KAL +        Y+ SK FF L
Sbjct: 144 CSKALTINPKNVKCYYRTSKAFFQL 168


>STI1L_PLAF7 RecName: Full=STI1-like protein;
          Length = 564

 Score = 47.0 bits (110), Expect = 8e-08
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGNE Y  + + +A+  Y++A+  +      +YN    +I++K Y+KA+E    A+E   
Sbjct: 249 KGNEFYKQKKFDEALKEYEEAIQINPNDIMYHYNKAAVHIEMKNYDKAVETCLYAIE--- 305

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNL 92
            ++Y F   +       N  A+ Y N+
Sbjct: 306 -NRYNFKAEFIQVAKLYNRLAISYINM 331



 Score = 40.8 bits (94), Expect = 6e-06
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 1/113 (0%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   ++ +A   Y +A+  +      Y N      KL +Y  A+E + KA+EL 
Sbjct: 383 NKGNEYFKNNDFPNAKKEYDEAIRRNPNDAKLYSNRAAALTKLIEYPSALEDVMKAIELD 442

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
               K +      +  + +  KAL+ +N    LD  + +C +       KI +
Sbjct: 443 PTFVKAYSRKGNLHFFMKDYYKALQAYNKGLELDPNNKECLEGYQRCAFKIDE 495



 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 15/60 (25%), Positives = 29/60 (48%)

Query: 7  GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
          GN+ +    Y +A+ Y+  A+ ND      Y N    +  L ++ +A+E   K + + +D
Sbjct: 14 GNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCISIKKD 73


>PPP5_ARATH RecName: Full=Serine/threonine protein phosphatase 5;   
                EC=3.1.3.16;
          Length = 538

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           S+ NE +    YS AI+ Y KA++ +      + N    + KL++Y  AI+  +KA+E+ 
Sbjct: 18  SQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYGSAIQDASKAIEV- 76

Query: 65  QDSKY---FFNLAYCYSMINNNSKALRYFNLAWALDNADID-------CEKAI 107
            DS+Y   ++     Y  +     AL+ F     L   D D       CEKA+
Sbjct: 77  -DSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRKLKECEKAV 128


>TOM34_PONAB RecName: Full=Mitochondrial import receptor subunit
           TOM34;AltName: Full=Translocase of outer membrane 34 kDa
           subunit;
          Length = 309

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GNEL    N+  AI  Y ++L     +  +Y N  +CY+ LKQY +A++  T+AL+L  
Sbjct: 199 EGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDG 258

Query: 65  QDSKYFFNLAYCYSMINN 82
           ++ K F+  A  +  + +
Sbjct: 259 KNVKAFYRRAQAHKALKD 276


>TOM34_HUMAN RecName: Full=Mitochondrial import receptor subunit
           TOM34;         Short=hTom34;AltName: Full=Translocase of
           outer membrane 34 kDa subunit;
          Length = 309

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GNEL    N+  AI  Y ++L     +  +Y N  +CY+ LKQY +A++  T+AL+L  
Sbjct: 199 EGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDG 258

Query: 65  QDSKYFFNLAYCYSMINN 82
           ++ K F+  A  +  + +
Sbjct: 259 KNVKAFYRRAQAHKALKD 276


>STUB1_MOUSE RecName: Full=STIP1 homology and U box-containing
           protein 1;         EC=6.3.2.-;AltName: Full=Carboxy
           terminus of Hsp70-interacting protein;
          Length = 304

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GN L+  R Y +A   Y +A+  +      Y N  +CY+K++Q E+A+    +ALEL  
Sbjct: 33  QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDG 92

Query: 65  QDSKYFFNLAYCYSMINNNSKALRYFNLAWAL 96
           Q  K  F L  C   + +  +A+     A++L
Sbjct: 93  QSVKAHFFLGQCQLEMESYDEAIANLQRAYSL 124


>DYXC1_MOUSE RecName: Full=Dyslexia susceptibility 1 candidate gene
           1 protein homolog;
          Length = 420

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYY-NAGVCYIKLKQYEKAIEMITKALEL 63
           KGN+L+ T NY  A++ Y  A+  + CK    Y N   C++KLK   KAIE  +KALEL
Sbjct: 294 KGNKLFATENYLAAVDAYNLAIRLN-CKIPLLYLNRAACHLKLKNLHKAIEDSSKALEL 351


>RAPI_BACSU RecName: Full=Response regulator aspartate phosphatase
           I;         EC=3.1.-.-;
          Length = 391

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 12/99 (12%)

Query: 4   FSKGNELYNTRNYSDAINYYKKALDN------DECKCHSYYNAGVCYIKLKQYEKAIEMI 57
           F     L ++  Y  A+  + K+L+       +     S+ N G+CY +LK+Y+KA + +
Sbjct: 188 FIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHL 247

Query: 58  TKALELYQDSKY------FFNLAYCYSMINNNSKALRYF 90
             ALE+++ SK+       F L Y  +   N + AL YF
Sbjct: 248 ILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYF 286


>STI1_SCHPO RecName: Full=Heat shock protein sti1 homolog;
          Length = 591

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 22/62 (35%), Positives = 33/62 (53%)

Query: 5  SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
          +KGN  ++ ++Y  AI+Y+ +A+  DE     Y N   CY   K Y  A++  TK  EL 
Sbjct: 7  AKGNAAFSKKDYKTAIDYFTQAIGLDERNHILYSNRSACYASEKDYADALKDATKCTELK 66

Query: 65 QD 66
           D
Sbjct: 67 PD 68



 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 1/112 (0%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGNEL+ + ++++AI  Y +           + N    Y+K+    + I    KA+EL  
Sbjct: 405 KGNELFKSGDFANAIKEYTEMTKRAPSDPRGFGNRAAAYLKVMAPAECIRDCNKAIELDP 464

Query: 66  D-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
           + +K +   A    M+ + +K +   N A  +D  + +  K +  I S++SK
Sbjct: 465 NFAKAYVRKAQALFMLKDYNKCIDACNEASEVDRREPNTGKNLREIESQLSK 516


>SGTA_BOVIN RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein alpha;AltName: Full=Alpha-SGT;
          Length = 313

 Score = 44.7 bits (104), Expect = 4e-07
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GNE     N+  A+++Y KA++ +      + N    Y KL  Y  A++   +A+ + 
Sbjct: 96  TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICID 155

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALD 97
              SK +  +    S +N +++A+ Y+  A  LD
Sbjct: 156 PSYSKAYGRMGLALSSLNKHTEAVAYYRKALELD 189


>Y425_SYNP2 RecName: Full=TPR repeat-containing protein
           SYNPCC7002_A0425;
          Length = 387

 Score = 43.5 bits (101), Expect = 9e-07
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GNE    RN++ A+ +Y++AL  +      +   G    +L  Y +A+    +A EL  
Sbjct: 69  QGNEQLTNRNFAQAVQHYRQALTLEANNARIHGALGYALSQLGNYSEAVTAYRRATELED 128

Query: 66  DSKYFFN-LAYCYSMINNNSKALRYFNLAWAL 96
           D+  FFN L +  +   +N  A+  +  A  L
Sbjct: 129 DNAEFFNALGFNLAQSGDNRSAINAYQRATQL 160


>CYC8_DICDI RecName: Full=General transcriptional corepressor trfA;
          Length = 1390

 Score = 43.5 bits (101), Expect = 9e-07
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 8   NELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDS 67
           N L+  + Y  AINY  +++D+D     ++Y  G CY+  ++Y+KA +   +A  +Y+D 
Sbjct: 396 NPLFTNQEY--AINYLMRSIDSDSSDAQTWYLLGRCYMTQQKYKKAYDAYQQA--VYRDG 451

Query: 68  K---YFFNLAYCYSMINNNSKALRYFNLAWALD 97
           +   ++ ++   Y  IN    AL  +  A  L+
Sbjct: 452 RNPTFWCSIGVLYYQINQYRDALDAYTRAIRLN 484


>YRRB_BACSU RecName: Full=TPR repeat-containing protein yrrB;
          Length = 206

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 8   NELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-YQD 66
           N L +      A+ +Y KAL+ D     +YY AG  Y+  + Y++A +M  KAL    ++
Sbjct: 32  NLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMEN 91

Query: 67  SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILS 112
              F+ L      +     AL Y   A  L+  D +      + L+
Sbjct: 92  GDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLA 137



 Score = 40.4 bits (93), Expect = 8e-06
 Identities = 20/65 (30%), Positives = 34/65 (52%)

Query: 2   SNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKAL 61
           + F  G  L N     +A++ +    + D     ++YNAGV Y   +  EKA+EM+ KA+
Sbjct: 128 ARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAI 187

Query: 62  ELYQD 66
           ++  D
Sbjct: 188 DIQPD 192



 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 50 YEKAIEMITKAL-ELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNA 99
          YEKA E  TKA+ E  +D+  + N A   S +N   +AL +++ A  LD++
Sbjct: 6  YEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSS 56


>SGTA_RAT RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein alpha;AltName:
           Full=Alpha-SGT;AltName: Full=Small glutamine-rich
           protein with tetratricopeptide repeats 1;
          Length = 314

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GNE     N+  A++ Y KA++ +      + N    Y KL  Y  A++   +A+ + 
Sbjct: 96  TEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGID 155

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALD 97
              SK +  +    S +N +++A+ Y+  A  LD
Sbjct: 156 PGYSKAYGRMGLALSSLNKHAEAVAYYKKALELD 189



 Score = 33.5 bits (75), Expect = 0.001
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 1/90 (1%)

Query: 28  DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ-DSKYFFNLAYCYSMINNNSKA 86
           + D  +       G   +KL+ +E A+ +  KA+EL   ++ YF N A  YS + N   A
Sbjct: 85  EEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGA 144

Query: 87  LRYFNLAWALDNADIDCEKAISLILSKISK 116
           ++    A  +D         + L LS ++K
Sbjct: 145 VQDCERAIGIDPGYSKAYGRMGLALSSLNK 174


>SGTA_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein alpha;AltName: Full=Alpha-SGT;
          Length = 315

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GNE     N+  A++ Y KA++ +      + N    Y KL  Y  A++   +A+ + 
Sbjct: 97  TEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGID 156

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALD 97
              SK +  +    S +N +++A+ Y+  A  LD
Sbjct: 157 PGYSKAYGRMGLALSSLNKHAEAVAYYKKALELD 190



 Score = 33.5 bits (75), Expect = 0.001
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 1/90 (1%)

Query: 28  DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ-DSKYFFNLAYCYSMINNNSKA 86
           + D  +       G   +KL+ +E A+ +  KA+EL   ++ YF N A  YS + N   A
Sbjct: 86  EEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGA 145

Query: 87  LRYFNLAWALDNADIDCEKAISLILSKISK 116
           ++    A  +D         + L LS ++K
Sbjct: 146 VQDCERAIGIDPGYSKAYGRMGLALSSLNK 175


>SGTA_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein alpha;AltName:
           Full=Alpha-SGT;AltName: Full=Vpu-binding protein;
          Length = 313

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GNE     N+  A+++Y KA++ +      + N    Y KL  Y  A++   +A+ + 
Sbjct: 96  TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICID 155

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALD 97
              SK +  +    S +N + +A+ Y+  A  LD
Sbjct: 156 PAYSKAYGRMGLALSSLNKHVEAVAYYKKALELD 189



 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

Query: 28  DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ-DSKYFFNLAYCYSMINNNSKA 86
           + D  +       G   +K++ +E A+    KA+EL   ++ YF N A  YS + N + A
Sbjct: 85  EEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGA 144

Query: 87  LRYFNLAWALDNADIDCEKAISLILSKISK 116
           ++    A  +D A       + L LS ++K
Sbjct: 145 VQDCERAICIDPAYSKAYGRMGLALSSLNK 174


>TOM34_RAT RecName: Full=Mitochondrial import receptor subunit
           TOM34;AltName: Full=Translocase of outer membrane 34 kDa
           subunit;
          Length = 309

 Score = 42.4 bits (98), Expect = 2e-06
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GNEL    N+  AI  Y            +Y N  +C++ LKQY++A +  T+AL+L  
Sbjct: 199 EGNELVKKGNHKKAIEKYXXXXXXXXXXXATYSNRALCHLVLKQYKEAEKDCTEALKLDG 258

Query: 65  QDSKYFFNLAYCYSMINNNSKAL 87
           ++ K F+  A  Y  + +   +L
Sbjct: 259 KNVKAFYRRAQAYKALKDYKSSL 281


>DNJC7_SCHPO RecName: Full=DnaJ homolog subfamily C member 7
           homolog;
          Length = 476

 Score = 42.4 bits (98), Expect = 2e-06
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 5   SKGNELYNTRNYSDAINYYKKAL----DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           ++GN+L+   NY DA   Y +AL    DN E     Y N     ++LK+ E+A+     A
Sbjct: 228 NQGNDLFRQGNYQDAYEKYSEALQIDPDNKETVAKLYMNRATVLLRLKRPEEALSDSDNA 287

Query: 61  LELYQDSKYFFNL---AYCYSMINNNSKALRYFNLAWALDNAD 100
           L +  DS Y   L   A  +  +    +A+R    A  LD +D
Sbjct: 288 LAI--DSSYLKGLKVRAKAHEALEKWEEAVRDVQSAIELDASD 328


>CYC8_SCHPO RecName: Full=General transcriptional corepressor ssn6;
          Length = 1102

 Score = 42.4 bits (98), Expect = 2e-06
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 15  NYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSK---YFF 71
           N   AI Y  K+L+ D+    S+Y  G CY+  ++Y KA E   +A  +Y+D +   ++ 
Sbjct: 565 NQDLAIQYLTKSLEADDTDAQSWYLIGRCYVAQQKYNKAYEAYQQA--VYRDGRNPTFWC 622

Query: 72  NLAYCYSMINNNSKALRYFNLAWALD 97
           ++   Y  IN    AL  ++ A  L+
Sbjct: 623 SIGVLYYQINQYQDALDAYSRAIRLN 648


>CTR9_MOUSE RecName: Full=RNA polymerase-associated protein CTR9
           homolog;AltName: Full=SH2 domain-binding protein
           1;AltName: Full=Tetratricopeptide repeat-containing,
           SH2-binding phosphoprotein of 150 kDa;
          Length = 1173

 Score = 42.4 bits (98), Expect = 2e-06
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 11  YNTRNYSDAINYYKKAL-DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +N ++Y  A+ YYKKAL  N  C        G C++KL + EKA    ++ALEL
Sbjct: 174 FNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALEL 227


>CTR9_HUMAN RecName: Full=RNA polymerase-associated protein CTR9
           homolog;AltName: Full=SH2 domain-binding protein 1;
          Length = 1173

 Score = 42.4 bits (98), Expect = 2e-06
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 11  YNTRNYSDAINYYKKAL-DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +N ++Y  A+ YYKKAL  N  C        G C++KL + EKA    ++ALEL
Sbjct: 174 FNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALEL 227


>Y1428_METJA RecName: Full=TPR repeat-containing protein MJ1428;
          Length = 567

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 23/96 (23%), Positives = 45/96 (46%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           + + G  +   ++Y  A+  + K L  DE    SYY   V     ++Y+KA+E I K++ 
Sbjct: 204 DLNNGLTMIKNKDYIGALKIFNKVLQIDENSDISYYYKSVIAEIFEEYKKALEYIDKSIS 263

Query: 63  LYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDN 98
           ++  S Y+         + +   A+  +N A  L++
Sbjct: 264 IFNRSLYYAKKGDILYKLGDEEGAIEAYNKAIKLNS 299



 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 16 YSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAY 75
          Y  A+  Y KAL+        ++N       L++Y+ A+E I +AL++   + YF   AY
Sbjct: 30 YDKAVECYLKALEKKNTNPIDWFNLAYALYHLEKYDSALEAINEALKISPSNIYF---AY 86

Query: 76 CYSMIN 81
             +I+
Sbjct: 87 LKGLIH 92



 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 27/117 (23%), Positives = 52/117 (44%), Gaps = 5/117 (4%)

Query: 4   FSKGNELYNTRNYSDAI--NYYKKALDNDECKCHSYYNAGVCYIK--LKQYEKAIEMITK 59
           + KG EL  + N+ D +   Y ++  + D    + Y   G        K Y +A++ +  
Sbjct: 313 YRKG-ELEKSSNFFDKVLETYLEELSEEDISALNLYSLIGKAETTGIPKYYHEAMKYVDN 371

Query: 60  ALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
            + L   S++++   Y Y  + N   A   F  A  ++  DI   K+++++L K  K
Sbjct: 372 LINLENSSRWWYVKGYIYYKLGNYKDAYESFMNALRVNPKDISTLKSLAIVLEKSGK 428


>TOM34_MOUSE RecName: Full=Mitochondrial import receptor subunit
           TOM34;AltName: Full=Translocase of outer membrane 34 kDa
           subunit;
          Length = 309

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-Y 64
           +GN+L    N+  AI  Y            +Y N  +C++ LKQY++A++  T+AL+L  
Sbjct: 199 EGNDLVKKGNHKKAIEKYXXXXXXXXXXXATYSNRALCHLVLKQYKEAVKDCTEALKLDG 258

Query: 65  QDSKYFFNLAYCY 77
           ++ K F+  A  Y
Sbjct: 259 KNVKAFYRRAQAY 271


>STIP1_CRIGR RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;AltName: Full=Hsc70/Hsp90-organizing protein;
                   Short=Hop;
          Length = 543

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKA 106
               K +   A     + + +KA+  +  A  LD++   C++A
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALELDSS---CKEA 464



 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K ++L  
Sbjct: 10 KGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKP 69

Query: 66 D-SKYFFNLAYCYSMINNNSKALRYF 90
          D  K +   A     +N   +A R +
Sbjct: 70 DWGKGYSRKAAALEFLNRFEEAKRTY 95



 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GNE Y  +++  A+ +Y +A + D        N    + +   Y K  E+  KA+E+ ++
Sbjct: 232 GNEAYKKKDFDMALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309


>STIP1_RAT RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;AltName: Full=Hsc70/Hsp90-organizing protein;
                   Short=Hop;
          Length = 543

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKA 106
               K +   A     + + +KA+  +  A  LD++   C++A
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA 464



 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  +++  A+ +Y KA + D        N    + +   Y K  E+  KA+E+ ++
Sbjct: 232 GNDAYKKKDFDKALKHYDKAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309



 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K ++L  
Sbjct: 10 KGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKP 69

Query: 66 D-SKYFFNLAYCYSMINNNSKALRYF 90
          D  K +   A     +N   +A R +
Sbjct: 70 DWGKGYSRKAAALEFLNRFEEAKRTY 95


>STIP1_MOUSE RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;         Short=mSTI1;AltName:
           Full=Hsc70/Hsp90-organizing protein;
          Length = 543

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKA 106
               K +   A     + + +KA+  +  A  LD++   C++A
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA 464



 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K ++L  
Sbjct: 10 KGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKP 69

Query: 66 D-SKYFFNLAYCYSMINNNSKALRYF 90
          D  K +   A     +N   +A R +
Sbjct: 70 DWGKGYSRKAAALEFLNRFEEAKRTY 95



 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  +++  A+ +Y +A + D        N    + +   Y K  E+  KA+E+ ++
Sbjct: 232 GNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309


>STIP1_HUMAN RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;AltName: Full=Hsc70/Hsp90-organizing protein;
                   Short=Hop;
          Length = 543

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKA 106
               K +   A     + + +KA+  +  A  LD++   C++A
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS---CKEA 464



 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  +++  A+ +Y KA + D        N    Y +   Y K  E+  KA+E+ ++
Sbjct: 232 GNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309



 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K ++L  
Sbjct: 10 KGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKP 69

Query: 66 D-SKYFFNLAYCYSMINNNSKALRYF 90
          D  K +   A     +N   +A R +
Sbjct: 70 DWGKGYSRKAAALEFLNRFEEAKRTY 95


>STIP1_BOVIN RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;AltName: Full=Hsc70/Hsp90-organizing protein;
                   Short=Hop;
          Length = 543

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKA 106
               K +   A     + + +KA+  +  A  LD+   +C++A
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDS---NCKEA 464



 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GNE Y  +++  A+ +Y KA D D        N    Y +   Y +  E+  KA+E+ ++
Sbjct: 232 GNEAYKKKDFDTALKHYDKAKDLDPTNMTYITNQAAVYFEKGDYGQCRELCEKAIEVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309



 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 20/61 (32%), Positives = 28/61 (45%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K ++L  
Sbjct: 10 KGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKP 69

Query: 66 D 66
          D
Sbjct: 70 D 70


>RAPC_BACSU RecName: Full=Response regulator aspartate phosphatase
           C;         EC=3.1.-.-;
          Length = 382

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKALDNDECKC------HSYYNAGVCYIKLKQYEKAIEM 56
           +F  G  L + RN+  A  ++K AL+  + +        +YYN G+CY      + AI+ 
Sbjct: 186 HFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLVGRAYYNLGLCYYNQDLLDPAIDY 245

Query: 57  ITKALELYQDSKYFFNLAYCYSMI 80
             KA+  ++ S+   +L   Y +I
Sbjct: 246 FEKAVSTFESSRIVNSLPQAYFLI 269



 Score = 34.7 bits (78), Expect = 4e-04
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKA-------LDNDECKCHSYYNAGVCYIKLKQYEKAIE 55
           NF +G   ++ R +  AI YYK+A        D+ E +   Y+     Y  +KQ   ++ 
Sbjct: 105 NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIE-RAEFYFKIAEAYYYMKQTYFSLI 163

Query: 56  MITKALELY-QDSKYFFNLAYCYSMI-------NNNSKALRYFNLAWALDNAD 100
            I  A E+Y +   Y   +  C+ +         N  +A R+F LA  +  A+
Sbjct: 164 NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAE 216


>PPP5_SOLLC RecName: Full=Serine/threonine protein phosphatase 5;   
                EC=3.1.3.16;AltName: Full=LePP5;
          Length = 556

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 8/108 (7%)

Query: 8   NELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-YQD 66
           NE +    YS AI+ Y +A++ +      Y N    + KL++Y  AI+  T+A+E+  + 
Sbjct: 22  NEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTKLEEYGSAIQDGTRAIEIDPRY 81

Query: 67  SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADID-------CEKAI 107
           SK ++     Y  +     AL+ F     L   D D       CEKA+
Sbjct: 82  SKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDATKKLKECEKAV 129


>STIP_SOYBN RecName: Full=Heat shock protein STI;       
           Short=GmSTI;AltName: Full=Stress-inducible protein;
          Length = 569

 Score = 40.8 bits (94), Expect = 6e-06
 Identities = 18/58 (31%), Positives = 30/58 (51%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           KGNEL+  + Y +A  +Y +A+  +     +Y N   CY KL    + ++   K +EL
Sbjct: 387 KGNELFKQQKYPEATKHYTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLKDAEKCIEL 444



 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           GN  Y  +++  AI +Y KAL+ D+       N    Y+++ ++E  I+   KA+E
Sbjct: 249 GNAAYKKKDFETAIGHYSKALELDDEDISYLTNRAAVYLEMGKFEDCIKDCEKAVE 304


>STIP1_MACFA RecName: Full=Stress-induced-phosphoprotein 1;       
           Short=STI1;AltName: Full=Hsc70/Hsp90-organizing protein;
                   Short=Hop;
          Length = 543

 Score = 40.8 bits (94), Expect = 6e-06
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +KGNE +   +Y  A+ +Y +A+  +      Y N   CY KL +++ A++   + ++L 
Sbjct: 365 NKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLE 424

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNA 99
               K +   A     + + +KA+  +  A  LD++
Sbjct: 425 PTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS 460



 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
          KGN+  +  N  DA+  Y +A+  D      Y N    Y K   Y+KA E   K +EL  
Sbjct: 10 KGNKALSAGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVELKP 69

Query: 66 D-SKYFFNLAYCYSMINNNSKALRYF 90
          D  K +   A     +N   +A R +
Sbjct: 70 DWGKGYSRKAAALEFLNRFEEAKRTY 95



 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  +++  A+ +Y KA + D        N    Y +   Y K  E+  KA+++ ++
Sbjct: 232 GNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIDVGRE 291

Query: 67  SKY-FFNLAYCYSMINNN 83
           ++  +  +A  Y+ I N+
Sbjct: 292 NREDYRQIAKAYARIGNS 309


>F10AL_ARATH RecName: Full=FAM10 family protein At4g22670;
          Length = 441

 Score = 40.8 bits (94), Expect = 6e-06
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 6/110 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           K  E  +  N+ +AI +  +A+  +      Y N    YIKLK+   AI     ALE+  
Sbjct: 129 KAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDANAALEINP 188

Query: 66  DS-KYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKI 114
           DS K + +     +M+   ++A +  +LA     + ID ++ IS +L K+
Sbjct: 189 DSAKGYKSRGMARAMLGEWAEAAKDLHLA-----STIDYDEEISAVLKKV 233


>TFC4_YEAST RecName: Full=Transcription factor tau 131 kDa
           subunit;AltName: Full=TFIIIC 131 kDa subunit;AltName:
           Full=Transcription factor C subunit 4;
          Length = 1025

 Score = 40.4 bits (93), Expect = 8e-06
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 12  NTRNYSDAINYYKKALDNDECKCHS-YYNAGVCYIKLKQYEKAIEMITKALEL--YQDSK 68
           NT N  +A+N+++   D         Y+ A     + ++Y++AI+  T  L L  ++ + 
Sbjct: 444 NTDNLVEALNHFQCLYDETFSDVADLYFEAATALTRAEKYKEAIDFFTPLLSLEEWRTTD 503

Query: 69  YFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKIS 115
            F  LA CY  I +   A  ++ LA   +  D+D   +++ +  +++
Sbjct: 504 VFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRVSLAEVYYRLN 550


>Z3H7B_HUMAN RecName: Full=Zinc finger CCCH domain-containing
           protein 7B;AltName: Full=Rotavirus 'X'-associated
           non-structural protein;
          Length = 993

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 12/76 (15%)

Query: 4   FSKGNELYNTRNYSDAINYYKKALD------------NDECKCHSYYNAGVCYIKLKQYE 51
           F++GN+L+  ++Y  A+  Y + L+              E  C  + N   CY  +  YE
Sbjct: 40  FAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYE 99

Query: 52  KAIEMITKALELYQDS 67
           KA+E   KAL L  +S
Sbjct: 100 KALEDSEKALGLDSES 115


>TTC6_HUMAN RecName: Full=Tetratricopeptide repeat protein 6;       
            Short=TPR repeat protein 6;
          Length = 520

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 18  DAINYYKKALDNDECKCHSYYNAGVCYIK----LKQYEKAIEMITKALELYQDS-KYFFN 72
           DAI++  K  D         YN G+CY++       Y+ AI  +T A+ + ++S   F+N
Sbjct: 85  DAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMTYKLAITDLTTAISMDKNSYTAFYN 144

Query: 73  LAYCYSMINNNSKALRYFNLAWALD 97
            A CY+ I     AL  + +   LD
Sbjct: 145 RALCYTKIRELQMALTDYGIVLLLD 169



 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 1   MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           ++ F+ GN  ++ R +S A +Y+ KAL  D    +   N  +    LK+YE+A E     
Sbjct: 383 LAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANV 442

Query: 61  LELYQD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNAD 100
           +E     +  +FN A+ Y  +     A    N A +L   D
Sbjct: 443 IESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPND 483


>TTC12_MACFA RecName: Full=Tetratricopeptide repeat protein 12;     
              Short=TPR repeat protein 12;Flags: Fragment;
          Length = 577

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGNE +   NY  AI +Y + L+  +     Y N    Y+KLK YEKA+     AL+  +
Sbjct: 112 KGNEAFAEGNYETAILHYSEGLEKLKDVKVLYTNRAQAYMKLKNYEKALVDCEWALKCDE 171

Query: 66  D-SKYFFNLAYCYSMINNNS 84
             +K +F++      + N S
Sbjct: 172 KCTKAYFHMGRANLALKNYS 191


>RAPSN_TORCA RecName: Full=43 kDa receptor-associated protein of the
           synapse;         Short=RAPsyn;AltName:
           Full=Acetylcholine receptor-associated 43 kDa protein;
          Length = 412

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 21/119 (17%)

Query: 5   SKGNELYNTRNYSDAINYYKKAL------DNDECKCHSYYNAGVCYIKLKQYEKAIEMIT 58
           S GN       +  A+  ++KAL      D+   +C    + G  Y++LK YEKA+    
Sbjct: 128 SMGNAFLGLSAFQKALECFEKALRYAHGNDDKMLECRVCCSLGAFYVQLKDYEKALFFPC 187

Query: 59  KALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWA------LDNADIDCEKAISLIL 111
           K+ EL  D    ++L Y         KA+  +++A A      +D+A   CE+++ + L
Sbjct: 188 KSAELVADYGRGWSLKY---------KAMSRYHMAAAYRKLGRMDDAMECCEESMKIAL 237


>BBS4_BOVIN RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
          Length = 519

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 23/84 (27%), Positives = 40/84 (47%)

Query: 10  LYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKY 69
           L+    +  AI  Y +A   ++      +N GVCYI LKQ++KA + +  AL L +    
Sbjct: 111 LFLLGKHKAAIEVYNEAAKLNQKDWEICHNLGVCYIYLKQFDKAQDQLHNALHLNRHDLT 170

Query: 70  FFNLAYCYSMINNNSKALRYFNLA 93
           +  L   + +  +  KA+  +  A
Sbjct: 171 YIMLGKIFLLKGDLDKAIEIYKKA 194


>UN45A_PONAB RecName: Full=Protein unc-45 homolog A;       
          Short=UNC-45A;AltName: Full=Smooth muscle
          cell-associated protein 1;         Short=SMAP-1;
          Length = 929

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 6  KGNELYNTRNYSDAINYYKKALDND---ECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
          +GNEL+   +Y  A+  Y +AL  D   + +   + N   CY+KL+ Y+KA    +KA+E
Sbjct: 12 EGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACYLKLEDYDKAETEASKAIE 71


>SGT_DICDI RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein;
          Length = 334

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GN   N   + +A++ Y KA+  D      + N    Y  L+ +EK+IE   +A++  
Sbjct: 150 NEGNAKLNEGKHQEALSCYNKAILYDNTNAIYFANRAATYSALQNFEKSIEDCLEAIKRN 209

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALD 97
            +  K +  +   Y+ +   S+A+  +N A  L+
Sbjct: 210 PNYGKAYTRMGSAYTSLGKFSEAMEAYNKAIELE 243


>RAPF_BACSU RecName: Full=Response regulator aspartate phosphatase
           F;         EC=3.1.-.-;
          Length = 381

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 14  RNYSDAINYYKKALDNDECKCH------SYYNAGVCYIKLKQYEKAIEMITKALELYQDS 67
           + Y DAI++++KA    E +        + YN G+C     QYE AI    +A+ ++++S
Sbjct: 196 KQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEES 255

Query: 68  KYFFNLAYCYSMI 80
               +L   Y +I
Sbjct: 256 NILPSLPQAYFLI 268



 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 16/113 (14%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKA-------LDNDECKCHSYYNAGVCYIKLKQYEKAIE 55
           NF +G    + R Y  AI ++KKA        D  E K   ++     Y  +KQ   +++
Sbjct: 104 NFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIE-KAEFFFKMSESYYYMKQTYFSMD 162

Query: 56  MITKALELYQDSK-YFFNLAYCYSMINNN-------SKALRYFNLAWALDNAD 100
              +A E+Y++ + Y   L  C+S+   N         A+ +F  A+++  A+
Sbjct: 163 YARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAE 215


>EIF3L_PANTR RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 564

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKALRY 89
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +  
Sbjct: 310 ECQVTTYYYVGFAYLTMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHA 369

Query: 90  FNLAWALDNADIDCEKAISLIL 111
             LA AL    +  +++I L L
Sbjct: 370 L-LAIALTMYPMRIDESIHLQL 390


>EIF3L_MOUSE RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 564

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKALRY 89
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +  
Sbjct: 310 ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHA 369

Query: 90  FNLAWALDNADIDCEKAISLIL 111
             LA AL    +  +++I L L
Sbjct: 370 L-LAIALTMYPMRIDESIHLQL 390


>EIF3L_HUMAN RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 564

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKALRY 89
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +  
Sbjct: 310 ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHA 369

Query: 90  FNLAWALDNADIDCEKAISLIL 111
             LA AL    +  +++I L L
Sbjct: 370 L-LAIALTMYPMRIDESIHLQL 390


>EIF3L_CHICK RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;
          Length = 564

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKALRY 89
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +  
Sbjct: 310 ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHA 369

Query: 90  FNLAWALDNADIDCEKAISLIL 111
             LA AL    +  +++I L L
Sbjct: 370 L-LAIALTMYPMRIDESIHLQL 390


>EIF3L_BOVIN RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 564

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKALRY 89
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +  
Sbjct: 310 ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHA 369

Query: 90  FNLAWALDNADIDCEKAISLIL 111
             LA AL    +  +++I L L
Sbjct: 370 L-LAIALTMYPMRIDESIHLQL 390


>TTC12_MOUSE RecName: Full=Tetratricopeptide repeat protein 12;     
              Short=TPR repeat protein 12;
          Length = 704

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGNE +   +Y  AI +Y + L   +     Y N    +IKL  Y+KA+     AL+  +
Sbjct: 111 KGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWALKCDE 170

Query: 66  D-SKYFFNLAYCYSMINNNSKA 86
           + +K +F++   +  + N SKA
Sbjct: 171 NCTKAYFHMGKAHVALKNYSKA 192


>PPP5_RAT RecName: Full=Serine/threonine-protein phosphatase 5;   
               Short=PP5;         EC=3.1.3.16;AltName:
          Full=Protein phosphatase T;
          Length = 499

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 5  SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
          ++ N+ +  ++Y +AI +Y +A++ +      Y N  + Y++ + Y  A+   T+A+EL 
Sbjct: 33 TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL- 91

Query: 65 QDSKY 69
           D KY
Sbjct: 92 -DKKY 95


>PPP5_HUMAN RecName: Full=Serine/threonine-protein phosphatase 5; 
                 Short=PP5;         EC=3.1.3.16;AltName:
          Full=Protein phosphatase T;
          Length = 499

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 5  SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
          ++ N+ +  ++Y +AI +Y +A++ +      Y N  + Y++ + Y  A+   T+A+EL 
Sbjct: 33 TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL- 91

Query: 65 QDSKY 69
           D KY
Sbjct: 92 -DKKY 95


>DNJC7_MOUSE RecName: Full=DnaJ homolog subfamily C member
           7;AltName: Full=Tetratricopeptide repeat protein
           2;AltName: Full=TPR repeat protein 2;
          Length = 494

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN  Y  ++Y++A NYY KA+D        Y N     + L ++ +A+    +++ L  
Sbjct: 34  QGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRL-D 92

Query: 66  DS--KYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEK 105
           DS  +       C+  + N   A R F  A  LD+ +   ++
Sbjct: 93  DSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ 134



 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 15/115 (13%)

Query: 7   GNELYNTRNYSDAINYYKKAL----DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           GN+ +   NY  A   Y +AL    +N +     Y N G    KL+Q E AIE  T A++
Sbjct: 263 GNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVK 322

Query: 63  LYQD-SKYFFNLAYCYSMINNNSKALRYFNLAW----------ALDNADIDCEKA 106
           L     K +   A CY       +A+R +   +           L NA ++ +K+
Sbjct: 323 LDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKS 377


>DNJC7_HUMAN RecName: Full=DnaJ homolog subfamily C member
           7;AltName: Full=Tetratricopeptide repeat protein
           2;AltName: Full=TPR repeat protein 2;
          Length = 494

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN  Y  ++Y++A NYY KA+D        Y N     + L ++ +A+    +++ L  
Sbjct: 34  QGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRL-D 92

Query: 66  DS--KYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEK 105
           DS  +       C+  + N   A R F  A  LD+ +   ++
Sbjct: 93  DSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ 134



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 15/115 (13%)

Query: 7   GNELYNTRNYSDAINYYKKAL----DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           GN+ +   NY  A   Y +AL    +N +     Y N G    KL++ + AIE  T A++
Sbjct: 263 GNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVK 322

Query: 63  LYQD-SKYFFNLAYCYSMINNNSKALRYFNLAW----------ALDNADIDCEKA 106
           L     K +   A CY       +A+R +   +           L NA ++ +K+
Sbjct: 323 LDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKS 377


>CDC23_DICDI RecName: Full=Anaphase-promoting complex subunit 8;    
               Short=APC8;AltName: Full=Cell division cycle protein
           23 homolog;
          Length = 592

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 38/142 (26%), Positives = 57/142 (40%), Gaps = 38/142 (26%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYN--------------------------- 39
           G+E    +N S AIN Y+KA+D +     ++Y                            
Sbjct: 400 GHEFLEIKNVSAAINAYRKAVDINPRDYRAWYGLGQTYQLLKLPLYSLYYFKKATTLRPY 459

Query: 40  -------AGVCYIKLKQYEKAIEMITKALELYQDSKYFFN-LAYCYSMINNNSKALRYF- 90
                  AG CY  +++  +AI+   +A E Y   +   N LA  Y  I NN KA  Y+ 
Sbjct: 460 DPRMWCAAGGCYEFIERIPEAIKCYERAEENYDRERVAINKLAKLYQEIQNNEKAAFYYK 519

Query: 91  -NLAWALDNADIDCEKAISLIL 111
            NL +  D   ID ++ I  +L
Sbjct: 520 KNLYYC-DQEKIDGQEIIDALL 540


>APC8_SCHPO RecName: Full=Anaphase-promoting complex subunit
           8;AltName: Full=20S cyclosome/APC complex protein
           apc8;AltName: Full=Cell untimely torn protein 23;
          Length = 565

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 1/111 (0%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-YQ 65
           GN       +  A+ Y+K+AL  +     ++   G  Y++LK    AIE    A+++  +
Sbjct: 345 GNYYSLLSEHEKAVTYFKRALQLNRNYLSAWTLMGHEYVELKNTHAAIESYRLAVDVNRK 404

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
           D + ++ L   Y +++ +  AL YF  A AL   D    +A+     KI +
Sbjct: 405 DYRAWYGLGQTYEVLDMHFYALYYFQRATALRPYDQRMWQALGNCYEKIDR 455


>TT21B_HUMAN RecName: Full=Tetratricopeptide repeat protein 21B;    
               Short=TPR repeat protein 21B;
          Length = 1316

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 29/90 (32%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKAL----- 61
           G  L  T NYS AI YY+ AL   + K +  Y+     +KLK Y+KA +++  AL     
Sbjct: 763 GKALIKTHNYSMAITYYEAALKTGQ-KNYLCYDLAELLLKLKWYDKAEKVLQHALAHEPV 821

Query: 62  ----ELYQDSKYFFNLAYCYSMINNNSKAL 87
                L +D +    LA  YS +     A+
Sbjct: 822 NELSALMEDGRCQVLLAKVYSKMEKLGDAI 851


>STIP1_DICDI RecName: Full=Protein STIP1 homolog;
          Length = 564

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 9/103 (8%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  + +  AI +Y KA++ D     +  N     I+ ++ ++AIE   KALE  Q+
Sbjct: 251 GNKAYAKKEFEQAIVHYDKAVELDSSDILAMNNKAAVLIEQQKLDEAIETCKKALEKAQE 310

Query: 67  --------SKYFFNLAYCYSMINNNSKALRYFNLAWALD-NAD 100
                   SK +  L   Y   N    A + ++ A   D NAD
Sbjct: 311 IRADYRVKSKVYTRLGNIYLKKNQLDDAYKAYSSAVLEDKNAD 353



 Score = 33.5 bits (75), Expect = 0.001
 Identities = 16/62 (25%), Positives = 33/62 (53%)

Query: 5  SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
          ++GN  +++++Y+ A+  + +A++ D      Y N     + L + E A+    KA+EL 
Sbjct: 13 NQGNAAFSSKDYNSAVKCFDQAIELDPSNHILYSNRSASLLALDKNEDALTDAKKAIELK 72

Query: 65 QD 66
           D
Sbjct: 73 PD 74


>DNJC7_PONAB RecName: Full=DnaJ homolog subfamily C member 7;
          Length = 494

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN  Y  ++Y++A NYY KA+D        Y N     + L ++ +A+    +++ L  
Sbjct: 34  QGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRL-D 92

Query: 66  DSKYFFNL--AYCYSMINNNSKALRYFNLAWALDNADIDCEK 105
           DS     L    C+  + N   A R F  A  LD+ +   ++
Sbjct: 93  DSFVRGRLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQ 134



 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 7   GNELYNTRNYSDAINYYKKAL----DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           GN+ +   NY  A   Y +AL    +N +     Y N G    KL++ + AIE  T A++
Sbjct: 263 GNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVK 322

Query: 63  LYQD-SKYFFNLAYCYSMINNNSKALR 88
           L     K +   A CY       +A+R
Sbjct: 323 LDDTYIKAYLRRAQCYMDTEQYEEAVR 349


>BBS4_HUMAN RecName: Full=Bardet-Biedl syndrome 4 protein;
          Length = 519

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 23/84 (27%), Positives = 39/84 (46%)

Query: 10  LYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKY 69
           L+    +  AI  Y +A   ++      +N GVCYI LKQ+ KA + +  AL L +    
Sbjct: 111 LFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLT 170

Query: 70  FFNLAYCYSMINNNSKALRYFNLA 93
           +  L   + +  +  KA+  +  A
Sbjct: 171 YIMLGKIHLLEGDLDKAIEVYKKA 194


>Y798_METJA RecName: Full=TPR repeat-containing protein MJ0798;
          Length = 334

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 19  AINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL----YQDSKYFFNLA 74
           AINY+KKAL+               Y KLK+Y+ A++   KAL+L    ++  + + ++ 
Sbjct: 221 AINYFKKALELKPDDIDLILKVAFTYFKLKKYKHALKYFEKALKLNPNVFELEQIYESMG 280

Query: 75  YCYSMINNNSKALRYF 90
             Y  +  + KA+  F
Sbjct: 281 RIYIYLGEDEKAIECF 296



 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 27/111 (24%), Positives = 42/111 (37%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KG  L        AI Y++KA + D     + +  G  Y  +   + +I+   K LEL  
Sbjct: 141 KGYALLKLYKRDLAIKYFEKASEKDRNNYKALFGLGKSYYLMSDNKNSIKYFEKVLELNP 200

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
           +               +  KA+ YF  A  L   DID    ++    K+ K
Sbjct: 201 NDVXXXXXXXXXXXXXDCEKAINYFKKALELKPDDIDLILKVAFTYFKLKK 251



 Score = 33.5 bits (75), Expect = 0.001
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 34/107 (31%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITK----ALELYQDS---KYF--------------FNLA 74
           +YY A  CY K  +  +  E++ K     L+LY+     KYF              F L 
Sbjct: 117 AYYEALFCYNKALELNQNTELLCKKGYALLKLYKRDLAIKYFEKASEKDRNNYKALFGLG 176

Query: 75  YCYSMINNNSKALRYFNLAWALDNADI-------------DCEKAIS 108
             Y ++++N  +++YF     L+  D+             DCEKAI+
Sbjct: 177 KSYYLMSDNKNSIKYFEKVLELNPNDVXXXXXXXXXXXXXDCEKAIN 223


>RAPSN_CHICK RecName: Full=43 kDa receptor-associated protein of the
           synapse;         Short=RAPsyn;AltName:
           Full=Acetylcholine receptor-associated 43 kDa protein;
          Length = 412

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 9/115 (7%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKAL------DNDECKCHSYYNAGVCYIKLKQYEKAIEM 56
           + S GN       +  A+  ++KAL      D+   +C    + G  Y ++K YEKA+  
Sbjct: 126 SLSMGNAFLGLSIFQKALECFEKALRYAHNNDDKMLECRVCCSLGNFYAQIKDYEKALFF 185

Query: 57  ITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLIL 111
             KA EL  D  Y    +  Y  ++    A+ Y  L    D  D  CE+++ + L
Sbjct: 186 PCKAAELVND--YGAGWSLKYRAMSQYHMAVAYRKLGRLADAMDC-CEESMKIAL 237


>PPP5_MOUSE RecName: Full=Serine/threonine-protein phosphatase 5; 
                 Short=PP5;         EC=3.1.3.16;AltName:
          Full=Protein phosphatase T;
          Length = 499

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 5  SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
          ++ N+ +  ++Y +AI +Y +A++ +      Y N  + Y++ + Y  A+   T+A+EL 
Sbjct: 33 TQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIEL- 91

Query: 65 QDSKY 69
           D KY
Sbjct: 92 -DKKY 95


>EIF3L_XENTR RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 562

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKAL 87
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q +K  F    Y Y MIN  ++ +
Sbjct: 308 ECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQM 365


>CTR9_XENTR RecName: Full=RNA polymerase-associated protein CTR9
           homolog;AltName: Full=SH2 domain-binding protein 1;
          Length = 1172

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 11  YNTRNYSDAINYYKKAL-DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +N ++Y  A+ YYKKAL  N  C        G C++KL + +KA     +AL+L
Sbjct: 174 FNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDL 227


>CTR9_XENLA RecName: Full=RNA polymerase-associated protein CTR9
           homolog;AltName: Full=SH2 domain-binding protein 1;
          Length = 1157

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 11  YNTRNYSDAINYYKKAL-DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +N ++Y  A+ YYKKAL  N  C        G C++KL + +KA     +AL+L
Sbjct: 174 FNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDL 227


>TOM70_NEUCR RecName: Full=Mitochondrial import receptor subunit
           tom-70;AltName: Full=Translocase of outer membrane
           tom-70;AltName: Full=Mitochondrial precursor proteins
           import receptor;
          Length = 624

 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 11/116 (9%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYY--NAGVCYIKLKQYEKAIEMITKALELY 64
           GN+ Y +++++ AI+ Y KA+    CK    Y  N   C+  L Q+E+ +   T AL+L 
Sbjct: 143 GNKAYGSKDFNKAIDLYSKAI---ICKPDPVYYSNRAACHNALAQWEQVVADTTAALKL- 198

Query: 65  QDSKYFFNL---AYCYSMINNNSKALRYFNLAWALDN-ADIDCEKAISLILSKISK 116
            D  Y   L   A  Y  ++    AL  F  +  +D   +    +A+  +L K ++
Sbjct: 199 -DPHYVKALNRRANAYDQLSRYRHALLDFTASCIIDGFRNEQSAQAVERLLKKFAE 253


>PPT1_YEAST RecName: Full=Serine/threonine-protein phosphatase T;   
                Short=PPT;         EC=3.1.3.16;
          Length = 513

 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 30  DECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL-YQDSKYFFNLAYCYSMINNNSKALR 88
           D  K     N G  ++K K + KAIE  T+A++L    S YF N A+ +  ++N   AL 
Sbjct: 8   DRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 89  YFNLAWALDNADIDCEKAISL 109
                        DC++AI L
Sbjct: 68  -------------DCDEAIKL 75


>FKBP5_RHIOR RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 385

 Score = 37.7 bits (86), Expect = 5e-05
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 14  RNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           ++Y  AI   +KALD D  K  +YY  G  Y++   YE ++  I   LE
Sbjct: 191 KHYDHAIEVCQKALDRDMTKIKAYYRIGQAYMEKGDYESSLTFIRIGLE 239



 Score = 33.5 bits (75), Expect = 0.001
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 10/77 (12%)

Query: 39  NAGVCYIKLKQYEKAIEMITKALELYQDS-KYFFNLAYCYSMINNNSKALRYFNLAWALD 97
           N G C++KLK Y+ AIE+  KAL+      K ++ +   Y    +   +L +        
Sbjct: 182 NIGACHLKLKHYDHAIEVCQKALDRDMTKIKAYYRIGQAYMEKGDYESSLTFIR------ 235

Query: 98  NADIDCEKAISLILSKI 114
              I  E AI L+   I
Sbjct: 236 ---IGLETAIGLLAQSI 249


>UN45A_RAT RecName: Full=Protein unc-45 homolog A;       
          Short=UNC-45A;AltName: Full=Smooth muscle
          cell-associated protein 1;         Short=SMAP-1;
          Length = 944

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 6  KGNELYNTRNYSDAINYYKKALD-----NDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
          +GNEL+   +Y  A+  Y +AL       D+   H   N   C++KL+ Y KA    +KA
Sbjct: 27 EGNELFKCGDYEGALTAYTQALSLGATPQDQAILHR--NRAACHLKLEDYSKAESEASKA 84

Query: 61 LE 62
          +E
Sbjct: 85 IE 86


>UN45A_MOUSE RecName: Full=Protein unc-45 homolog A;       
          Short=UNC-45A;AltName: Full=Stromal membrane-associated
          protein 1;         Short=SMAP-1;
          Length = 944

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 6  KGNELYNTRNYSDAINYYKKALD-----NDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
          +GNEL+   +Y  A+  Y +AL       D+   H   N   C++KL+ Y KA    +KA
Sbjct: 27 EGNELFKCGDYEGALTAYTQALSLGATPQDQAILHR--NRAACHLKLEDYSKAESEASKA 84

Query: 61 LE 62
          +E
Sbjct: 85 IE 86


>UN45A_HUMAN RecName: Full=Protein unc-45 homolog A;       
          Short=UNC-45A;AltName: Full=GCUNC-45;AltName:
          Full=Smooth muscle cell-associated protein 1;
          Length = 944

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 6  KGNELYNTRNYSDAINYYKKALDND---ECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
          +GNEL+   +Y  A+  Y +AL  D   + +   + N   C++KL+ Y+KA    +KA+E
Sbjct: 27 EGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIE 86


>TTC12_HUMAN RecName: Full=Tetratricopeptide repeat protein 12;     
              Short=TPR repeat protein 12;
          Length = 705

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           KGNE +   NY  AI  Y + L+  +     Y N    Y+KL+ YEKA+     AL+  +
Sbjct: 112 KGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWALKCDE 171

Query: 66  D-SKYFFNLAYCYSMINNNS 84
             +K +F++      + N S
Sbjct: 172 KCTKAYFHMGKANLALKNYS 191


>TOM70_SCHPO RecName: Full=Probable mitochondrial import receptor
           subunit tom70;AltName: Full=Translocase of outer
           membrane 40 kDa subunit;
          Length = 625

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN+ Y  + Y++AI+YY +A+         + N   CY  +  +E+ I+  ++AL L  D
Sbjct: 158 GNKAYGQKEYANAIDYYTQAITCSHDPIF-FSNRAACYAAIGDFEQVIKDTSEALSL--D 214

Query: 67  SKYFFNL---AYCYSMINNNSKALRYFNLAWALDN-ADIDCEKAISLILSKISK 116
           S Y   L   +  Y  +    +AL    ++   D  A+      +  +L K+++
Sbjct: 215 SSYVKALNRRSAAYEQLGKLDEALMDSTVSCIFDGFANESMTATVERLLKKVAE 268


>SGTB_RAT RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta;AltName:
           Full=Beta-SGT;AltName: Full=Small glutamine-rich protein
           with tetratricopeptide repeats 2;
          Length = 304

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN      NY+ A++ Y +A++ D      Y N      KL  Y  AI+   KA+ +  
Sbjct: 91  EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAI-- 148

Query: 66  DSKY---FFNLAYCYSMINNNSKALRYFNLAWALD 97
           DSKY   +  +    + +N   +A+  +  A  LD
Sbjct: 149 DSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLD 183


>SGTB_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta;AltName: Full=Beta-SGT;
          Length = 304

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN      NY+ A++ Y +A++ D      Y N      KL  Y  AI+   KA+ +  
Sbjct: 91  EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAI-- 148

Query: 66  DSKY---FFNLAYCYSMINNNSKALRYFNLAWALD 97
           DSKY   +  +    + +N   +A+  +  A  LD
Sbjct: 149 DSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLD 183


>PPT1_SCHPO RecName: Full=Serine/threonine-protein phosphatase T;   
                Short=PPT;         EC=3.1.3.16;
          Length = 473

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++ N+     +   AI+ Y KA++ D      Y N  + ++K + Y  AI   +KA+E  
Sbjct: 10  NEANKFLKEGHIVQAIDLYTKAIELDSTNAILYSNRSLAHLKSEDYGLAINDASKAIECD 69

Query: 65  QD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAI 107
            + +K +F  A  +  I    +A+  F  A AL  +D    K +
Sbjct: 70  PEYAKAYFRRATAHIAIFQPKEAVGDFRKALALAPSDPAARKKL 113


>FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase;        
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 559

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 27/119 (22%)

Query: 6   KGNELYNTRNYSDAINYYKKAL---------------DNDECKCHSYYNAGVCYIKLKQY 50
           +GN L+ +  Y+ A   Y+KA                 + + K     N   C +KLK Y
Sbjct: 407 EGNALFKSGKYARASKRYEKAAKFIEYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDY 466

Query: 51  EKAIEMITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISL 109
           ++A ++ TK LEL  DS+   N+   Y       +A  Y  LA  L+ A++D +KA+ +
Sbjct: 467 KQAEKLCTKVLEL--DSR---NVKALY------RRAQAYTQLA-DLELAEVDIKKALEI 513


>BBS4_DROME RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
          Length = 486

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 13  TRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-QDSKYFF 71
           ++   +A  Y++ A+ +   K  SY      Y K KQY+KAIE++   L L  ++S+   
Sbjct: 160 SQQQDEARTYFELAVQSGR-KLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLI 218

Query: 72  NLAYCYSMINNNSKA 86
            ++  Y  IN   KA
Sbjct: 219 EISVLYLKINETQKA 233


>TTC28_HUMAN RecName: Full=Tetratricopeptide repeat protein 28;     
              Short=TPR repeat protein 28;
          Length = 2481

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           + N+  +  ++  AI  Y +AL  D   C  Y N    Y+K++QY+KA++   KA
Sbjct: 64  QSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDDAIKA 118


>SPY_ARATH RecName: Full=Probable UDP-N-acetylglucosamine--peptide
           N-acetylglucosaminyltransferase SPINDLY;       
           EC=2.4.1.-;
          Length = 914

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITK-ALELYQ 65
           G  L    N  + I  Y +AL  D     +YYN GV Y ++ QY+ A+    K ALE   
Sbjct: 159 GTSLKLAGNTQEGIQKYYEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKAALERPM 218

Query: 66  DSKYFFNLAYCY 77
            ++ + N+   Y
Sbjct: 219 YAEAYCNMGVIY 230


>SGTB_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta;AltName:
           Full=Beta-SGT;AltName: Full=Small glutamine-rich protein
           with tetratricopeptide repeats 2;
          Length = 304

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +GN      NY+ A++ Y +A++ D      Y N      KL  Y  AI+   KA+ +  
Sbjct: 91  EGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAI-- 148

Query: 66  DSKY---FFNLAYCYSMINNNSKALRYFNLAWALD 97
           DSKY   +  +    + +N   +A+  +  A  LD
Sbjct: 149 DSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLD 183


>EIF3L_XENLA RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 562

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKAL 87
           EC+  +YY  G  Y+ +++Y+ +I +    L   Q +K  F    Y Y MIN  ++ +
Sbjct: 308 ECQVTTYYYVGFAYLMMRRYQDSIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQM 365


>EIF3L_DANRE RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;AltName:
           Full=Eukaryotic translation initiation factor 3 subunit
           E-interacting protein;
          Length = 576

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 31  ECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFF-NLAYCYSMINNNSKAL 87
           EC+  +YY  G  Y+ +++Y+ AI +    L   Q ++  F    Y Y MIN  ++ +
Sbjct: 309 ECQITTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTRNMFQRTTYKYEMINKQNEQM 366


>CYC8_YEAST RecName: Full=General transcriptional corepressor
           CYC8;AltName: Full=Glucose repression mediator protein
           CYC8;
          Length = 966

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 2/102 (1%)

Query: 15  NYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-QDSKYFFNL 73
           +Y+ A + +++A++ D      + + GV Y ++ QY  A++  T+A+ L    S+ +++L
Sbjct: 311 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 370

Query: 74  AYCYSMINNN-SKALRYFNLAWALDNADIDCEKAISLILSKI 114
              Y   NN  S AL  +  A  LD  ++   + +  +  ++
Sbjct: 371 GTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQL 412


>TTC30_ANOGA RecName: Full=Tetratricopeptide repeat protein 30
           homolog;         Short=TPR repeat protein 30 homolog;
          Length = 654

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           +G  LY    Y DA+  Y  AL       H  YNA +C+ + K+  +A+  I + +E
Sbjct: 151 EGCLLYQANMYEDALQRYVSALQAGGFNPHVAYNAALCHYRRKENSQALNYIAEIVE 207


>TMTC3_MOUSE RecName: Full=Transmembrane and TPR repeat-containing
           protein 3;
          Length = 920

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           S+G  L        A   Y KAL+ D      +YN  + YI+LK+  +A++   +ALEL 
Sbjct: 573 SRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELN 632

Query: 65  QDSKY-FFNLA 74
              K   FN A
Sbjct: 633 PKHKLALFNSA 643


>SWA2_YEAST RecName: Full=Auxilin-like clathrin uncoating factor
           SWA2;AltName: Full=DnaJ-related protein SWA2;       
           Short=J protein SWA2;
          Length = 668

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 5   SKGNELYNTRNYSDAINYYKKALD----NDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           +KG  L+   +Y +++  Y+K+L+    N   +  +  N     +K+ +Y K+IE  + A
Sbjct: 379 AKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMA 438

Query: 61  LELYQDSKYFFNLAYCYSMINNNSKALRYFNLAW 94
           LEL+  SK  +          +NS   R FN  W
Sbjct: 439 LELFPSSKAKWKNKI------SNSDPERSFNDIW 466


>SUGT1_DICDI RecName: Full=Protein SUGT1 homolog;
          Length = 387

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 21/99 (21%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 1  MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
          M    +GN  +    Y +A+  Y KA         +++    C+ KL   ++A+  I  +
Sbjct: 1  MEQLKEGNSYFVDEQYDEALKCYDKACLELSNNAEAFFKRSQCHSKLSNLKEALSDINTS 60

Query: 61 LEL-YQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDN 98
          ++L   +SKY+         +     AL+ F    ++D+
Sbjct: 61 IKLDSNNSKYYLKKGQLCFELEEFDTALKTFEKGQSIDS 99


>CTR9_YEAST RecName: Full=RNA polymerase-associated protein
           CTR9;AltName: Full=Cln three-requiring protein
           9;AltName: Full=Centromere-binding factor 1-dependent
           protein 1;
          Length = 1077

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 19/78 (24%), Positives = 35/78 (44%)

Query: 15  NYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLA 74
           +Y  AI  Y+K L  D     +     + + + K+   A+E++ K  +   +     NLA
Sbjct: 679 SYLKAIQLYQKVLQVDPFNIFAAQGLAIIFAESKRLGPALEILRKVRDSLDNEDVQLNLA 738

Query: 75  YCYSMINNNSKALRYFNL 92
           +CY  +    KA+  + L
Sbjct: 739 HCYLEMREYGKAIENYEL 756


>CDC23_YEAST RecName: Full=Anaphase-promoting complex subunit
           CDC23;AltName: Full=Cell division control protein 23;
          Length = 626

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 21/84 (25%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 14  RNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-QDSKYFFN 72
           + +  +I Y+++AL  D+   +++   G  +++L     AIE   +A+++  +D K +F 
Sbjct: 411 QEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFG 470

Query: 73  LAYCYSMINNNSKALRYFNLAWAL 96
           L   Y++++ +  +L YF  A  L
Sbjct: 471 LGQAYALLDMHLYSLYYFQKACTL 494


>BBS4_XENTR RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
          Length = 516

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 11  YNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ-DSKY 69
           Y  + Y  AI+  K+AL          YN G+ ++ ++QY  A   ++ A+ L+  ++  
Sbjct: 278 YGKKKYVAAISCLKRALYLSPFDWRVLYNLGLVHLSMQQYASAFHFLSAAISLHHGNAGL 337

Query: 70  FFNLAYCYSMINNNSKALRYFNLAWALDNAD 100
           +  LA   + +++   A   +  A +LD  D
Sbjct: 338 YMLLAVALTYLDDIENAKSSYQQAASLDQTD 368



 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 10  LYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           L+    +  A+  Y +A   ++      +N GVCY+ LK   K+ E +T AL+L++
Sbjct: 108 LFLLGKHKAAVEVYNEAARLNQKDWEICHNLGVCYLFLKDLSKSKEQLTLALQLHR 163


>APC3_SCHPO RecName: Full=Anaphase-promoting complex subunit
           3;AltName: Full=20S cyclosome/APC complex protein
           apc3;AltName: Full=Nuclear alteration protein 2;
          Length = 665

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 14  RNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD-SKYFFN 72
           ++Y  A+++Y +A   DE    + +      I L  ++KA+  + +   +  D +   F 
Sbjct: 547 KDYKKALDFYDRACKLDEKSSLARFKKAKVLILLHDHDKALVELEQLKAIAPDEANVHFL 606

Query: 73  LAYCYSMINNNSKALRYFNLAWALD 97
           L   +  +   + AL++F +AW LD
Sbjct: 607 LGKIFKQMRKKNLALKHFTIAWNLD 631


>STI1_YEAST RecName: Full=Heat shock protein STI1;
          Length = 589

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 9/94 (9%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++GN+ Y  R + +AI +Y KA +  +   +    A   Y K  +YE AI  +  A+E  
Sbjct: 267 AEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEK-GEYETAISTLNDAVEQG 325

Query: 65  QD--------SKYFFNLAYCYSMINNNSKALRYF 90
           ++        SK F  +   Y  + +  K + Y+
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLGDLKKTIEYY 359



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 6  KGNELYNTRNYSDAINYYKKALDNDECKCHSYY-NAGVCYIKLKQYEKAIEMITKALEL 63
          +GN  +  ++Y  AI  + KA++  E   H  Y N   CY  LK++  A+    + +++
Sbjct: 11 QGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKI 69



 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 37 YYNAGVCYIKLKQYEKAIEMITKALELYQDSKY--FFNLAYCYSMINNNSKALRYFN 91
          Y   G      K Y+KAIE+ TKA+E+ +   +  + N + CY+ +   S AL   N
Sbjct: 8  YKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64


>SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptide
           N-acetylglucosaminyltransferase SPINDLY;       
           EC=2.4.1.-;AltName: Full=HvSPY;
          Length = 944

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITK-ALELYQ 65
           G  L    N  D I  Y +AL+ D     +YYN GV Y ++ Q++ A+    K ALE   
Sbjct: 150 GTSLKLAGNTEDGIQKYCEALEVDSHYAPAYYNLGVVYSEMMQFDVALTCYEKAALERPL 209

Query: 66  DSKYFFNLAYCY 77
            ++ + N+   Y
Sbjct: 210 YAEAYCNMGVIY 221


>FKBP5_MOUSE RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 456

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 15/73 (20%)

Query: 6   KGNELYNTRNYSDAINYYKK---------ALDNDECKCH------SYYNAGVCYIKLKQY 50
           KG   +    Y+ A+  Y+K          L   E K        ++ N  +CY+KL++Y
Sbjct: 274 KGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREY 333

Query: 51  EKAIEMITKALEL 63
            KA+E   KAL L
Sbjct: 334 NKAVECCDKALGL 346


>DNJC7_DICDI RecName: Full=DnaJ homolog subfamily C member 7
           homolog;
          Length = 539

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 2   SNFSKGNELYNTRNYSDAINYYKKALDND----ECKCHSYYNAGVCYIKLKQYEKAIEMI 57
           S   +GNE + ++NY  A + + +AL  D          Y N     + L +  +AI   
Sbjct: 237 SKKKEGNEYFQSKNYQAAYDSFTEALSIDPKLETMNSQLYSNRAAALVHLNRISEAINDC 296

Query: 58  TKALELYQD-SKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAI 107
           T A+ +  +  K +   A C     N   A+R +  A +LD  + + ++ I
Sbjct: 297 TSAVTIDPNYGKAYIRRAQCQMKQENYEDAVRDYEKAQSLDPENGELQRNI 347


>CDC23_HUMAN RecName: Full=Cell division cycle protein 23
           homolog;AltName: Full=Anaphase-promoting complex subunit
           8;         Short=APC8;
          Length = 597

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-Q 65
           G+E    +N S AI  Y+ A++ ++    ++Y  G  Y  LK     +    +A +L   
Sbjct: 372 GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPN 431

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKI 114
           DS+    L  CY  +N   +A + +  A+A+     D EK   + L+K+
Sbjct: 432 DSRMLVALGECYEKLNQLVEAKKCYWRAYAVG----DVEKMALVKLAKL 476


>CDC23_BOVIN RecName: Full=Cell division cycle protein 23
           homolog;AltName: Full=Anaphase-promoting complex subunit
           8;         Short=APC8;
          Length = 597

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-Q 65
           G+E    +N S AI  Y+ A++ ++    ++Y  G  Y  LK     +    +A +L   
Sbjct: 372 GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPN 431

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKI 114
           DS+    L  CY  +N   +A + +  A+A+     D EK   + L+K+
Sbjct: 432 DSRMLVALGECYEKLNQLVEAKKCYWRAYAVG----DVEKMALVKLAKL 476


>Y1088_AQUAE RecName: Full=Uncharacterized protein aq_1088;
          Length = 761

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 11  YNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           Y+     +A +Y+++AL  +  K    YN GV ++   + EKA+++  +AL L  D
Sbjct: 114 YSQGKLEEAQHYWERALSLNPNKVEILYNLGVLHLNKGELEKALDLFERALRLKPD 169


>GPSM2_MOUSE RecName: Full=G-protein-signaling modulator 2;AltName:
           Full=Pins homolog;
          Length = 672

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 13/96 (13%)

Query: 7   GNELYNTRNYSDAINYYKKAL------DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           GN       +  A  YYKK L       +   +  S Y+ G  Y  L+ YEKAI+   K 
Sbjct: 242 GNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKH 301

Query: 61  LELYQDSK-------YFFNLAYCYSMINNNSKALRY 89
           L + Q+ K         ++L   Y+ + N+ +A+ +
Sbjct: 302 LAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHF 337


>STI1L_PLAFA RecName: Full=STI1-like protein;Flags: Fragment;
          Length = 252

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 15/60 (25%), Positives = 29/60 (48%)

Query: 7  GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
          GN+ +    Y +A+ Y+  A+ ND      Y N    +  L ++ +A+E   K + + +D
Sbjct: 14 GNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCISIKKD 73


>SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide
           N-acetylglucosaminyltransferase SPINDLY;       
           EC=2.4.1.-;AltName: Full=PhSPY;
          Length = 932

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITK-ALELYQ 65
           G  L    N  + I  Y +A+  D     +YYN GV Y ++ QY+ A+    K A+E   
Sbjct: 164 GTSLKLAGNSQEGIQKYYEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKAAIERPM 223

Query: 66  DSKYFFNLAYCY 77
            ++ + N+   Y
Sbjct: 224 YAEAYCNMGVIY 235


>SGT2_SCHPO RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein 2;
          Length = 317

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           +GN     ++Y  A++ Y KA++ D      Y N    Y +L Q+E A+E     L L
Sbjct: 89  EGNNAIAAKDYQKALDLYTKAIEIDPTSPVYYSNRAAAYNQLGQFENAVEDALTCLSL 146


>RAPSN_MOUSE RecName: Full=43 kDa receptor-associated protein of the
           synapse;         Short=RAPsyn;AltName:
           Full=Acetylcholine receptor-associated 43 kDa protein;
          Length = 412

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 9/115 (7%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKAL------DNDECKCHSYYNAGVCYIKLKQYEKAIEM 56
           + S GN       +  A+  ++KAL      D+   +C    + G  Y ++K YEKA+  
Sbjct: 126 SLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFF 185

Query: 57  ITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLIL 111
             KA EL  D  Y    +  Y  ++    A+ Y  L   L +A   CE+++ + L
Sbjct: 186 PCKAAELVND--YGKGWSLKYRAMSQYHMAVAY-RLLGHLGSAMECCEESMKIAL 237


>PEX5_CHICK RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 645

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 19/62 (30%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + Q 
Sbjct: 535 GATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALHMQQK 594

Query: 67  SK 68
           S+
Sbjct: 595 SR 596


>GPSM2_HUMAN RecName: Full=G-protein-signaling modulator 2;AltName:
           Full=Mosaic protein LGN;
          Length = 677

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 13/96 (13%)

Query: 7   GNELYNTRNYSDAINYYKKAL------DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           GN       +  A  YYKK L       +   +  S Y+ G  Y  L+ YEKAI+   K 
Sbjct: 242 GNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKH 301

Query: 61  LELYQ-------DSKYFFNLAYCYSMINNNSKALRY 89
           L + Q       + +  ++L   Y+ + N+ +A+ +
Sbjct: 302 LAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHF 337


>DNJC3_CHICK RecName: Full=DnaJ homolog subfamily C member 3;Flags:
           Precursor;
          Length = 503

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 16/60 (26%), Positives = 32/60 (53%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G +L      +DA++++  A++ D     +YY     Y+ + + + AI  ++K +EL QD
Sbjct: 44  GKKLLAAGQLADALSHFHAAIEGDSDNYIAYYRRATVYLAMGKSKAAIRDLSKVVELKQD 103


>BBS4_MOUSE RecName: Full=Bardet-Biedl syndrome 4 protein homolog;
          Length = 520

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 21/84 (25%), Positives = 38/84 (45%)

Query: 10  LYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKY 69
           L+    +  A   Y +A   ++      +N GVCY  LKQ+ KA + +  AL+L +    
Sbjct: 111 LFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLT 170

Query: 70  FFNLAYCYSMINNNSKALRYFNLA 93
           +  L   + +  +  KA+  +  A
Sbjct: 171 YIMLGKIHLLQGDLDKAIEIYKKA 194


>YCF3_CYAME RecName: Full=Photosystem I assembly protein ycf3;
          Length = 158

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 33  KCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD----SKYFFNLAYCYSMINNNSKALR 88
           K  SYY  G+      +Y +A+E    ALE  +D    S   +N+   Y+    + +AL 
Sbjct: 34  KAFSYYREGMAAQAEGEYAQALESYYHALEFEEDVIDRSYIIYNIGLIYASNGEDEQALE 93

Query: 89  YFNLAWALDNADIDCEKAISLILSK 113
           Y++ A  L+   +     I++I  K
Sbjct: 94  YYHQALELNPRLVQALNNIAVIYHK 118


>SPY_SOLLC RecName: Full=Probable UDP-N-acetylglucosamine--peptide
           N-acetylglucosaminyltransferase SPINDLY;       
           Short=LeSPY;         EC=2.4.1.-;
          Length = 931

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKA 60
           G  L    N  + I  Y +A+  D     +YYN GV Y ++ QY+ A+    KA
Sbjct: 164 GTSLKLAGNTQEGIQKYYEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKA 217


>PPID_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
               Short=PPIase D;         Short=Rotamase D;       
           EC=5.2.1.8;
          Length = 364

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 14/78 (17%)

Query: 4   FSKGNELYNTRNYSDAINYY--KKALDNDE----------CKCHSYYNAGVCYIKLKQYE 51
           F KG+     + Y  AI Y   K A D ++           K   Y N  +C +KL +Y 
Sbjct: 219 FKKGDHANAAKKYLKAIRYLNEKPAFDENDPKELEGKFAAIKIPCYLNRSMCALKLGEYS 278

Query: 52  KAIEMITKALELYQDSKY 69
           + +++ T  LE   DSKY
Sbjct: 279 ECVKVTTTVLE--YDSKY 294


>CDC27_YEAST RecName: Full=Anaphase-promoting complex subunit
           CDC27;AltName: Full=Cell division control protein
           27;AltName: Full=Anaphase-promoting complex subunit 3;
          Length = 758

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           +G+E  +  +   A   Y+KAL  D    ++YY  G   +KL QYE+A+    KA  +  
Sbjct: 580 QGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINP 639

Query: 66  DSKYFFNLAYC---YSMINNNSKALRYFNLA 93
            +     +  C      +    KAL+Y+ LA
Sbjct: 640 VNVVL--ICCCGGSLEKLGYKEKALQYYELA 668


>CDC23_MOUSE RecName: Full=Cell division cycle protein 23
           homolog;AltName: Full=Anaphase-promoting complex subunit
           8;         Short=APC8;
          Length = 597

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY-Q 65
           G+E    +N S AI  Y+ A++ ++    ++Y  G  Y  LK     +    +A +L   
Sbjct: 372 GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPN 431

Query: 66  DSKYFFNLAYCYSMINNNSKALRYFNLAWALDNAD 100
           DS+    L  CY  +N   +A + +  A+A+ + +
Sbjct: 432 DSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVE 466


>TTC9B_MOUSE RecName: Full=Tetratricopeptide repeat protein 9B;     
              Short=TPR repeat protein 9B;
          Length = 239

 Score = 34.7 bits (78), Expect = 4e-04
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 24  KKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDS-KYFFNLAYCYSMINN 82
           ++ ++N E +C+    A +   +L  YE+  E   K LE  Q + K  +     +  + +
Sbjct: 125 RRLVENTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGD 184

Query: 83  NSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
            ++ALRY   A + +  D +  + I L   K+++
Sbjct: 185 YARALRYLQEARSREPTDTNVLRYIQLTQLKMNR 218


>SPY_ORYSJ RecName: Full=Probable UDP-N-acetylglucosamine--peptide
           N-acetylglucosaminyltransferase SPINDLY;       
           EC=2.4.1.-;
          Length = 927

 Score = 34.7 bits (78), Expect = 4e-04
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITK-ALELYQ 65
           G  L    N  + I  Y +AL+ D     +YYN GV Y ++ Q++ A+    K ALE   
Sbjct: 150 GTSLKLAGNTEEGIQKYCEALEVDSHYAPAYYNLGVVYSEMMQFDLALTCYEKAALERPL 209

Query: 66  DSKYFFNLAYCY 77
            ++ + N+   Y
Sbjct: 210 YAEAYCNMGVIY 221


>SKI3_SCHPO RecName: Full=Superkiller protein 3;
          Length = 1389

 Score = 34.7 bits (78), Expect = 4e-04
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 19  AINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYS 78
           A++YY   L  D    H+    G+  I+ +QY  A++ +   L+ +++      L++CY 
Sbjct: 449 AMHYYDILLAADPRNYHALLGKGLVQIENEQYSDAVKTLGLLLDDHENDPSLSELSWCYF 508

Query: 79  MINNNSKAL 87
              N  KA+
Sbjct: 509 KTGNLPKAI 517


>YCF3_SYNJA RecName: Full=Photosystem I assembly protein ycf3;
          Length = 173

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 16  YSDAINYYKKAL---DNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALEL 63
           Y++A+  Y++AL    +DE + +  YN G+ Y    + +KA+E   +ALEL
Sbjct: 52  YAEALENYREALALEQDDEDRSYILYNMGLIYQSNGELDKALEYYHQALEL 102



 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 17  SDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD----SKYFFN 72
           +D I      +  ++ K  +YY  G+      +Y +A+E   +AL L QD    S   +N
Sbjct: 19  ADLILKLMPGVSPEQKKAFAYYRDGMAAQSEGEYAEALENYREALALEQDDEDRSYILYN 78

Query: 73  LAYCYSMINNNSKALRYFNLAWALD 97
           +   Y       KAL Y++ A  L+
Sbjct: 79  MGLIYQSNGELDKALEYYHQALELN 103


>YCF3_EMIHU RecName: Full=Photosystem I assembly protein ycf3;
          Length = 171

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 30  DECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD----SKYFFNLAYCYSMINNNSK 85
           +E K  SYY  G+       Y +A+E   +AL+L +D    S   +N+   Y    + SK
Sbjct: 29  EEKKAFSYYRYGMSAQSSGDYAEALENYYEALKLEEDPFDRSYILYNIGLIYGNNGDYSK 88

Query: 86  ALRYFNLAWALDN 98
           +L Y++ A  L++
Sbjct: 89  SLDYYHQALDLNS 101


>Y8921_DICDI RecName: Full=Putative uncharacterized protein
           DDB_G0278921;
          Length = 921

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 31/105 (29%), Positives = 42/105 (40%), Gaps = 25/105 (23%)

Query: 8   NELYNTRNYSDAINYYKKALDN-----DECKCHSYYNA-------------GVCYIKLKQ 49
           N L   +NY D I  +K  L N     D+ K  +Y                G+ Y K K 
Sbjct: 91  NFLTPNKNYDDLIEKFKVILLNLRFKEDDIKNFNYNGQHYLNDQHIKLNRKGIEYYKNKD 150

Query: 50  YEKAIEMIT-------KALELYQDSKYFFNLAYCYSMINNNSKAL 87
           Y  A++          K+L  +  SK   NLA  YS +NN  KA+
Sbjct: 151 YGNALKCYNQIEKSPFKSLSFHLISKNSLNLAILYSKLNNGPKAI 195


>Y856_MIMIV RecName: Full=Putative TPR repeat-containing protein
           R856;
          Length = 342

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 7   GNELYNTRNYSDAINYYKKALD-NDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           GN+      Y ++I+ + K    + +    S Y  G  Y    +Y KA+E   ++L+ Y+
Sbjct: 217 GNDSEALEKYQESIDIFNKIFTISHQAVAFSLYGIGTVYEFRSEYSKALEKYQESLQTYK 276

Query: 66  D-----SKY-FFNLAYC-------YSMINNNSKALRYFNLA 93
           +      KY  +++A C       Y +  N++++  Y N A
Sbjct: 277 NVYERSEKYQHYDIASCLYKIGLVYKLSGNDNESTTYLNQA 317


>Y1345_METJA RecName: Full=TPR repeat-containing protein MJ1345;
          Length = 314

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 29 NDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYSMINNNSKALR 88
          N+      Y++A    ++ + YEKA+ +I K LE+ +    +   A     +  N KAL 
Sbjct: 11 NESILWDEYFDA----LEKRNYEKALLLIDKILEVRESPDVYVRKARILRTLGENDKALE 66

Query: 89 YFNLAWAL 96
          YF+ A  L
Sbjct: 67 YFDKALKL 74


>TEX11_MOUSE RecName: Full=Testis-expressed sequence 11 protein;
          Length = 947

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 18/112 (16%)

Query: 4   FSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGV-----------CYIKLKQYEK 52
           + K +     + Y+DA+++Y  +L     K + Y  A +           CY+ LKQ +K
Sbjct: 407 WGKASRSVKVQKYADALHWYSYSL-----KLYEYDKADLDLIKLKRNMVSCYLSLKQLDK 461

Query: 53  AIEMITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCE 104
           A E I +  +  +D  + F   Y + +      A R   +  AL  + +D E
Sbjct: 462 AKEAIAEVEQ--KDPTHVFTRYYIFKIAIMEGDAFRALQVVSALKKSLMDGE 511


>SOLR_CLOAB RecName: Full=Sol locus transcriptional repressor;
          Length = 318

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 19  AINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYS 78
           A+ Y+ +A++       SY N    Y    +Y+KAIE   KA+ +   +  + +L   Y+
Sbjct: 118 ALKYFLRAVELQPNVGISYENLAWFYYLTGKYDKAIENFEKAISMGSTNSVYRSLGITYA 177

Query: 79  MINNNSKALRYFNLA 93
            I +  K+  Y   A
Sbjct: 178 KIGDYKKSEEYLKKA 192


>RPAP3_XENTR RecName: Full=RNA polymerase II-associated protein 3;
          Length = 657

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN  +    Y  AI+ Y + ++ D        N  + Y+K+++Y++A    T A+ L  D
Sbjct: 291 GNAYFKEGKYEIAIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISL--D 348

Query: 67  SKY---FFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
           + Y   F        M+    +A   F +   LD  +    K   L L KIS+
Sbjct: 349 ASYCKAFARRGTARIMLGKQKEAKEDFEMVLKLDPGN----KQAVLELEKISR 397


>RPAP3_XENLA RecName: Full=RNA polymerase II-associated protein 3;
          Length = 660

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           GN  +    Y  AI  Y + ++ D        N  + Y+K+++Y++A    T A+ L  D
Sbjct: 291 GNAYFKEGKYEIAIECYSQGMEADNTNALLPANRAMAYLKIQKYKEAEADCTLAISL--D 348

Query: 67  SKY---FFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK 116
           + Y   F        M+    +A   F +   LD  +    K   L L+KIS+
Sbjct: 349 ASYCKAFARRGTASIMLGKQKEAKEDFEMVLKLDPGN----KQAVLELAKISQ 397


>RAPSN_HUMAN RecName: Full=43 kDa receptor-associated protein of the
           synapse;         Short=RAPsyn;AltName:
           Full=Acetylcholine receptor-associated 43 kDa protein;
          Length = 412

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 3   NFSKGNELYNTRNYSDAINYYKKAL----DNDEC--KCHSYYNAGVCYIKLKQYEKAIEM 56
           + S GN       +  A+  ++KAL    +ND+   +C    + G  Y ++K YEKA+  
Sbjct: 126 SLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFF 185

Query: 57  ITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLIL 111
             KA EL   + Y    +  Y  ++    A+ Y  L   L +A   CE+++ + L
Sbjct: 186 PCKAAELV--NNYGKGWSLKYRAMSQYHMAVAY-RLLGRLGSAMECCEESMKIAL 237


>RAPH_BACSU RecName: Full=Response regulator aspartate phosphatase
           H;         EC=3.1.-.-;AltName: Full=PSP28;
          Length = 431

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 2   SNFSKGNELYNTRNYSDAINYYKKA------LDNDECKCHSYYNAGVCYIKLKQYEKAIE 55
           S F +G   ++ + Y +AI YY++A      + +D  K   ++     Y  +KQ   ++ 
Sbjct: 101 SLFFRGMYEFDQKEYVEAIGYYREAEKELPFVSDDIEKAEFHFKVAEAYYHMKQTHVSMY 160

Query: 56  MITKALELYQD 66
            I +AL++YQ+
Sbjct: 161 HILQALDIYQN 171


>PEX5_PICPA RecName: Full=Peroxisomal targeting signal receptor;    
               Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisomal protein PAS8;
          Length = 576

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           G  L N     +A+  Y +AL  +     + YN GV +I + +Y++A+E +   + L++
Sbjct: 463 GAALANYNKPEEAVEAYSRALQLNPNFVRARYNLGVSFINMGRYKEAVEHLLTGISLHE 521


>FKB70_ARATH RecName: Full=70 kDa peptidyl-prolyl isomerase;        
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 551

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 22/117 (18%)

Query: 2   SNFSKGNELYNTRNYSDAINY--YKKALDNDE------CKCHSYYNAGVCYIKLKQYEKA 53
           S F  G     ++ Y  A+ +  Y  +   +E       K     N   C +KLK Y++A
Sbjct: 409 SKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQA 468

Query: 54  IEMITKALELYQDS-KYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISL 109
            ++ TK LEL   + K  +  A  Y  +++             LD A+ D +KA+ +
Sbjct: 469 EKLCTKVLELESTNVKALYRRAQAYMELSD-------------LDLAEFDVKKALEI 512


>TTC14_HUMAN RecName: Full=Tetratricopeptide repeat protein 14;     
              Short=TPR repeat protein 14;
          Length = 770

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 16/122 (13%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE---L 63
           G + +    + DA+N Y KAL+ D+    +    G  Y       KAIE    ALE    
Sbjct: 314 GVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPT 373

Query: 64  YQDSKYFFNLAYCYSMINNNSK---------ALRYFNLAWALDNADIDCEKAISLILSKI 114
           +++++ +     C +++    +         A  Y+  A ALD    D E A+  +   +
Sbjct: 374 HRNARKYL----CQTLVERGGQLEEEEKFLNAESYYKKALALDETFKDAEDALQKLHKYM 429

Query: 115 SK 116
            K
Sbjct: 430 QK 431


>TMTC3_DROME RecName: Full=Transmembrane and TPR repeat-containing
           protein CG4050;
          Length = 926

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 32/62 (51%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           ++G+ L      + A   Y++AL  D      YYN GV +++  + ++A     KA+ELY
Sbjct: 636 NRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELY 695

Query: 65  QD 66
            +
Sbjct: 696 PE 697


>PEX5_MOUSE RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 639

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + + 
Sbjct: 529 GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRK 588

Query: 67  SK 68
           S+
Sbjct: 589 SR 590


>PEX5_HUMAN RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 639

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + + 
Sbjct: 529 GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRK 588

Query: 67  SK 68
           S+
Sbjct: 589 SR 590


>PEX5_DEBHA RecName: Full=Peroxisomal targeting signal receptor;    
               Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxin-5;
          Length = 603

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQ 65
           G  L N+    +A++ Y KAL+       + YN GV  I +  Y++A E +   L ++Q
Sbjct: 490 GASLANSNRSEEAVDAYFKALELKPTFVRARYNLGVSCINIGCYKEAAEHLLSGLSMHQ 548


>PEX5_CRIGR RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 640

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + + 
Sbjct: 530 GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRK 589

Query: 67  SK 68
           S+
Sbjct: 590 SR 591


>PEX5_CAVPO RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 640

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + + 
Sbjct: 530 GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRK 589

Query: 67  SK 68
           S+
Sbjct: 590 SR 591


>PEX5_BOVIN RecName: Full=Peroxisomal targeting signal 1 receptor;  
                 Short=PTS1 receptor;         Short=PTS1R;AltName:
           Full=Peroxisome receptor 1;
          Length = 640

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 7   GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           G  L N     +A+  Y++AL+       S YN G+  I L  + +A+E   +AL + + 
Sbjct: 530 GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRK 589

Query: 67  SK 68
           S+
Sbjct: 590 SR 591


>FKBP6_DICDI RecName: Full=FK506-binding protein 6;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 366

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 30/114 (26%), Positives = 45/114 (39%), Gaps = 20/114 (17%)

Query: 7   GNELYNTRNYSDAINYYKKA------------LDNDECKCHS------YYNAGVCYIKLK 48
           GN+ +   NY  +I +Y K+            L+  E K         Y N   C IKLK
Sbjct: 234 GNQFFQKSNYKKSIRHYVKSIWILNDPEQTLGLNEMENKLLKDTLIILYLNLASCNIKLK 293

Query: 49  QYEKAIEMITKALEL--YQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNAD 100
             ++ I    K LEL     +K+++ +   YS+      A R    A  L+  D
Sbjct: 294 DGKRGISNCEKILELGGNTTAKFYYRMGQAYSLNKQYDSAKRCLVQAIRLEPND 347


>EIF3L_USTMA RecName: Full=Eukaryotic translation initiation factor
           3 subunit L;         Short=eIF3l;
          Length = 668

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 24  KKALDNDECKCH--SYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYSMIN 81
           K  L N    CH  +YY  G  Y+ L++Y   I+  T  L      + +   +Y Y  IN
Sbjct: 324 KSGLINRVTACHVTAYYYVGFAYLMLRRYPDCIKSFTHILVFIMRLRQYHTRSYQYDQIN 383

Query: 82  NNS 84
             +
Sbjct: 384 KTA 386


>TTC30_AEDAE RecName: Full=Tetratricopeptide repeat protein 30
           homolog;         Short=TPR repeat protein 30 homolog;
          Length = 659

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 6   KGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALE 62
           +G  L+    + DA+  Y  AL       H  YNA +C+ + K+  +A+  I + +E
Sbjct: 149 EGCLLFQANMFEDALQRYVSALQAGGFNPHIAYNAALCHYRKKENSQALNYIAEIVE 205


>TAH1_YEAST RecName: Full=TPR repeat-containing protein associated
          with Hsp90;
          Length = 111

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 1  MSNFSK----GNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEM 56
          MS F K    GN L+    Y +A++ Y + +         Y N  +  IKL +Y +AI+M
Sbjct: 1  MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM 60

Query: 57 ITKAL 61
            + L
Sbjct: 61 CQQGL 65


>SYR_XANC5 RecName: Full=Arginyl-tRNA synthetase;       
           EC=6.1.1.19;AltName: Full=Arginine--tRNA ligase;        
           Short=ArgRS;
          Length = 562

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 23  YKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYSMINN 82
           Y +A    E  C    ++    ++L +Y + +E+  +ALE YQ ++Y   LA+ +    +
Sbjct: 462 YDQAHGLAELACLDDEHSLAVMLELSRYPEVVEIAGQALEPYQIAQYLRELAHAFHTWYH 521

Query: 83  NSKAL 87
           NSK L
Sbjct: 522 NSKVL 526


>SYR_XANAC RecName: Full=Arginyl-tRNA synthetase;       
           EC=6.1.1.19;AltName: Full=Arginine--tRNA ligase;        
           Short=ArgRS;
          Length = 562

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 23  YKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYSMINN 82
           Y +A    E  C    ++    ++L +Y + +E+  +ALE YQ ++Y   LA+ +    +
Sbjct: 462 YDQAHGLAELACLDDEHSLAVMLELSRYPEVVEIAGQALEPYQIAQYLRELAHAFHTWYH 521

Query: 83  NSKAL 87
           NSK L
Sbjct: 522 NSKVL 526


>SNAA_VITVI RecName: Full=Alpha-soluble NSF attachment protein;     
              Short=Alpha-SNAP;AltName:
           Full=N-ethylmaleimide-sensitive factor attachment
           protein alpha;
          Length = 289

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 9   ELYNT-RNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQD 66
           ELY   +N+  AI Y++KA D  + +  +   A  C  K+ Q+   +E   KA+++Y+D
Sbjct: 120 ELYELEQNFEQAIIYFEKAADIYQSE-EATTAANQCNAKVAQFAAQLEQYQKAIQIYED 177


>LBA1_MOUSE RecName: Full=Lupus brain antigen 1;
          Length = 2999

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 20/63 (31%), Positives = 28/63 (44%)

Query: 5   SKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELY 64
           +K N  YN   +++A    K+ L  D      YY AG   + L Q  +A  M  + L L 
Sbjct: 149 NKSNAFYNLGKWNEAFLAAKECLQWDPTYVKGYYRAGYSLLHLLQPYEAARMFFEGLRLL 208

Query: 65  QDS 67
           Q S
Sbjct: 209 QRS 211


>FKBP5_SAIBB RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;AltName: Full=51 kDa FK506-binding
           immunophilin;
          Length = 457

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITKALEL 63
           ++ N  +CY+KL++Y KA+E   KAL L
Sbjct: 319 AFLNLAMCYLKLREYTKAVECCDKALGL 346


>FKBP5_SAGOE RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;AltName: Full=51 kDa FK506-binding
           immunophilin;
          Length = 457

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITKALEL 63
           ++ N  +CY+KL++Y KA+E   KAL L
Sbjct: 319 AFLNLAMCYLKLREYAKAVECCDKALGL 346


>FKBP5_HUMAN RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 457

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITKALEL 63
           ++ N  +CY+KL++Y KA+E   KAL L
Sbjct: 319 AFLNLAMCYLKLREYTKAVECCDKALGL 346


>FKBP5_CERAE RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;AltName: Full=51 kDa FK506-binding
           immunophilin;
          Length = 457

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITKALEL 63
           ++ N  +CY+KL++Y KA+E   KAL L
Sbjct: 319 AFLNLAMCYLKLREYTKAVECCDKALGL 346


>FKBP5_AOTNA RecName: Full=FK506-binding protein 5;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;AltName: Full=51 kDa FK506-binding
           immunophilin;
          Length = 457

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 36  SYYNAGVCYIKLKQYEKAIEMITKALEL 63
           ++ N  +CY+KL++Y KA+E   KAL L
Sbjct: 319 AFLNLAMCYLKLREYTKAVECCDKALGL 346


>FKBP4_HUMAN RecName: Full=FK506-binding protein 4;       
           EC=5.2.1.8;AltName: Full=Peptidyl-prolyl cis-trans
           isomerase;         Short=PPIase;
          Length = 459

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 15/73 (20%)

Query: 6   KGNELYNTRNYSDAINYYKK---------ALDNDEC------KCHSYYNAGVCYIKLKQY 50
           +G   +    Y  A+  YKK         +  N+E       +  S+ N  +C++KL+ +
Sbjct: 276 RGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAF 335

Query: 51  EKAIEMITKALEL 63
             AIE   KALEL
Sbjct: 336 SAAIESCNKALEL 348


>DYHA_CHLRE RecName: Full=Dynein alpha chain, flagellar outer
            arm;AltName: Full=DHC alpha;
          Length = 4499

 Score = 33.5 bits (75), Expect = 0.001
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 11/85 (12%)

Query: 34   CHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSK-------YFFNLAYCYSMINNNSKA 86
            C S  N    Y  L+  E+ +E+  KAL  Y +SK       YF + A    +++N +  
Sbjct: 1412 CVSCCNREGLYANLETQERELEICKKALNDYMESKRRAFPRFYFVSSADLLDILSNGNNP 1471

Query: 87   LR---YFNLAW-ALDNADIDCEKAI 107
            +R   + N  + A+DN  +D E+ +
Sbjct: 1472 MRVQIHMNKCFQAIDNVRLDSEEVV 1496


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.321    0.138    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,644,701,296
Number of extensions: 402017554
Number of successful extensions: 1165832
Number of sequences better than 1.0e-03: 29257
Number of HSP's gapped: 1129564
Number of HSP's successfully gapped: 34597
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)