BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB81731.1 cper0 CPE2025 GIB00075CH01 "conserved hypothetical
protein"
         (434 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YQEV_BACSU RecName: Full=Putative methylthiotransferase yqeV;   ...   363   e-102
Y474_AQUAE RecName: Full=Putative methylthiotransferase aq_474; ...   318   4e-89
Y16R_MYCIO RecName: Full=Putative methylthiotransferase in 16S R...   273   2e-75
MIAB_CLOTE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   261   1e-71
MIAB_CLOBM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   259   2e-71
MIAB_CLOBK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   258   5e-71
Y830_THEMA RecName: Full=Putative methylthiotransferase TM_0830;...   258   9e-71
MIAB_THEP3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   256   3e-70
MIAB_THEPX RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   255   6e-70
MIAB_PELTS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   253   2e-69
MIAB_CLOBH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   252   4e-69
MIAB_CLOB1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   252   4e-69
MIAB_CLOBL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   248   5e-68
MIAB_CLOB8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   246   2e-67
MIAB_THETN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   244   1e-66
MIAB_CLOTH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   242   4e-66
MIAB_CLOBB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   242   4e-66
MIAB_CLOBA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   242   5e-66
MIAB_CLONN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   241   1e-65
MIAB_ALKOO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   239   3e-65
MIAB_CLOAB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   238   6e-65
MIAB_NATTJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   237   1e-64
MIAB_CLOPH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   233   2e-63
MIAB_CLOPE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   231   7e-63
MIAB_CLOP1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   231   7e-63
MIAB_CLOPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   231   9e-63
Y477_CHLPN RecName: Full=Putative methylthiotransferase CPn_0477...   229   4e-62
MIAB_AKKM8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   228   1e-61
MIAB_FINM2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   227   1e-61
MIAB_BACCN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   226   3e-61
MIAB_CARHZ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   225   5e-61
MIAB_BACWK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   224   8e-61
MIAB_DESAP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   224   1e-60
MIAB_STAAW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAA9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAA1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_BACC4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAS1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAAC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAA8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_STAA3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   223   2e-60
MIAB_SYMTH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   222   5e-60
MIAB_STAAR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   7e-60
MIAB_STAAB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   7e-60
MIAB_BACCR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   7e-60
MIAB_BACC2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   7e-60
MIAB_CALS8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   9e-60
MIAB_MYCPE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_GEOKA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACHK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACCZ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACC7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACC1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACC0 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_BACAH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   221   1e-59
MIAB_DESRM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   220   2e-59
MIAB_METI4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   220   2e-59
MIAB_OCEIH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   219   3e-59
MIAB_BACA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   219   4e-59
MIAB_AQUAE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   219   4e-59
MIAB_BACP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   219   5e-59
MIAB_FUSNN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   218   8e-59
MIAB_CLOD6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   217   1e-58
MIAB_BACAN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   217   1e-58
MIAB_SYNWW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   216   4e-58
MIAB_RICBR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   216   4e-58
MIAB_RICB8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   5e-58
MIAB_GEOUR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   5e-58
MIAB_THEYD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   7e-58
MIAB_THEAB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   7e-58
MIAB_CAUSK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   7e-58
MIAB_ALKMQ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   215   7e-58
MIAB_MOOTA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   9e-58
MIAB_CYAP8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   9e-58
MIAB_SULSY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   1e-57
MIAB_THESQ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   1e-57
MIAB_THEP1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   1e-57
MIAB_PARUW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   214   1e-57
MIAB_HYDS0 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   2e-57
MIAB_THEMA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   3e-57
MIAB_RHIL3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   3e-57
MIAB_GEOTN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   3e-57
MIAB_BRASO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   3e-57
MIAB_ANOFW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   213   3e-57
MIAB_EHRRW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   212   4e-57
MIAB_DESHY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   212   4e-57
MIAB_STAHJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   212   6e-57
MIAB_EHRRG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   212   6e-57
MIAB_RICFE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   211   7e-57
MIAB_OCHA4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   211   7e-57
MIAB_SYNJA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   211   1e-56
MIAB_SYNAS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   211   1e-56
MIAB_MARMM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   211   1e-56
MIAB_UNCTG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   210   2e-56
MIAB_THEM4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   210   2e-56
MIAB_ANAVT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   210   2e-56
MIAB_DICT6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   3e-56
MIAB_RICRS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   4e-56
MIAB_RICRO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   4e-56
MIAB_PETMO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   4e-56
MIAB_BACSK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   4e-56
MIAB_ARCB4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   209   5e-56
MIAB_SYNP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   6e-56
MIAB_SYNJB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   6e-56
MIAB_SYNFM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   6e-56
MIAB_SILST RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   6e-56
MIAB_ANAPZ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   6e-56
MIAB_RICCN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   8e-56
MIAB_BURPP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   208   8e-56
MIAB_RHIME RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   1e-55
MIAB_EHRCJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   1e-55
MIAB_DESPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   1e-55
MIAB_DECAR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   1e-55
MIAB_BUCBP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   1e-55
MIAB_BURXL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   207   2e-55
MIAB_RICAH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   2e-55
MIAB_ROSDO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   3e-55
MIAB_RICCK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   3e-55
MIAB_FERNB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   3e-55
MIAB_SALTO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   4e-55
MIAB_BRASB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   206   4e-55
MIAB_SINMW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   205   5e-55
MIAB_PROMS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   9e-55
MIAB_COPPD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   9e-55
MIAB_THEFY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_RHOP5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_PROMM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_PARL1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_EHRCR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_BURS3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_BACSU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_BACLD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   1e-54
MIAB_RICM5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_RHIEC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_PROM3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_METFK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_DESOH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_COREF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   204   2e-54
MIAB_RHIE6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   2e-54
MIAB_ALHEH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   2e-54
MIAB_TRIEI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   3e-54
MIAB_RALSO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   3e-54
MIAB_LEPBP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   3e-54
MIAB_LEPBA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   3e-54
MIAB_DESDG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   203   3e-54
MIAB_BURM1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   3e-54
MIAB_CYAA5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   4e-54
MIAB_CLAM3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   4e-54
MIAB_BURTA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   4e-54
MIAB_SILPO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   6e-54
MIAB_BURA4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   6e-54
MIAB_BARQU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   6e-54
MIAB_ACTP7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   6e-54
MIAB_ACTP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   202   6e-54
MIAB_SYNR3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   8e-54
MIAB_RHOS1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   8e-54
MIAB_BURCM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   8e-54
MIAB_BRAJA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   8e-54
MIAB_BART1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   8e-54
MIAB_RHILW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   1e-53
MIAB_HAES2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   1e-53
MIAB_HAES1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   1e-53
MIAB_CORDI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   1e-53
MIAB_ACTPJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   201   1e-53
MIAB_METEP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURP8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURCJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURCC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURCA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BACHD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_ANASP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_SALPK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_SALPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_SACEN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_NEIM0 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_LYSSC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURVG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURP6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURP0 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURMS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURMA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURM9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BURM7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUSU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUO2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUC2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUAB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_BRUA1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   200   2e-53
MIAB_THELT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_SALAR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_PROMA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_JANMA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_GLOVI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_CYAP7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_CORGL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_CHRVO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_BRUSI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   3e-53
MIAB_SALTY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALTI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALSV RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALNS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALHS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALG2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALEP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALDC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_SALA4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_NEIG2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_HAEIN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_HAEIG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_CORJK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_CORGB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_BORA1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   4e-53
MIAB_RHOS4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   5e-53
MIAB_ORITB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   5e-53
MIAB_ECO81 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   5e-53
MIAB_CLAMS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   199   5e-53
MIAB_STAES RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_STAEQ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_NITHX RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_NEIMF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_NEIG1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_BARBK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_ARTAT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   6e-53
MIAB_PROM0 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_NOSP7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_MESSB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_HAEIE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_HAEI8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_BURP1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_BRUME RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_BARHE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   198   8e-53
MIAB_SHISS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_SHIBS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_RICTY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_NEIMB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_HAEDU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_CITK8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_SHIFL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_SHIF8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_SHIDS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_RHOPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_NITMU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_KLEP3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ESCF3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOUT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOSM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOSE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOLU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOLI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOLC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOL6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOL5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOK1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECOHS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECODH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO8A RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO7I RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO5E RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO57 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO55 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO45 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_ECO24 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   1e-52
MIAB_POLNS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   2e-52
MIAB_PELCD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   197   2e-52
MIAB_PROM2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   2e-52
MIAB_PROAC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   2e-52
MIAB_HERAR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   2e-52
MIAB_DELAS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   2e-52
MIAB_ACISJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   2e-52
MIAB_SULDN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   3e-52
MIAB_POLSQ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   3e-52
MIAB_JANSC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   3e-52
MIAB_RICPR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_NEIMA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_MYCA9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_KOCRD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_KLEP7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_ENT38 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_ANAMM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   196   4e-52
MIAB_SHIB3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   5e-52
MIAB_AGRT5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   5e-52
MIAB_YERPN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_YERPE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_YERPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_RHOPT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_PROM5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_BIFAA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   195   7e-52
MIAB_TROWT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   9e-52
MIAB_THIDA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   9e-52
MIAB_PASMU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   1e-51
MIAB_ORITI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   1e-51
MIAB_NOCSJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   1e-51
MIAB_ENTS8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   1e-51
MIAB_YERPY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   2e-51
MIAB_TROW8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   2e-51
MIAB_DESVV RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   194   2e-51
MIAB_MYCGI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   193   2e-51
MIAB_DESVH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   193   2e-51
MIAB_YERPP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   193   3e-51
MIAB_YERPG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   193   3e-51
MIAB_WOLPP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   193   3e-51
MIAB1_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA methylth...   193   3e-51
Y416_RICPR RecName: Full=Putative methylthiotransferase RP416;  ...   192   4e-51
MIAB_YERPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   4e-51
MIAB_YERPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   4e-51
MIAB_YERP3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   4e-51
MIAB_SPHAL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   4e-51
MIAB_ACTSZ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   4e-51
RIMO_DESHY RecName: Full=Ribosomal protein S12 methylthiotransfe...   192   5e-51
MIAB_STRCO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_RHILO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_PSEA6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_NITSB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_LEPBL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_LEPBJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   5e-51
MIAB_XANCP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_XANCB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_XANC8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_SHELP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_RALPJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_MANSM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_LEPCP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_ACIBL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   192   6e-51
MIAB_NITWN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   8e-51
MIAB_AZOC5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   8e-51
RIMO_CLOD6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   191   1e-50
MIAB_ZYMMO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_CORU7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_XANP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_RHOPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_PARDP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_MYCUA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_MYCS2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_GEOLS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_GEOBB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB_ACAM1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   191   1e-50
MIAB2_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA methylth...   191   1e-50
MIAB_YERE8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_SHESH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_SHEAM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_RHOS5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_PROMP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_PHOLL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_NITEC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_COLP3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_PSYWF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_PARD8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   190   2e-50
MIAB_SYNY3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   3e-50
MIAB_LEPIN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   3e-50
MIAB_LEPIC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   3e-50
MIAB_GRAFK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   3e-50
MIAB_RHOBA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   4e-50
MIAB_LAWIP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   4e-50
MIAB_STRAW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   5e-50
MIAB_RENSM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   5e-50
MIAB_CAMFF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   189   5e-50
MIAB_PSESM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   7e-50
MIAB_SERP5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_SALAI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_RALEH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_MYCTU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_MYCTA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_MYCBP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_MYCBO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_MICAN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_LEGPL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_LEGPH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_LEGPC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_LEGPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_DINSH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_CUPTR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   188   9e-50
MIAB_SODGM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_SHEWM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_SHEHH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_RHOFD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_PSEU2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_POLNA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_NOCFA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_WOLTR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   1e-49
MIAB_MARMS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   2e-49
MIAB_HYPNA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   2e-49
MIAB_ERWCT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   2e-49
MIAB_ACIAC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   187   2e-49
MIAB_WOLSU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_VIBVU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_STRMK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_SHESA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_PSE14 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_PROMH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_NEOSM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_GEOMG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_VIBVY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_STRM5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_SHEPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_METPP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_HELP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   3e-49
MIAB_SHESR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   4e-49
MIAB_ERYLH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   186   4e-49
MIAB_WOLPM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   6e-49
MIAB_PROM4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   6e-49
MIAB_GLUDA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   6e-49
MIAB_THET8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   7e-49
MIAB_THET2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   7e-49
MIAB_SHEFN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   7e-49
MIAB_RHOPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   7e-49
MIAB_HELPJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   185   7e-49
MIAB_SHEON RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_POLSJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_ALTMD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_SHESM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_RHOP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_HELPH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   1e-48
MIAB_STRGG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   2e-48
MIAB_HELAH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   2e-48
MIAB_AERS4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   184   2e-48
MIAB_SHEDO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   2e-48
MIAB_RALME RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   2e-48
MIAB_RALEJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   2e-48
MIAB_BUCAI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   2e-48
MIAB_ACIC1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   2e-48
RIMO_ALKMQ RecName: Full=Ribosomal protein S12 methylthiotransfe...   183   3e-48
MIAB_VIBCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   3e-48
MIAB_VIBC3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   3e-48
MIAB_HELPY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   3e-48
MIAB_ARTS2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   183   3e-48
MIAB_VIBPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_SACD2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_PROM9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_PELUB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_ERWT9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_COXBU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_COXBR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_COXB2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_COXB1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_AERHH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   4e-48
MIAB_PSEPF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   5e-48
MIAB_LEIXX RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   5e-48
MIAB_HELPG RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   5e-48
MIAB_COXBN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   5e-48
MIAB_BORPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   182   6e-48
MIAB_SYNS3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   8e-48
MIAB_AZOSB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   8e-48
RIMO_CLOPE RecName: Full=Ribosomal protein S12 methylthiotransfe...   181   1e-47
RIMO_CLOP1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   181   1e-47
MIAB_PSEF5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_NITOC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_MYCSS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_MYCSK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_HERA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_GEOSL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
RIMO_CLOPS RecName: Full=Ribosomal protein S12 methylthiotransfe...   181   1e-47
MIAB_VIBHB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_SHEB9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_SHEB8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_OLICO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_MYCSJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_BAUCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   181   1e-47
MIAB_SULNB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
MIAB_SHEB5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
MIAB_NITEU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
MIAB_MYCVP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
RIMO_CLOPH RecName: Full=Ribosomal protein S12 methylthiotransfe...   180   2e-47
MIAB_HELPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
MIAB_ACICJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   180   2e-47
MIAB_PSEMY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
MIAB_FRATW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
MIAB_FRATT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
MIAB_FRATN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
MIAB_FRATM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
MIAB_FRAT1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   3e-47
RIMO_CLOK5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   179   4e-47
MIAB_THICR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   4e-47
MIAB_RHOSR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   4e-47
MIAB_HAHCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   4e-47
MIAB_CAMC5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   4e-47
RIMO_CLOTE RecName: Full=Ribosomal protein S12 methylthiotransfe...   179   5e-47
MIAB_SOLUE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_SHESW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_SHEPC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_OPITP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_FRAP2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_AZOSE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   179   5e-47
MIAB_VIBFM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   178   7e-47
MIAB_VIBF1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   178   7e-47
MIAB_CHRSD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   178   7e-47
MIAB_PSEHT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   178   9e-47
MIAB_PELPD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   178   9e-47
MIAB_SYNPX RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   1e-46
MIAB_PSYCK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   1e-46
MIAB_PSEU5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   1e-46
MIAB_MYCLE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   1e-46
RIMO_PROMS RecName: Full=Ribosomal protein S12 methylthiotransfe...   177   2e-46
RIMO_PROM2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   177   2e-46
MIAB_PHOPR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   2e-46
MIAB_PHEZH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   2e-46
MIAB_PSYIN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   177   2e-46
RIMO_PROM0 RecName: Full=Ribosomal protein S12 methylthiotransfe...   176   3e-46
MIAB_MAGSA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   3e-46
MIAB_PSEAE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   3e-46
MIAB_PSEAB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   3e-46
MIAB_KINRD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   3e-46
RIMO_CLOBA RecName: Full=Ribosomal protein S12 methylthiotransfe...   176   4e-46
MIAB_PSEA7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   4e-46
MIAB_DEIRA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   4e-46
MIAB_AZOPC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   176   4e-46
MIAB_SYNP6 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   175   8e-46
MIAB_SYNE7 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   175   8e-46
MIAB_ALISL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   175   8e-46
RIMO_SYNS9 RecName: Full=Ribosomal protein S12 methylthiotransfe...   174   1e-45
MIAB_SYNS9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_HALHL RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_FRATO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_FRATH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_FRATF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_CAMC1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
MIAB_ACIBS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   1e-45
RIMO_THETN RecName: Full=Ribosomal protein S12 methylthiotransfe...   174   1e-45
RIMO_PROM4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   174   2e-45
RIMO_BDEBA RecName: Full=Ribosomal protein S12 methylthiotransfe...   174   2e-45
MIAB_PSYA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_IDILO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_BUCAP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_BDEBA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_ACIBY RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_ACIBC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_ACIB5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
MIAB_ACIB3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   174   2e-45
RIMO_THEPX RecName: Full=Ribosomal protein S12 methylthiotransfe...   173   2e-45
MIAB_GLUOX RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   2e-45
MIAB_BIFLI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   2e-45
MIAB_ACIAD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   2e-45
RIMO_PELTS RecName: Full=Ribosomal protein S12 methylthiotransfe...   173   3e-45
MIAB_XANOR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   3e-45
MIAB_TREDE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   3e-45
MIAB_CHLT3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   173   3e-45
RIMO_PROMP RecName: Full=Ribosomal protein S12 methylthiotransfe...   172   4e-45
MIAB_XANC5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
MIAB_XANAC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
MIAB_SYNSC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
MIAB_METCA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
MIAB_CHLCH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
MIAB_BACTN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   4e-45
RIMO_THEP3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   172   5e-45
RIMO_PROM9 RecName: Full=Ribosomal protein S12 methylthiotransfe...   172   5e-45
MIAB_CAMJ8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   5e-45
MIAB_BIFLO RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   5e-45
MIAB_BIFLD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   5e-45
Y867_METJA RecName: Full=Putative methylthiotransferase MJ0867; ...   172   6e-45
MIAB_ROSS1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   6e-45
MIAB_BEII9 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   6e-45
MIAB_ACIF5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   6e-45
MIAB_ACIF2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   172   6e-45
RIMO_GEOSL RecName: Full=Ribosomal protein S12 methylthiotransfe...   171   8e-45
RIMO_CLONN RecName: Full=Ribosomal protein S12 methylthiotransfe...   171   8e-45
MIAB_CELJU RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   8e-45
Y285_HELPY RecName: Full=Putative methylthiotransferase HP_0285;...   171   1e-44
MIAB_XANOP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_XANOM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_THEEB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_SPHWW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_GRABC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_FRAAA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_CAMJJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_CAMJE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
Y285_HELPJ RecName: Full=Putative methylthiotransferase jhp_0270...   171   1e-44
RIMO_TRIEI RecName: Full=Ribosomal protein S12 methylthiotransfe...   171   1e-44
RIMO_DESRM RecName: Full=Ribosomal protein S12 methylthiotransfe...   171   1e-44
RIMO_ALKOO RecName: Full=Ribosomal protein S12 methylthiotransfe...   171   1e-44
MIAB_VEREI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_CAMJD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   171   1e-44
MIAB_METS4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_METPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_BACV8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_BACFR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_BACFN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_ANADF RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
RIMO_CLOTH RecName: Full=Ribosomal protein S12 methylthiotransfe...   170   2e-44
RIMO_CLOBB RecName: Full=Ribosomal protein S12 methylthiotransfe...   170   2e-44
MIAB_PROM1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_METC4 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_FLAJ1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_CHLTE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   170   2e-44
MIAB_NOVAD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_MYCA1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_MAGSM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_FRASC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_FLAPJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_CAMJR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_BORBR RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   3e-44
MIAB_SYNPW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   169   4e-44
RIMO_RHOBA RecName: Full=Ribosomal protein S12 methylthiotransfe...   168   7e-44
MIAB_MYCPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   168   7e-44
MIAB_DEHE1 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   168   7e-44
MIAB_BORPE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   168   7e-44
Y1729_PYRAB RecName: Full=Putative methylthiotransferase PYRAB17...   168   9e-44
MIAB_PROMT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   168   9e-44
MIAB_FRASN RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   168   9e-44
RIMO_THELT RecName: Full=Ribosomal protein S12 methylthiotransfe...   167   1e-43
RIMO_SYNPW RecName: Full=Ribosomal protein S12 methylthiotransfe...   167   2e-43
MIAB_MYXXD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   167   2e-43
RIMO_ANAVT RecName: Full=Ribosomal protein S12 methylthiotransfe...   167   2e-43
RIMO_SYNPX RecName: Full=Ribosomal protein S12 methylthiotransfe...   166   3e-43
MIAB_RHOCS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   166   3e-43
MIAB_CHLP8 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   166   3e-43
MIAB_CYTH3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   166   4e-43
MIAB_ANASK RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   166   4e-43
RIMO_GEOUR RecName: Full=Ribosomal protein S12 methylthiotransfe...   166   5e-43
RIMO_PROM5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   165   6e-43
RIMO_PROM3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   165   6e-43
RIMO_CALS8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   165   6e-43
MIAB_PROVI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   165   6e-43
MIAB_MARAV RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   165   6e-43
RIMO_ANASP RecName: Full=Ribosomal protein S12 methylthiotransfe...   165   8e-43
MIAB_DICNV RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   165   8e-43
MIAB_DEHSB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   165   8e-43
RIMO_SYNSC RecName: Full=Ribosomal protein S12 methylthiotransfe...   164   1e-42
RIMO_MOOTA RecName: Full=Ribosomal protein S12 methylthiotransfe...   164   1e-42
MIAB_DEHSC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   164   1e-42
RIMO_CLOAB RecName: Full=Ribosomal protein S12 methylthiotransfe...   164   2e-42
MIAB_PORGI RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   164   2e-42
MIAB_METRJ RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   164   2e-42
MIAB_BORPD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   164   2e-42
RIMO_MICAN RecName: Full=Ribosomal protein S12 methylthiotransfe...   163   3e-42
RIMO_GEOMG RecName: Full=Ribosomal protein S12 methylthiotransfe...   163   3e-42
RIMO_DICT6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   163   3e-42
RIMO_CYAP7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   163   3e-42
RIMO_SYNY3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   162   5e-42
RIMO_SYNS3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   162   5e-42
RIMO_NATTJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   162   7e-42
MIAB_DEIGD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   162   7e-42
MIAB_TREPS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   161   9e-42
MIAB_TREPA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   161   9e-42
RIMO_PROMM RecName: Full=Ribosomal protein S12 methylthiotransfe...   161   1e-41
RIMO_CLOB8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   161   1e-41
MIAB_PORG3 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   161   1e-41
MIAB_CAMHC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   161   1e-41
MIAB_PELPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   160   1e-41
MIAB_ANADE RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   160   2e-41
RIMO_SYNP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   160   3e-41
MIAB_SALRD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   160   3e-41
RIMO_SACEN RecName: Full=Ribosomal protein S12 methylthiotransfe...   159   4e-41
RIMO_NOSP7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   159   4e-41
RIMO_SYMTH RecName: Full=Ribosomal protein S12 methylthiotransfe...   159   6e-41
RIMO_CYAA5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   158   7e-41
MIAB_RHORT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   158   7e-41
RIMO_SYNE7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   158   1e-40
MIAB_CHLAA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   158   1e-40
RIMO_SYNP6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   1e-40
RIMO_GEOBB RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   1e-40
MIAB_VESOH RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   157   1e-40
MIAB_AMOA5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   157   1e-40
RIMO_CYAP8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   2e-40
RIMO_CARHZ RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   2e-40
RIMO_PROMA RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   2e-40
RIMO_LEPBP RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   2e-40
RIMO_LEPBA RecName: Full=Ribosomal protein S12 methylthiotransfe...   157   2e-40
RIMO_SYNJB RecName: Full=Ribosomal protein S12 methylthiotransfe...   156   4e-40
RIMO_HELMI RecName: Full=Ribosomal protein S12 methylthiotransfe...   156   4e-40
RIMO_CLOBM RecName: Full=Ribosomal protein S12 methylthiotransfe...   156   4e-40
RIMO_MAGSM RecName: Full=Ribosomal protein S12 methylthiotransfe...   155   5e-40
RIMO_CLOBL RecName: Full=Ribosomal protein S12 methylthiotransfe...   155   5e-40
RIMO_LEPBL RecName: Full=Ribosomal protein S12 methylthiotransfe...   155   6e-40
MIAB_XYLFT RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   155   6e-40
MIAB_XYLF2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   155   6e-40
RIMO_CLOBH RecName: Full=Ribosomal protein S12 methylthiotransfe...   155   8e-40
RIMO_CLOB1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   155   8e-40
MIAB_CHLPD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   155   8e-40
MIAB_CHLPB RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   155   8e-40
Y1875_PYRHO RecName: Full=Putative methylthiotransferase PH1875;...   154   1e-39
RIMO_HAHCH RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   1e-39
RIMO_CLOBK RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   1e-39
RIMO_AQUAE RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   1e-39
MIAB_XYLFM RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   154   1e-39
MIAB_PROA2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   154   1e-39
RIMO_GEOLS RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   1e-39
RIMO_PELCD RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   2e-39
RIMO_LEPIN RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   2e-39
RIMO_CHLAA RecName: Full=Ribosomal protein S12 methylthiotransfe...   154   2e-39
RIMO_ACAM1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   153   2e-39
RIMO_KLEP7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   153   3e-39
RIMO_KLEP3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   153   3e-39
RIMO_LEPBJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   152   4e-39
MIAB_PELLD RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   152   4e-39
RIMO_SYNR3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   152   5e-39
RIMO_GLOVI RecName: Full=Ribosomal protein S12 methylthiotransfe...   152   5e-39
MIAB_CHLL2 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   152   5e-39
RIMO_LEPIC RecName: Full=Ribosomal protein S12 methylthiotransfe...   152   7e-39
RIMO_FERNB RecName: Full=Ribosomal protein S12 methylthiotransfe...   151   9e-39
RIMO_CYTH3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   151   9e-39
RIMO_AERS4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   151   1e-38
MIAB_XYLFA RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   151   1e-38
CDKAL_XENTR RecName: Full=CDK5 regulatory subunit-associated pro...   151   1e-38
RIMO_SYNJA RecName: Full=Ribosomal protein S12 methylthiotransfe...   150   2e-38
Y826_METTH RecName: Full=Putative methylthiotransferase MTH_826;...   149   3e-38
RIMO_PROMH RecName: Full=Ribosomal protein S12 methylthiotransfe...   149   3e-38
RIMO_CITK8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   149   3e-38
CDKAL_DANRE RecName: Full=CDK5 regulatory subunit-associated pro...   149   3e-38
RIMO_SYNWW RecName: Full=Ribosomal protein S12 methylthiotransfe...   149   4e-38
RIMO_AERHH RecName: Full=Ribosomal protein S12 methylthiotransfe...   149   4e-38
MIAB_RUTMC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   149   4e-38
MIAB_ALCBS RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   149   4e-38
CDKAL_XENLA RecName: Full=CDK5 regulatory subunit-associated pro...   149   4e-38
RIMO_PARUW RecName: Full=Ribosomal protein S12 methylthiotransfe...   149   6e-38
RIMO_THESQ RecName: Full=Ribosomal protein S12 methylthiotransfe...   148   8e-38
RIMO_THEMA RecName: Full=Ribosomal protein S12 methylthiotransfe...   148   8e-38
RIMO_THEP1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   148   1e-37
RIMO_VIBVY RecName: Full=Ribosomal protein S12 methylthiotransfe...   147   1e-37
RIMO_THEYD RecName: Full=Ribosomal protein S12 methylthiotransfe...   147   1e-37
RIMO_PELPD RecName: Full=Ribosomal protein S12 methylthiotransfe...   147   1e-37
RIMO_ESCF3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   147   2e-37
RIMO_PETMO RecName: Full=Ribosomal protein S12 methylthiotransfe...   147   2e-37
CDKAL_DROPS RecName: Full=CDKAL1-like protein;                        147   2e-37
RIMO_THEM4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   3e-37
RIMO_HERA2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   3e-37
RIMO_BACFR RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   3e-37
RIMO_BACFN RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   3e-37
RIMO_STRCO RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   4e-37
RIMO_OPITP RecName: Full=Ribosomal protein S12 methylthiotransfe...   146   4e-37
RIMO_WOLSU RecName: Full=Ribosomal protein S12 methylthiotransfe...   145   5e-37
RIMO_VIBVU RecName: Full=Ribosomal protein S12 methylthiotransfe...   145   5e-37
RIMO_GRAFK RecName: Full=Ribosomal protein S12 methylthiotransfe...   145   5e-37
RIMO_FLAPJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   145   5e-37
CDKAL_HUMAN RecName: Full=CDK5 regulatory subunit-associated pro...   145   5e-37
RIMO_SALPB RecName: Full=Ribosomal protein S12 methylthiotransfe...   145   6e-37
CK5P1_DICDI RecName: Full=CDK5RAP1-like protein;                      145   6e-37
CDKAL_DROME RecName: Full=CDKAL1-like protein;                        145   6e-37
RIMO_THEEB RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_SALTI RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ERWCT RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
Y1247_ARCFU RecName: Full=Putative methylthiotransferase AF_1247...   144   1e-36
RIMO_SHIBS RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_SHIB3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOSM RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOSE RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOLU RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOLI RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOLC RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECOHS RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECODH RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO8A RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO7I RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO5E RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO57 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO55 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_ECO24 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   1e-36
RIMO_SALTY RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALSV RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALPK RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALPA RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALNS RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALEP RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALDC RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALCH RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALAR RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_SALA4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_PSEA6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_PROAC RecName: Full=Ribosomal protein S12 methylthiotransfe...   144   2e-36
RIMO_THICR RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   2e-36
RIMO_ENTS8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   2e-36
CDKAL_MOUSE RecName: Full=CDK5 regulatory subunit-associated pro...   143   2e-36
RIMO_SALHS RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_SALG2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECOUT RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECOL6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECOL5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECOK1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECO81 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_ECO45 RecName: Full=Ribosomal protein S12 methylthiotransfe...   143   3e-36
RIMO_VIBCH RecName: Full=Ribosomal protein S12 methylthiotransfe...   142   5e-36
RIMO_SHIFL RecName: Full=Ribosomal protein S12 methylthiotransfe...   142   5e-36
RIMO_SHISS RecName: Full=Ribosomal protein S12 methylthiotransfe...   142   7e-36
RIMO_SHIF8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   142   7e-36
RIMO_BACTN RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   9e-36
RIMO_VIBC3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_THIDA RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_METI4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_FRAP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_CHLCV RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_ACIBL RecName: Full=Ribosomal protein S12 methylthiotransfe...   141   1e-35
RIMO_CHLAB RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   2e-35
RIMO_SULNB RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   2e-35
RIMO_DESPS RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   3e-35
RIMO_ACIBT RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   3e-35
RIMO_ACIBS RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   3e-35
RIMO_ACIBC RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   3e-35
RIMO_ACIAD RecName: Full=Ribosomal protein S12 methylthiotransfe...   140   3e-35
RIMO_SULSY RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   4e-35
RIMO_PSEE4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   4e-35
RIMO_DESAP RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   4e-35
CK5P1_RAT RecName: Full=CDK5 regulatory subunit-associated prote...   139   4e-35
RIMO_THET8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   5e-35
RIMO_THEAB RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   5e-35
RIMO_NOCSJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   5e-35
MIAB_HELHP RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   139   5e-35
CK5P1_MOUSE RecName: Full=CDK5 regulatory subunit-associated pro...   139   5e-35
RIMO_PSEPK RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_PSEP1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_FRATN RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_CHLFF RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_CAMJJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_ANASK RecName: Full=Ribosomal protein S12 methylthiotransfe...   139   6e-35
RIMO_PSEPW RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   8e-35
RIMO_CAMJR RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   8e-35
RIMO_CAMJ8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   8e-35
CK5P1_CAEEL RecName: Full=CDK5RAP1-like protein;                      138   8e-35
RIMO_SYNAS RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   1e-34
RIMO_FLAJ1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   1e-34
RIMO_CAMHC RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   1e-34
RIMO_ACIBY RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   1e-34
RIMO_ACIB3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   138   1e-34
RIMO_PSEPG RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   1e-34
RIMO_CAMJD RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   1e-34
RIMO_ELUMP RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_CAMJE RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_STRAW RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_PASMU RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_PARD8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_HELHP RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_ACIB5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   137   2e-34
RIMO_ACTP7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   136   3e-34
MIAB_SULMW RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   136   3e-34
RIMO_ACTPJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   136   4e-34
CK5P1_ORYSJ RecName: Full=CDK5RAP1-like protein;                      136   4e-34
RIMO_SORC5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   135   5e-34
RIMO_FRATO RecName: Full=Ribosomal protein S12 methylthiotransfe...   135   5e-34
RIMO_FRATF RecName: Full=Ribosomal protein S12 methylthiotransfe...   135   5e-34
CK5P1_DROME RecName: Full=CDK5RAP1-like protein;                      135   5e-34
CK5P1_ARATH RecName: Full=CDK5RAP1-like protein;                      135   7e-34
RIMO_ACTP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   135   9e-34
Y269_TREPA RecName: Full=Putative methylthiotransferase TP_0269;...   134   1e-33
RIMO_SOLUE RecName: Full=Ribosomal protein S12 methylthiotransfe...   134   1e-33
RIMO_HAES2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   134   1e-33
RIMO_HAES1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   134   1e-33
RIMO_THET2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   134   1e-33
RIMO_SHEPC RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_PSYA2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_MARAV RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_CHRVO RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_CAMFF RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
CK5P1_HUMAN RecName: Full=CDK5 regulatory subunit-associated pro...   133   3e-33
RIMO_SHESW RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_NITSB RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_BACV8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   133   3e-33
RIMO_PSYWF RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   4e-33
RIMO_PSEPF RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   4e-33
RIMO_KINRD RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   4e-33
RIMO_BURPP RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   4e-33
RIMO_AZOSE RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   4e-33
RIMO_PSEU5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   6e-33
RIMO_PSEAB RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   6e-33
RIMO_ACTSZ RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   6e-33
RIMO_RHILO RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   7e-33
RIMO_PSEF5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   7e-33
RIMO_CHLL2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   132   7e-33
RIMO_SYNFM RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_PSYCK RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_PSEU2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_PSEMY RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_MANSM RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_CHLPN RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_RHOPS RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_RALME RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_BURXL RecName: Full=Ribosomal protein S12 methylthiotransfe...   131   1e-32
RIMO_STRGG RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_PSE14 RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_SHEB8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_PSEAE RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_MAGSA RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_LEGPL RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_LEGPC RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_LEGPA RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_BURTA RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   2e-32
RIMO_SHESR RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_SHESM RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_SHESA RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_SHEB9 RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_PORG3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_HAEDU RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_BURCH RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_BURCA RecName: Full=Ribosomal protein S12 methylthiotransfe...   130   3e-32
RIMO_DEIGD RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   4e-32
RIMO_BURCJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   4e-32
RIMO_AZOSB RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   4e-32
RIMO_ANADE RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   4e-32
MIAB_SORC5 RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   129   4e-32
RIMO_UNCTG RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_SPHAL RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_SHEON RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_SHEB5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_RHOPA RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_RHOP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_RHOFD RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_RALPJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_PSEA7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_MYXXD RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_LEGPH RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_BURS3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_BURCC RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_BORPE RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_BORPA RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_ACISJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   5e-32
RIMO_RHOPT RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   6e-32
RIMO_PORGI RecName: Full=Ribosomal protein S12 methylthiotransfe...   129   6e-32
RIMO_RALSO RecName: Full=Ribosomal protein S12 methylthiotransfe...   128   8e-32
RIMO_ACIC1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   128   8e-32
RIMO_RHOCS RecName: Full=Ribosomal protein S12 methylthiotransfe...   128   1e-31
RIMO_BURVG RecName: Full=Ribosomal protein S12 methylthiotransfe...   128   1e-31
RIMO_BURM1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   128   1e-31
RIMO_ZYMMO RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   1e-31
RIMO_PSESM RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   1e-31
RIMO_SACD2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_CELJU RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURMS RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURMA RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURM9 RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURM7 RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURCM RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
MIAB_BUCCC RecName: Full=(Dimethylallyl)adenosine tRNA methylthi...   127   2e-31
RIMO_SHEAM RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_DESOH RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURPS RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURP1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BURP0 RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_BORPD RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_ANADF RecName: Full=Ribosomal protein S12 methylthiotransfe...   127   2e-31
RIMO_POLSQ RecName: Full=Ribosomal protein S12 methylthiotransfe...   126   3e-31
RIMO_AZOC5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   126   3e-31
RIMO_POLNS RecName: Full=Ribosomal protein S12 methylthiotransfe...   126   4e-31
RIMO_CAMC1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   126   4e-31
RIMO_METS4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   5e-31
RIMO_METPB RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   5e-31
RIMO_METEP RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   5e-31
RIMO_DECAR RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   5e-31
RIMO_ACIF2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   5e-31
RIMO_METC4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   7e-31
RIMO_BURA4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   7e-31
RIMO_BURP8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   125   9e-31
RIMO_THEFY RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_SPHWW RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_RALEJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_HYDS0 RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_CHLTE RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_BORBR RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   1e-30
RIMO_XANCP RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_XANC8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_XANAC RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_RHOP5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_BURP6 RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_BRASB RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_XANCB RecName: Full=Ribosomal protein S12 methylthiotransfe...   124   2e-30
RIMO_JANMA RecName: Full=Ribosomal protein S12 methylthiotransfe...   123   3e-30
RIMO_METRJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   123   3e-30
RIMO_CUPTR RecName: Full=Ribosomal protein S12 methylthiotransfe...   123   3e-30
RIMO_ROSS1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   4e-30
RIMO_RHOPB RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   4e-30
RIMO_METFK RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   4e-30
RIMO_COLP3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   4e-30
RIMO_XANC5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   6e-30
RIMO_RHORT RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   6e-30
RIMO_STRMK RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   8e-30
RIMO_STRM5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   8e-30
RIMO_RALEH RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   8e-30
RIMO_BRASO RecName: Full=Ribosomal protein S12 methylthiotransfe...   122   8e-30
RIMO_POLNA RecName: Full=Ribosomal protein S12 methylthiotransfe...   121   1e-29
RIMO_CHLP8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   121   1e-29
RIMO_NITEU RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_HELPG RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_ACIF5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_HERAR RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_ERYLH RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_ALTMD RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   2e-29
RIMO_HELPH RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   3e-29
RIMO_CHLPB RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   3e-29
RIMO_BRAJA RecName: Full=Ribosomal protein S12 methylthiotransfe...   120   3e-29
RIMO_BRUO2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   4e-29
RIMO_XANOR RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   5e-29
RIMO_XANOP RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   5e-29
RIMO_XANOM RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   5e-29
RIMO_HELP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   5e-29
RIMO_POLSJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_OCHA4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUSU RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUSI RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUME RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUC2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUAB RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUA2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_BRUA1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   119   6e-29
RIMO_TREDE RecName: Full=Ribosomal protein S12 methylthiotransfe...   118   8e-29
RIMO_OLICO RecName: Full=Ribosomal protein S12 methylthiotransfe...   118   8e-29
RIMO_DELAS RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   1e-28
RIMO_VEREI RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_HELPJ RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_HELAH RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_DEIRA RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_AKKM8 RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_BART1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   117   2e-28
RIMO_HELPS RecName: Full=Ribosomal protein S12 methylthiotransfe...   116   3e-28
RIMO_CHLCH RecName: Full=Ribosomal protein S12 methylthiotransfe...   116   3e-28
RIMO_BARHE RecName: Full=Ribosomal protein S12 methylthiotransfe...   116   3e-28
RIMO_RHOS1 RecName: Full=Ribosomal protein S12 methylthiotransfe...   115   5e-28
RIMO_PELPB RecName: Full=Ribosomal protein S12 methylthiotransfe...   115   5e-28
RIMO_CHLPD RecName: Full=Ribosomal protein S12 methylthiotransfe...   115   7e-28
RIMO_NITMU RecName: Full=Ribosomal protein S12 methylthiotransfe...   115   9e-28
RIMO_RHOS4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   114   1e-27
RIMO_HELPY RecName: Full=Ribosomal protein S12 methylthiotransfe...   114   1e-27
RIMO_LEPCP RecName: Full=Ribosomal protein S12 methylthiotransfe...   114   2e-27
RIMO_METCA RecName: Full=Ribosomal protein S12 methylthiotransfe...   114   2e-27
RIMO_CHLT3 RecName: Full=Ribosomal protein S12 methylthiotransfe...   113   4e-27
RIMO_RHOS5 RecName: Full=Ribosomal protein S12 methylthiotransfe...   112   6e-27
RIMO_PELLD RecName: Full=Ribosomal protein S12 methylthiotransfe...   111   1e-26
RIMO_METPP RecName: Full=Ribosomal protein S12 methylthiotransfe...   111   1e-26
RIMO_NOVAD RecName: Full=Ribosomal protein S12 methylthiotransfe...   111   1e-26
RIMO_NITEC RecName: Full=Ribosomal protein S12 methylthiotransfe...   111   1e-26
RIMO_XANP2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   110   2e-26
RIMO_SALTO RecName: Full=Ribosomal protein S12 methylthiotransfe...   110   2e-26
RIMO_FRASC RecName: Full=Ribosomal protein S12 methylthiotransfe...   110   2e-26
RIMO_ARCB4 RecName: Full=Ribosomal protein S12 methylthiotransfe...   110   2e-26
RIMO_PROVI RecName: Full=Ribosomal protein S12 methylthiotransfe...   110   3e-26
RIMO_PARDP RecName: Full=Ribosomal protein S12 methylthiotransfe...   109   4e-26
RIMO_ALHEH RecName: Full=Ribosomal protein S12 methylthiotransfe...   109   4e-26
RIMO_LAWIP RecName: Full=Ribosomal protein S12 methylthiotransfe...   108   7e-26
RIMO_SULDN RecName: Full=Ribosomal protein S12 methylthiotransfe...   108   9e-26
RIMO_BEII9 RecName: Full=Ribosomal protein S12 methylthiotransfe...   108   9e-26
RIMO_SALAI RecName: Full=Ribosomal protein S12 methylthiotransfe...   107   1e-25
RIMO_ACIAC RecName: Full=Ribosomal protein S12 methylthiotransfe...   107   2e-25
RIMO_PROA2 RecName: Full=Ribosomal protein S12 methylthiotransfe...   107   3e-25
RIMO_ROSCS RecName: Full=Ribosomal protein S12 methylthiotransfe...   106   3e-25
RIMO_JANSC RecName: Full=Ribosomal protein S12 methylthiotransfe...   106   3e-25
RIMO_SILPO RecName: Full=Ribosomal protein S12 methylthiotransfe...   104   1e-24
RIMO_DINSH RecName: Full=Ribosomal protein S12 methylthiotransfe...   103   3e-24
RIMO_ROSDO RecName: Full=Ribosomal protein S12 methylthiotransfe...   102   6e-24
RIMO_SILST RecName: Full=Ribosomal protein S12 methylthiotransfe...   100   2e-23
RIMO_DESDG RecName: Full=Ribosomal protein S12 methylthiotransfe...   100   2e-23
RIMO_HYPNA RecName: Full=Ribosomal protein S12 methylthiotransfe...    99   5e-23
CDKAL_CAEEL RecName: Full=CDKAL1-like protein;                         99   7e-23
RIMO_DESVV RecName: Full=Ribosomal protein S12 methylthiotransfe...    97   3e-22
RIMO_DESVH RecName: Full=Ribosomal protein S12 methylthiotransfe...    97   3e-22
RIMO_FRAAA RecName: Full=Ribosomal protein S12 methylthiotransfe...    93   4e-21
Y1620_METJA RecName: Full=Uncharacterized protein MJ1620;              46   7e-07
KAMA_BACSU RecName: Full=L-lysine 2,3-aminomutase;         Short...    40   5e-05
LIPA_ALKMQ RecName: Full=Lipoyl synthase;         EC=2.8.1.8;Alt...    37   2e-04
BCHE_RHOS4 RecName: Full=Anaerobic magnesium-protoporphyrin IX m...    37   2e-04
BCHE_RHOGE RecName: Full=Anaerobic magnesium-protoporphyrin IX m...    36   7e-04

>YQEV_BACSU RecName: Full=Putative methylthiotransferase yqeV;      
             EC=2.-.-.-;
          Length = 451

 Score =  363 bits (933), Expect = e-102
 Identities = 185/435 (42%), Positives = 285/435 (65%), Gaps = 6/435 (1%)

Query: 3   VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           VAF TLGC+VN YE+EA+ + F   GYE  DF + ADVYV+NTC+VTN GDKKSRQ+I R
Sbjct: 4   VAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVINTCTVTNTGDKKSRQVIRR 63

Query: 63  ARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           A RQNP+ +I V GCYAQ +P E+  I GVD+V+G++++ +++ Y+++ R+E +    V 
Sbjct: 64  AIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREKMLGYIDQYREERQPINGVS 123

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            ++K +V+E+L +  + ++TRA LKIQ+GCN FC +C+IP+ RG + S+DP++V+ + + 
Sbjct: 124 NIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIPWARGLLRSRDPEEVIKQAQQ 183

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIE-KIDGIERVRIGSIDPTFFTEDV 241
           L + G+KEI+L+GIHT  YG D+ +      LL E++ +++G++R+RI SI+ +  T++V
Sbjct: 184 LVDAGYKEIVLTGIHTGGYGEDMKD-YNFAKLLSELDTRVEGVKRIRISSIEASQITDEV 242

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +  +    K+  H H+ +QSG +  LKRM R+YT + + D +N L+  +  +++T+DVIV
Sbjct: 243 IEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFADRLNKLKKALPGLAVTSDVIV 302

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            +K    S+ H+F YS R GT A  ME+QVD N K+ER  +LI L
Sbjct: 303 GFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPAARMEDQVDENVKNERVHRLIAL 362

Query: 362 NRINEKAFAEKYIGEVIDVLFEE---EVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
           +    K +A +Y  EV++++ EE   E E    ++ GYT NY+KV  K   ++ GKI+ V
Sbjct: 363 SDQLAKEYASQYENEVLEIIPEEAFKETE-EENMFVGYTDNYMKVVFKGTEDMIGKIVKV 421

Query: 419 KINSFEGEVAEGEIV 433
           KI        EG+ V
Sbjct: 422 KILKAGYPYNEGQFV 436


>Y474_AQUAE RecName: Full=Putative methylthiotransferase aq_474;    
               EC=2.-.-.-;
          Length = 410

 Score =  318 bits (816), Expect = 4e-89
 Identities = 170/420 (40%), Positives = 263/420 (62%), Gaps = 10/420 (2%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKVAF TLGCR+N ++++ +  KF+++GYEVV F +MADVYV+NTC+VT  GD+ SRQ I
Sbjct: 1   MKVAFETLGCRMNQFDTDLLKNKFIQKGYEVVSFEDMADVYVINTCTVTVGGDRSSRQAI 60

Query: 61  GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            +A+R+NP+AI+   GCYAQ+ P E++ ++ VD+V+G+ +K E++  + +  +  +++V 
Sbjct: 61  YQAKRRNPKAIVVATGCYAQVNPQELAKLKEVDLVVGNTHKSELLKILEEYLERREKKVV 120

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           VG + + K   +     Y    R FLK+Q+GCN+FC +C+IPY RG V S D +K++ ++
Sbjct: 121 VGEIFREKEVRNFDTVLYFEGVRPFLKVQEGCNKFCTFCVIPYARGKVRSVDLEKIVHQV 180

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + LA+ GFKE++L+G   + YG   D+   L  LL E+ KI+GIE +R+ S+      ++
Sbjct: 181 KLLAQKGFKEVVLTGTQLSQYG--WDKGYNLYTLLTELIKIEGIELIRLSSMHIKEMDKE 238

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +++ I++ +K+ PHFHLSLQSG +  L+ M+R YT +EYE++VN + +     SI TDVI
Sbjct: 239 LLKLIVSEEKIAPHFHLSLQSGSNRILELMDRGYTREEYEEVVNFIVENRPISSIGTDVI 298

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFP             LKRI +S  HIF YS R  T+A  ++ ++    K ER + L E
Sbjct: 299 VGFPTESEEDFQETYEFLKRIPISYMHIFPYSDRPFTKASKLKPKLPERIKKERVRILKE 358

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           L++   + F EK  G+ +  L  EE  L        T NYI +  +    V GK++ V I
Sbjct: 359 LDQKKRQEFYEKNKGKELRALVIEENRL-------LTENYIDIKREGYKEV-GKLVRVLI 410


>Y16R_MYCIO RecName: Full=Putative methylthiotransferase in 16S RNA
           5'region;         EC=2.-.-.-;
          Length = 438

 Score =  273 bits (698), Expect = 2e-75
 Identities = 157/433 (36%), Positives = 245/433 (56%), Gaps = 9/433 (2%)

Query: 4   AFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA 63
           A  TLGC+VN +ES ++    +  G   V F+  ADVY++NTC+VTN  D KSR  I RA
Sbjct: 11  AIHTLGCKVNLFESNSIKNDLIMNGLVEVPFDSKADVYIINTCTVTNKADAKSRLYIKRA 70

Query: 64  RRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGA 123
             QN +AII V GC +Q+    +  ++ + + +G++ K  +   +N+   + ++  +V  
Sbjct: 71  HVQNKDAIIIVAGCMSQVNKDLMDKLK-ISIQIGNKYKNSVFDLINEYLKKRERIYRVEN 129

Query: 124 VLKNKVFEDLKIEE-YNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           +L  K FE    +  +   TRAF+KIQDGCN  C+YC+IP++RG   S+  + +L++I++
Sbjct: 130 ILAEKKFEQTTQDFIFLENTRAFIKIQDGCNFMCSYCIIPFSRGRQRSQKMESILEKIKT 189

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           L    FKEI+L+G++TA Y   LDE   T  DLL  I K+DG  RVRI S++P    +++
Sbjct: 190 LVSKXFKEIVLTGVNTAGY---LDENNNTFFDLLNNINKLDGDFRVRISSLEPFQINDEI 246

Query: 242 VRRILALKK-LCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +  + + KK  C H+H+ LQSG D  LK+MNR+YT  E+  ++  + +K    + TTD I
Sbjct: 247 IDLVTSNKKRFCQHWHICLQSGSDDVLKKMNRKYTTDEFYKLMQKILNKSPLTNFTTDYI 306

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFP             L +I L   HIF YS R  TR+ + ++  D  KKD R K++  
Sbjct: 307 VGFPTETDEDQKKSIDFLNKIKLYDMHIFPYSKRNNTRSSHYKDINDSTKKD-RVKEITX 365

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
                        IG+  +VLFE++ E    +++GY+  Y +V  ++  N+  K+L V+I
Sbjct: 366 XXXXXXXXXXXXXIGKTCEVLFEKKKE-DEKMWSGYSNEYCRVMVESGDNLENKMLKVRI 424

Query: 421 NSFEGEVAEGEIV 433
                +   GEI+
Sbjct: 425 KKIFFDSLVGEII 437


>MIAB_CLOTE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 453

 Score =  261 bits (666), Expect = 1e-71
 Identities = 153/433 (35%), Positives = 235/433 (54%), Gaps = 8/433 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N  +SE ++      GY+  +    AD+ + NTC V    + K    +G  +  
Sbjct: 23  TWGCQMNEEDSEKLSGMLKNIGYKNAEDKNQADIIIFNTCCVRENAELKVYGNLGALKGL 82

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
             +NP  IIAV GC  Q   +A   +     VD++ G+ N  +   Y+N+A+ EGK  ++
Sbjct: 83  KSKNPNLIIAVCGCMMQQEGMAEAIIKKYPFVDIIFGTHNSYKFPEYLNRAKQEGKSIIE 142

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V    + ++ E + ++   + T+AF+ I  GCN FC YC++PY RG   S++   +  EI
Sbjct: 143 VWDK-EEEIVEGIPVDR-KSSTKAFVTIMYGCNNFCTYCIVPYVRGRERSREVSDIEKEI 200

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L + G+KEI L G +  SYG DL+ KV+  +LL  + +I+GIERVR  +  P   TED
Sbjct: 201 KELVKSGYKEITLLGQNVNSYGKDLEPKVSFAELLRHVNEIEGIERVRFMTSHPKDLTED 260

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC H HL +QSG    LK+MNR Y  ++Y ++VN ++++I +V+ITTD+I
Sbjct: 261 VIYAIKECDKLCNHIHLPVQSGSSRILKKMNRYYNREDYLNLVNKIKEEIPNVAITTDII 320

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A ++E QV  + K +R KKL+E
Sbjct: 321 VGFPGETEEDFNETLELVKEVEYDSAFTFLYSKRKGTPAYDIEEQVPEDVKHDRFKKLVE 380

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           +   + +   +KY   ++ VL E E +      +G T     VN   + +  GKI++VKI
Sbjct: 381 VVNKSCEKNNKKYQDRIVKVLVEGESKNDKNKLSGRTDTAKLVNFIGNKDNIGKIVDVKI 440

Query: 421 NSFEGEVAEGEIV 433
                   EGE V
Sbjct: 441 TKTLSFSLEGEEV 453


>MIAB_CLOBM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  259 bits (663), Expect = 2e-71
 Identities = 156/427 (36%), Positives = 232/427 (54%), Gaps = 13/427 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N  +SE ++    +EGY   +  E ADV + NTC V    + K   +  I+   
Sbjct: 20  TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKVYGNLGILKGL 79

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           + +NP  IIAV GC  Q   +A T       VD+++G+ N      Y+N+ + +    +K
Sbjct: 80  KSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNLHNFPNYLNEVKKKDTSILK 139

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +    ++ + E++ I+   N  +AF+ I  GCN FC YC++PY RG   S+ P+ + DEI
Sbjct: 140 IQEK-EDSIIENMPIDR-KNSMKAFVTIMYGCNNFCTYCIVPYVRGRERSRTPENIEDEI 197

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG DL+ KVT  DLLE +  IDG+ERVR  +  P   T+D
Sbjct: 198 KKLISEGYKEITLLGQNVNSYGKDLEPKVTFADLLERVNTIDGLERVRFMTSHPKDLTDD 257

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC   HL +QSG    LK+MNR Y  ++Y D+V+ ++  I +V+++TD+I
Sbjct: 258 VIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVVSKIKKLIPNVALSTDII 317

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A   E+QV  + K +R  +L+E
Sbjct: 318 VGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFEDQVPEDVKHKRFNRLVE 377

Query: 361 -LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            +N I+ K   + Y G++ +VL E   +       G TR    VN   D +  GK++NVK
Sbjct: 378 VVNEISAKK-NKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLVNFIGDKDSIGKLVNVK 436

Query: 420 I---NSF 423
           I   NSF
Sbjct: 437 IIKANSF 443


>MIAB_CLOBK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  258 bits (660), Expect = 5e-71
 Identities = 155/427 (36%), Positives = 232/427 (54%), Gaps = 13/427 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N  +SE ++    +EGY   +  E ADV + NTC V    + K   +  I+   
Sbjct: 20  TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKVYGNLGILKGL 79

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           + +NP  IIAV GC  Q   +A T       VD+++G+ N      Y+N+ + +    +K
Sbjct: 80  KSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNLHNFPNYLNEVKKKDTSVLK 139

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +    ++ + E++ I+   N  +AF+ I  GCN FC YC++PY RG   S+ P+ + DEI
Sbjct: 140 IQEK-EDSIIENMPIDR-KNSMKAFVTIMYGCNNFCTYCIVPYVRGRERSRTPENIEDEI 197

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG DL+ KVT  +LLE +  IDG+ERVR  +  P   T+D
Sbjct: 198 KKLISEGYKEITLLGQNVNSYGKDLEPKVTFAELLERVNTIDGLERVRFMTSHPKDLTDD 257

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC   HL +QSG    LK+MNR Y  ++Y D+V+ ++  I +V+++TD+I
Sbjct: 258 VIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVVSKIKKLIPNVALSTDII 317

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A   E+QV  + K +R  +L+E
Sbjct: 318 VGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFEDQVPEDVKHKRFNRLVE 377

Query: 361 -LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            +N I+ K   + Y G++ +VL E   +       G TR    VN   D +  GK++NVK
Sbjct: 378 VVNEISAKK-NKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLVNFIGDKDSIGKLVNVK 436

Query: 420 I---NSF 423
           I   NSF
Sbjct: 437 IIKANSF 443


>Y830_THEMA RecName: Full=Putative methylthiotransferase TM_0830;   
                EC=2.-.-.-;
          Length = 434

 Score =  258 bits (658), Expect = 9e-71
 Identities = 155/425 (36%), Positives = 237/425 (55%), Gaps = 13/425 (3%)

Query: 3   VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           V   T GC+VN YESE M E+  + GY V+     A  Y+VN+C+VT   +KK +++I  
Sbjct: 4   VRIETFGCKVNQYESEYMAEQLEKAGYVVLPDGNAA-YYIVNSCAVTKEVEKKVKRLIKS 62

Query: 63  ARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
            R +N  A I + GC+AQ++P E   +  VD+VLG   K  IV ++N     GKQQV V 
Sbjct: 63  IRNRNKNAKIILTGCFAQLSPDEAKNLP-VDMVLGIDEKKHIVDHINSLN--GKQQVVVS 119

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL-DEIR 181
              +  V+E +K   + ++TR+++K++DGC+  C YC I   RG+     P ++  +E  
Sbjct: 120 EPGR-PVYEKVK-GSFEDRTRSYIKVEDGCDNTCTYCAIRLARGTRIRSKPLEIFKEEFA 177

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
            +   G+KEI+++G++   YG D+    +L +LL+ IEK+ G  RVR+ SI+     +++
Sbjct: 178 EMVMKGYKEIVITGVNLGKYGKDMGS--SLAELLKVIEKVPGDYRVRLSSINVEDVNDEI 235

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           V+      +LCPH H+S+QSG D  LKRM R+Y   ++  +V+ LR    D SITTD+IV
Sbjct: 236 VKAFKRNPRLCPHLHISVQSGSDDVLKRMGRKYKISDFMRVVDKLRSIDPDFSITTDIIV 295

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++++  S+ HIF++SPR GT A  ME  V  +KK ER   L E 
Sbjct: 296 GFPGETDADFQRTLELVEKVEFSRVHIFRFSPRPGTPASRMEGGVPESKKKERLDVLKEK 355

Query: 362 NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKIN 421
            +     + ++ IG+   VL E  V    GV +GY   Y+K       N  G+  +V++ 
Sbjct: 356 AKDVSIRYRKRIIGKERKVLAEWYVM--KGVLSGYDEYYVKHEFVG--NRVGEFHSVRVK 411

Query: 422 SFEGE 426
           S   E
Sbjct: 412 SLSEE 416


>MIAB_THEP3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  256 bits (654), Expect = 3e-70
 Identities = 165/437 (37%), Positives = 254/437 (58%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N ++SE +     + GY+  +  E ADV + NTC+V    + +   ++GR    
Sbjct: 37  TYGCQMNVHDSEKLAGMLEKMGYKYTENLEQADVLLFNTCAVREHAEIR---VLGRVSQM 93

Query: 64  ---RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + +NP  II V GC  Q   +          +D+V G+ N  +    + +A +    
Sbjct: 94  KELKARNPNLIIGVSGCMMQEKNVVEAIKEKYSYIDIVFGTHNIYKFPQLLWEALNSQDI 153

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +    KN V E+L ++  +N  +A++ I  GCN FC YC++PYTRG   S+ P+ ++
Sbjct: 154 VIDIIEDTKN-VIEELPVKRDSN-LKAWVNIIYGCNNFCTYCIVPYTRGREKSRKPEDII 211

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ LA+ G+KEI L G +  SYG DLDE +T   LL ++  I+GIER+R  +  P   
Sbjct: 212 AEVKELAQKGYKEITLLGQNVNSYGKDLDEDITFAKLLYKLNDIEGIERIRFMTSHPKDI 271

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           +++++  I  L K+C H HL +Q+G +  LK+MNR+YT + Y +I++ +R  I D++ITT
Sbjct: 272 SDELIYAIRDLDKVCEHLHLPVQAGSNKILKKMNRKYTKEHYLEIIDKVRSNIPDIAITT 331

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG              R+     + F YS R GT A NM +QVD   K ER ++
Sbjct: 332 DIIVGFPGXXXXXXXXXXXXXXRVRFDAAYTFIYSKRAGTVAANMPDQVDDAVKHERLER 391

Query: 358 LIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           LIEL N+I+ +  AE   G++++VL E   +  S   T  TR    V+   D ++ GK+ 
Sbjct: 392 LIELQNKISLEKSAE-LRGKIVEVLIEGISKRDSNKLTSRTRTNKVVHFVGDESLIGKLA 450

Query: 417 NVKINSFEGEVAEGEIV 433
           NVKI   +    +GE+V
Sbjct: 451 NVKITETKAWTMQGELV 467


>MIAB_THEPX RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  255 bits (651), Expect = 6e-70
 Identities = 164/437 (37%), Positives = 254/437 (58%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N ++SE +     + GY+  +  E ADV + NTC+V    + +   ++GR    
Sbjct: 37  TYGCQMNVHDSEKLAGMLEKMGYKYTENLEQADVLLFNTCAVREHAEIR---VLGRVSQM 93

Query: 64  ---RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + +NP  II V GC  Q   +          +D+V G+ N  +    + +A +    
Sbjct: 94  KELKARNPNLIIGVSGCMMQEKNVVEAIKEKYSYIDIVFGTHNIYKFPQLLWEALNSQDI 153

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +    KN V E+L ++  +N  +A++ I  GCN FC YC++PYTRG   S+ P+ ++
Sbjct: 154 VIDIIEDTKN-VIEELPVKRDSN-LKAWVNIIYGCNNFCTYCIVPYTRGREKSRKPEDII 211

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ LA+ G+KEI L G +  SYG DLDE +T   LL ++  I+GIER+R  +  P   
Sbjct: 212 AEVKELAQKGYKEITLLGQNVNSYGKDLDEDITFAKLLYKLNDIEGIERIRFMTSHPKDI 271

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           +++++  +  L K+C H HL +Q+G +  LK+MNR+YT + Y +I++ +R  I D++ITT
Sbjct: 272 SDELIYAMRDLDKVCEHLHLPVQAGSNKILKKMNRKYTKEHYLEIIDKVRSNIPDIAITT 331

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG              R+     + F YS R GT A NM +QVD   K ER ++
Sbjct: 332 DIIVGFPGXXXXXXXXXXXXXXRVRFDAAYTFIYSKRAGTVAANMPDQVDDAVKHERLER 391

Query: 358 LIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           LIEL N+I+ +  AE   G++++VL E   +  S   T  TR    V+   D ++ GK+ 
Sbjct: 392 LIELQNKISLEKSAE-LRGKIVEVLIEGISKRDSNKLTSRTRTNKVVHFVGDESLIGKLA 450

Query: 417 NVKINSFEGEVAEGEIV 433
           NVKI   +    +GE+V
Sbjct: 451 NVKITETKAWTMQGELV 467


>MIAB_PELTS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  253 bits (646), Expect = 2e-69
 Identities = 147/425 (34%), Positives = 222/425 (52%), Gaps = 7/425 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K      GC++N ++SE +       GY     +E  D+ ++NTC V    + K   ++G
Sbjct: 3   KYRIIVFGCQMNEHDSEVLAGILESMGYCQAGNSEDPDIILINTCCVRKTAENKVFSLLG 62

Query: 62  RARRQ---NPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           R RRQ   NP  II V GC  Q   +A         VD++ G+ N  ++   + K  +  
Sbjct: 63  RLRRQKAQNPNLIIGVCGCMPQQEGMAERIKQLFPHVDLIFGTHNVHQLPELIGKVIEGQ 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           KQ +++      ++ E+L ++      RA++ I  GCN FC YC++PY RG   S+ P+ 
Sbjct: 123 KQVLEIWPGYGGELREELPVKRKEG-VRAWVTIMYGCNNFCTYCIVPYVRGREKSRSPEA 181

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           V +E+  LA  GFKE+IL G +  SYG DL  K     LLE +E IDGI+R+R  +  P 
Sbjct: 182 VYEEVARLAGEGFKEVILLGQNVNSYGKDLGVKTDFASLLESLENIDGIDRIRYMTSHPR 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            F+  +V  I A KK+C HFHL +Q+G +  LK+MNR YT +EY D++  ++  I   ++
Sbjct: 242 DFSLRLVEAIAASKKVCEHFHLPVQAGSNRILKKMNRGYTREEYVDLIRYIKSLIPHATV 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           TTD++VGFPG            ++ I     + F Y+ R GT A  M +QV  N K ER 
Sbjct: 302 TTDIMVGFPGETDEDFNDTLDLVREIRFDSAYTFVYNIRPGTPAAEMPDQVAENVKKERI 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           + LI+L         E+ +G+  +VL E E + GSG   G  R    V    D ++ GK+
Sbjct: 362 QALIKLQNKISLERNEEEVGQTQEVLVEGEKDRGSGFIYGRNRGNKTVIFSGDPSLVGKV 421

Query: 416 LNVKI 420
           + V +
Sbjct: 422 VPVTV 426


>MIAB_CLOBH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  252 bits (644), Expect = 4e-69
 Identities = 152/427 (35%), Positives = 230/427 (53%), Gaps = 13/427 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N  +SE ++    +EGY   +  E ADV + NTC V    + K   +  I+   
Sbjct: 20  TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKVYGNLGILKGL 79

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           + +NP  IIAV GC  Q   +A T       VD+++G+ N      Y+N+ + +    +K
Sbjct: 80  KSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNLHNFPNYLNEVKKKDTSVLK 139

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +    +N + E++ I+   N  +AF+ I  GCN FC YC++PY RG   S+ P+ +  EI
Sbjct: 140 IQEK-ENSIIENMPIDR-KNSMKAFVTIMYGCNNFCTYCIVPYVRGRERSRTPENIEAEI 197

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG DL+  VT  +LL+ +  I+G+ERVR  +  P   T+D
Sbjct: 198 KKLISEGYKEITLLGQNVNSYGKDLEPNVTFAELLKRVNNIEGLERVRFMTSHPKDLTDD 257

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC   HL +QSG    LK+MNR Y  ++Y D+V+ ++  I +V+++TD+I
Sbjct: 258 VIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVVSKIKKLIPNVALSTDII 317

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A   E+QV  + K +R  +L+E
Sbjct: 318 VGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFEDQVPEDVKHKRFNRLVE 377

Query: 361 -LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            LN I+ K   + Y G++ +VL E   +       G TR    VN   D +  G+++NVK
Sbjct: 378 VLNEISAKK-NKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLVNFIGDKDSIGELVNVK 436

Query: 420 I---NSF 423
           I   NSF
Sbjct: 437 IIKANSF 443


>MIAB_CLOB1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  252 bits (644), Expect = 4e-69
 Identities = 152/427 (35%), Positives = 230/427 (53%), Gaps = 13/427 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N  +SE ++    +EGY   +  E ADV + NTC V    + K   +  I+   
Sbjct: 20  TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKVYGNLGILKGL 79

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           + +NP  IIAV GC  Q   +A T       VD+++G+ N      Y+N+ + +    +K
Sbjct: 80  KSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNLHNFPNYLNEVKKKDTSVLK 139

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +    +N + E++ I+   N  +AF+ I  GCN FC YC++PY RG   S+ P+ +  EI
Sbjct: 140 IQEK-ENSIIENMPIDR-KNSMKAFVTIMYGCNNFCTYCIVPYVRGRERSRTPENIEAEI 197

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG DL+  VT  +LL+ +  I+G+ERVR  +  P   T+D
Sbjct: 198 KKLISEGYKEITLLGQNVNSYGKDLEPNVTFAELLKRVNNIEGLERVRFMTSHPKDLTDD 257

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC   HL +QSG    LK+MNR Y  ++Y D+V+ ++  I +V+++TD+I
Sbjct: 258 VIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVVSKIKKLIPNVALSTDII 317

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A   E+QV  + K +R  +L+E
Sbjct: 318 VGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFEDQVPEDVKHKRFNRLVE 377

Query: 361 -LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            LN I+ K   + Y G++ +VL E   +       G TR    VN   D +  G+++NVK
Sbjct: 378 VLNEISAKK-NKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLVNFIGDKDSIGELVNVK 436

Query: 420 I---NSF 423
           I   NSF
Sbjct: 437 IIKANSF 443


>MIAB_CLOBL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  248 bits (634), Expect = 5e-68
 Identities = 150/427 (35%), Positives = 229/427 (53%), Gaps = 13/427 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N  +SE ++    +EGY   +  E ADV + NTC V    + K   +  I+   
Sbjct: 20  TWGCQMNEEDSEKLSGMLKKEGYIRTEERENADVIIFNTCCVRENAELKVYGNLGILKGL 79

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           + +NP  IIAV GC  Q   +A T       VD+++G+ N      Y+N+ + +    +K
Sbjct: 80  KSKNPNLIIAVTGCMMQQKGMAETIKKKFPFVDIIIGTHNLHNFPNYLNEVKKKDTSVLK 139

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +    ++ + E++ I+   N  +AF+ I  GCN FC YC++PY RG   S+ P+ +  EI
Sbjct: 140 IQEK-EDSIIENMPIDR-KNSMKAFVTIMYGCNNFCTYCIVPYVRGRERSRTPENIEAEI 197

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG DL+  VT  +LL+ +  I+G+ERVR  +  P   T+D
Sbjct: 198 KKLISEGYKEITLLGQNVNSYGKDLEPNVTFAELLKRVNNIEGLERVRFMTSHPKDLTDD 257

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  I    KLC   HL +QSG    LK+MNR Y  ++Y D+V+ ++  I +V+++TD+I
Sbjct: 258 VIEAIAKCDKLCEQIHLPVQSGSSEILKKMNRHYDREKYLDVVSKIKKLIPNVALSTDII 317

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS RKGT A   E+QV  + K +R  +L+E
Sbjct: 318 VGFPGETEKDFEETLSLVKEVEYDSAFTFLYSIRKGTPAAKFEDQVPEDVKHKRFNRLVE 377

Query: 361 -LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            +N I+ K   + Y G++ +VL E   +       G TR    VN   D +  G+ +NVK
Sbjct: 378 VVNEISAKK-NKAYEGKIEEVLVEGTSKNDENKLMGRTRTGKLVNFIGDKDSIGEFVNVK 436

Query: 420 I---NSF 423
           I   NSF
Sbjct: 437 IIKANSF 443


>MIAB_CLOB8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 455

 Score =  246 bits (629), Expect = 2e-67
 Identities = 145/432 (33%), Positives = 228/432 (52%), Gaps = 13/432 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE ++    R GYE  +  + A + + NTC V    + K    +G  ++Q
Sbjct: 24  TYGCQMNEEDSEKLSGMLKRMGYENTENRDEASIIIFNTCCVRENAENKVFGNLGALKKQ 83

Query: 67  ---NPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
              NP+ +I + GC  Q   +A   +     V+++ G+ N  +   Y+N+ + EG Q +K
Sbjct: 84  KEKNPDLVIGICGCMMQQKGMADDILKRFPYVNIIFGTHNSYKFPEYLNRVKTEGVQ-IK 142

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                + ++ E + I+  ++  + F+ I  GCN FC YC++PY RG   S+ P+ +++EI
Sbjct: 143 EIIDKETEIVEGIPIDRKSD-IKGFVTIMYGCNNFCTYCIVPYVRGRERSRKPEDIVNEI 201

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + +   G+KE+ L G +  SYG  L+E +T  DLL ++ +I+G+ER+R  +  P   T D
Sbjct: 202 KDMVTRGYKEVTLLGQNVNSYGKGLEENITFADLLRKVNEIEGLERIRFMTSHPKDLTLD 261

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           VV  I    K+C   HL +QSG D  LK MNR YT ++Y  +   +R +I DV+ +TD+I
Sbjct: 262 VVYAIRDCDKVCEQIHLPVQSGSDRILKEMNRHYTKEQYITLAKKIRAEIPDVTFSTDII 321

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG             K +       F YS R  T A+ MENQ+    K ER  +L+E
Sbjct: 322 VGFPGETEEDFSETLELAKEVRYDAAFTFIYSRRNHTPADKMENQIPDEIKHERFNRLVE 381

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           +         +   G++ +VL E   +      TG TRN   VN +   ++ GK++NVKI
Sbjct: 382 IVNTGIAKGNKDAEGKIYEVLVEGYSKNDEAKLTGRTRNGRLVNFEGGEDLIGKLVNVKI 441

Query: 421 ---NSFE--GEV 427
              NSF   GEV
Sbjct: 442 IKANSFSLIGEV 453


>MIAB_THETN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  244 bits (623), Expect = 1e-66
 Identities = 153/437 (35%), Positives = 235/437 (53%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N ++SE +       GY+  +  E ADV + NTC+V    + +   ++GR    
Sbjct: 37  TYGCQMNVHDSEKLAGMLEEMGYKYTEDLEKADVLLFNTCAVREHAEVR---VLGRVSQI 93

Query: 64  ---RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + +NP  II + GC  Q   I          VD+V G+ N  +    + +A +   Q
Sbjct: 94  KELKNRNPNLIIGISGCMMQEKHIVEAIREKYPHVDIVFGTHNIYKFPELLWQALNSRVQ 153

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + V    +N V E L I   +N  +A++ I  GCN FC YC++PYTRG   S+ P+ ++
Sbjct: 154 VIDVIENTQN-VIEGLPIRRDSN-LKAWVNIIYGCNNFCTYCIVPYTRGREKSRRPEDII 211

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ LAE G+KEI L G +  SYG DL   +    LL  +  I GIER+R  +  P   
Sbjct: 212 AEVKELAEKGYKEITLLGQNVNSYGKDLGGDINFAKLLYMLNDIKGIERIRFMTSHPKDI 271

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           +++++  +  L K+C H HL +Q+G +  LKRMNRRYT + Y +I++ +R  I D++ITT
Sbjct: 272 SDELIYAMRDLDKVCEHLHLPVQAGSNKILKRMNRRYTREHYLEIIDKVRANIPDIAITT 331

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            ++R+     + F YS R GT A +M +QVD   K +R  +
Sbjct: 332 DIIVGFPGETEEDFFQTLDLVERVRFDGAYTFMYSKRAGTPAASMPDQVDDEVKKDRLIR 391

Query: 358 LIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           LIEL N+I+ +  AE   G+V++VL E   +      T  TR    V+   D ++ GK+ 
Sbjct: 392 LIELQNKISLEKSAE-LKGKVVEVLIEGVSKRDPNKLTSRTRTNKVVHFIGDESLIGKLA 450

Query: 417 NVKINSFEGEVAEGEIV 433
           NVKI   +    +GE+V
Sbjct: 451 NVKITETKAWTMQGELV 467


>MIAB_CLOTH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  242 bits (618), Expect = 4e-66
 Identities = 140/434 (32%), Positives = 223/434 (51%), Gaps = 10/434 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N ++SE +       GY   D    +D+ + NTC V    + K    +G  +  
Sbjct: 49  TFGCQMNEHDSEKLAGMLAEMGYAETDNVNESDLVIYNTCCVRENAELKVYGHLGMLKPL 108

Query: 65  -RQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             Q P+ +IAV GC  Q  P  V  I+     VD++ G+ N  +    +  A D     V
Sbjct: 109 KNQKPDLVIAVCGCMMQ-QPEVVEHIKKTYSHVDLIFGTHNLYKFPELLYSAMDSQTTVV 167

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
            V      ++ E++ IE  +   +A++ +  GCN FC YC++PY RG   S+    +L+E
Sbjct: 168 DVWDC-DGQIAENVAIERKDG-VKAWVTVMYGCNNFCTYCIVPYVRGRERSRSMDDILEE 225

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           +R L   GFKEI L G +  SYG D+ +  +  +L+ E+ KI GIER+R  +  P   ++
Sbjct: 226 VRMLGRQGFKEITLLGQNVNSYGKDIGDGTSFAELIREVNKIPGIERIRFTTSHPKDLSD 285

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           D++  +   +K+C H HL  Q+G    LK MNR+YT ++Y ++V  +++ I D+++TTD+
Sbjct: 286 DLIYAMRDCEKVCEHLHLPFQAGSTRILKLMNRKYTKEDYINLVAKIKENIPDIALTTDI 345

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVGFPG            L+++     + F YS R GT A  ME+QV    K ER ++L+
Sbjct: 346 IVGFPGETEEDFSDTLDILEKVRFDNAYTFLYSKRTGTPAAKMEDQVPEEVKKERFQRLL 405

Query: 360 ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
           E      K   + +                  ++TG TR    VN +AD ++ GK++NV+
Sbjct: 406 ETQNRISKEINDTFXXXXXXXXXXXXXXTNDKIFTGRTRGNKVVNFEADASLIGKLVNVR 465

Query: 420 INSFEGEVAEGEIV 433
           IN+ +    EG IV
Sbjct: 466 INTVKTWSLEGSIV 479


>MIAB_CLOBB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  242 bits (618), Expect = 4e-66
 Identities = 146/433 (33%), Positives = 226/433 (52%), Gaps = 8/433 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE ++     +GYE  +  + A + + NTC V    + K    +GR + Q
Sbjct: 25  TWGCQMNEEDSEKLSGMLKSQGYEETENRDEASIVIFNTCCVRENAENKVFGNLGRLKNQ 84

Query: 67  ---NPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
              NP  IIA+ GC  Q   +A   +S    VD++ G+ N  +   Y+++ + EG Q VK
Sbjct: 85  KEKNPNLIIALCGCMMQQKGMADEILSRFPYVDIIFGTHNAYKFPEYLHRVQVEGVQ-VK 143

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                + ++ E + I+  +N  +AF+ I  GCN FC YC++PY RG   S+ P+ + +EI
Sbjct: 144 EIFDKETEIVEGVPIDRKSN-VKAFVTIMYGCNNFCTYCVVPYVRGRERSRRPEDIENEI 202

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L   G+KEI L G +  SYG  L+E++T   LL  I +IDG+ER+R  +  P   T D
Sbjct: 203 KELVSSGYKEITLLGQNVNSYGKGLEEEITFAQLLRRINEIDGLERLRFMTSHPKDLTLD 262

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           VV  I    KLC   HL +QSG +  L++MNR Y  ++Y ++   +R++I DV+ +TD+I
Sbjct: 263 VVYAIRDCDKLCEQIHLPVQSGSNEILQKMNRHYNKEQYLELAKKIREEIPDVTFSTDII 322

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS R  T A+ MENQ+  + K +R  +L+ 
Sbjct: 323 VGFPGETEEDFEETINLVKEVRYDAAFTFIYSRRNHTPADKMENQIPDDVKHDRFNRLVA 382

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
                     +   G++ +VL E   +      TG TRN   VN      + GK++ VKI
Sbjct: 383 AVNEGIVVGNKAAEGKIYEVLVEGTSKNNENKLTGRTRNAKLVNFDGCKEMIGKLVKVKI 442

Query: 421 NSFEGEVAEGEIV 433
              +     GE+V
Sbjct: 443 IEAKSFSLVGEVV 455


>MIAB_CLOBA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  242 bits (617), Expect = 5e-66
 Identities = 145/433 (33%), Positives = 227/433 (52%), Gaps = 8/433 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE ++     +GYE  +  + A + + NTC V    + K    +GR + Q
Sbjct: 24  TFGCQMNEEDSEKLSGMLKSQGYEETENRDEASIVIFNTCCVRENAENKVFGNLGRLKNQ 83

Query: 67  ---NPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
              NP  IIA+ GC  Q   +A   +S    VD++ G+ N  +   Y+++ + EG Q VK
Sbjct: 84  KEKNPNLIIALCGCMMQQKGMADEILSRFPYVDIIFGTHNAYKFPEYLHRVQVEGVQ-VK 142

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                + ++ E + I+  +N  +AF+ I  GCN FC YC++PY RG   S+ P+ + +EI
Sbjct: 143 EIFDKETEIVEGVPIDRKSN-VKAFVTIMYGCNNFCTYCVVPYVRGRERSRRPEDIENEI 201

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L  +G+KEI L G +  SYG  L+E++T   LL  I +IDG+ER+R  +  P   T D
Sbjct: 202 KELVSNGYKEITLLGQNVNSYGKGLEEEITFAQLLRRINEIDGLERLRFMTSHPKDLTLD 261

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           VV  I    KLC   HL +QSG +  L++MNR Y  ++Y ++   +R++I DV+ +TD+I
Sbjct: 262 VVYAIRDCDKLCEQIHLPVQSGSNEILQKMNRHYNKEQYLELAKKIREEIPDVTFSTDII 321

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K +       F YS R  T A+ ME+Q+  + K +R  +L+ 
Sbjct: 322 VGFPGETEEDFEETINLVKEVRYDAAFTFIYSRRNHTPADKMEDQIPDDVKHDRFNRLVA 381

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
                     +   G++ +VL E   +      TG TRN   VN      + GK++ VKI
Sbjct: 382 AVNEGIVVGNKAAEGKIYEVLVEGTSKNNENKLTGRTRNAKLVNFDGCKEMIGKLVKVKI 441

Query: 421 NSFEGEVAEGEIV 433
              +     GE+V
Sbjct: 442 IEAKSFSLVGEVV 454


>MIAB_CLONN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 452

 Score =  241 bits (614), Expect = 1e-65
 Identities = 139/435 (31%), Positives = 231/435 (53%), Gaps = 10/435 (2%)

Query: 6   ATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR- 64
           +T GC++N  +SE ++      GY   D  + ADV + NTC V    ++K    +G  + 
Sbjct: 21  STWGCQMNEEDSEKISGLLKGIGYTRTDIRDEADVVIFNTCCVRENAEQKVYGHLGELKA 80

Query: 65  --RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             R+NP  I+ V GC  Q   +    +     VD++ G+ N  ++  Y+ + + EG   +
Sbjct: 81  LKRKNPNLILIVTGCMMQQKGMPEKVMEKFPHVDIIAGTYNSYKLPEYIERVKTEGNSII 140

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           ++    K  + E L ++  ++  +AF+ I  GCN FC+YC++PY RG   S+DP+ ++DE
Sbjct: 141 EIWDKEKG-IVEGLPVDRKSD-IKAFVTIMYGCNNFCSYCIVPYVRGRERSRDPQNIIDE 198

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I+ L   G+KEI L G +  SYG  L+ ++    LL  + KIDG+ER+R  +  P   ++
Sbjct: 199 IKDLVSKGYKEITLLGQNVNSYGKGLEPEINFATLLRMVNKIDGLERIRFMTSHPKDVSD 258

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           ++++ +   +K+C   H +LQSG    L++MNR+YT ++Y  +V  LR  + +V I+TD+
Sbjct: 259 ELIKAMAECEKVCEQGHFALQSGSTEILQKMNRKYTREDYLTLVKKLRKAMPNVGISTDI 318

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           I+G+PG            +K I       F YS R+GT A  +E+QV  + K  R  KL+
Sbjct: 319 IIGYPGETEKDFEDTLSIVKEIEFDSAFTFIYSKREGTPAAKLEDQVPEDVKHTRFNKLV 378

Query: 360 E-LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
           E +N I  +   E + G+ ++VL E   +       G TR+   VN     +  GK++N+
Sbjct: 379 EAVNEIMARKNKE-FEGKTVEVLVEGPSKNDDTKLMGRTRSGKLVNFNGCLDQVGKLVNI 437

Query: 419 KINSFEGEVAEGEIV 433
           KI         GEI+
Sbjct: 438 KITKANSFSLTGEII 452


>MIAB_ALKOO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  239 bits (610), Expect = 3e-65
 Identities = 147/441 (33%), Positives = 226/441 (51%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N ++SE ++      GY +    E A++ + NTC V    + K    IG
Sbjct: 34  KYMITTYGCQMNEHDSETLSGMLENMGYSITTNKEEANLIIYNTCCVRENAELKVYGNIG 93

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARDE 114
             +   ++N + IIAV GC  Q  P  V  I+     VD+V G+ N       ++++ + 
Sbjct: 94  ALKALKKKNEDLIIAVCGCMMQ-QPQVVKEIKRKYRHVDLVFGTHNLYRFPELLSRSMET 152

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
               ++V    +  + E L      +  + F+ I  GCN FC YC++PYTRG   S++  
Sbjct: 153 EGMFIEVWDE-ETGIVEGLPANRKYD-LKGFINIMYGCNNFCTYCIVPYTRGRERSREVA 210

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
            ++ E   LA +G KEI L G +  SYG  L+  +   DLL  + KIDGIER+R  +  P
Sbjct: 211 DIIREATDLANNGTKEITLLGQNVNSYGKTLEHPIDFADLLRALNKIDGIERIRFMTSHP 270

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
              +E ++  I    K+C HFHL  QSG +  LK MNR+YT + Y  IV  L+D+I ++ 
Sbjct: 271 KDLSERLIDAIAECDKVCEHFHLPFQSGSNQILKAMNRKYTKENYLSIVKKLKDRIPNIG 330

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFPG            ++       + F YS R+GT A  M+NQ+D   K ER
Sbjct: 331 LTTDIIVGFPGETEEDFQDTLDIVQEARYDSAYTFLYSIREGTPAAKMQNQIDEKVKQER 390

Query: 355 SKKLIELNRINE--KAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
             +L  L+++NE      + Y+ +V++VL E   +  S    G TR    VN   D ++ 
Sbjct: 391 FSRL--LDKVNEISAEINQSYLNKVVEVLVEGPSKTDSNKLMGRTRQNKLVNFSGDESLI 448

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           GK++NV+I         GE++
Sbjct: 449 GKLVNVRIVECRTFSLNGEVI 469


>MIAB_CLOAB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  238 bits (608), Expect = 6e-65
 Identities = 149/435 (34%), Positives = 225/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N  +SE +        YE  D  E AD+ + NTC V    + K    +G  ++ 
Sbjct: 11  TWGCQMNAEDSEKLAGMLKEMKYEATDNREDADLIIFNTCCVRENAELKVYGNLGTLKKL 70

Query: 66  --QNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
             + P  II V GC  Q   +A         VD+V+G+ N      Y+ K  +E    V+
Sbjct: 71  KDKKPNLIITVCGCMMQQRDMAEHIKKRFPFVDIVMGTHNTQMFPQYLKKVENERTSVVE 130

Query: 121 VGAVLKNKVFEDLKI-EEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           +    +  + E + I   Y+ K  AF+ I  GCN FC YC++PY RG   S+ P+ + +E
Sbjct: 131 IWDK-EEGIVEGMPIYRSYDMK--AFVTIMYGCNNFCTYCIVPYVRGRERSRKPEDIENE 187

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I+ L + G+KEI L G +  SYG  LDE++    LL  +  I+G+ R+R  +  P   T+
Sbjct: 188 IKELVKKGYKEITLLGQNVNSYGKSLDEEMNFALLLRRLNNIEGLLRIRFMTSHPKDLTD 247

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           DV+  I    K+C H HL +QSG    L +MNR YT ++Y ++VN ++  I++V+ITTD+
Sbjct: 248 DVIAAIADCDKVCEHIHLPVQSGSTTILNKMNRNYTREDYINLVNKIKSGIKNVAITTDI 307

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVGFPG            +K +       F YS R+GT A   ENQ+    K +R  KL+
Sbjct: 308 IVGFPGETEEDFEDTLSLVKEVEYDSAFTFLYSIREGTPAAKYENQIPDEVKHKRFNKLL 367

Query: 360 E-LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
           E +N I+EK   E Y G+++++L E + +       G TR    VN +   +  GK++NV
Sbjct: 368 EAVNLISEKKNKE-YEGKIVEILVEGKSKNDGSKLMGRTRTGKLVNFEGLESSIGKLINV 426

Query: 419 KINSFEGEVAEGEIV 433
           KI   +     GE V
Sbjct: 427 KITKAQAFSLVGEEV 441


>MIAB_NATTJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  237 bits (605), Expect = 1e-64
 Identities = 141/432 (32%), Positives = 225/432 (52%), Gaps = 8/432 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N ++SE +     + G+E     E AD+ ++NTC+V    ++K    IG  R  
Sbjct: 16  TFGCQMNEHDSEVLAGMLDQMGFEKAASEEEADLLIINTCAVREKAEQKVLGKIGTLRYL 75

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
               P+  IA+ GC  Q   +A         VD++ G+ N       +     +GK+ VK
Sbjct: 76  KENKPDMKIAIGGCMVQQEHVANKIYRDFTHVDIIFGTHNINRFPQLLEHVMQKGKR-VK 134

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
             +   ++VFE+L   +  +  +A++ I  GC+ +C YC++PY RG   S+DP+ +  E+
Sbjct: 135 EISQDDSQVFENLP-HKREDSIKAWVVISYGCDNYCKYCIVPYVRGQQRSRDPEHIKYEV 193

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
             LA+ G KEI L G +  SYG DLD+ ++  +LLEE+ KI+GIER+R  +  P  F ++
Sbjct: 194 EKLAKEGLKEITLLGQNVNSYGKDLDQNISFTNLLEELSKIEGIERIRFMTSHPKDFDKE 253

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++  +    K+C HFHL +Q+G +  LK+M R YT + Y DIVN +R ++ + SITTD+I
Sbjct: 254 LITTLKESNKICEHFHLPVQAGSNKILKKMGRGYTREHYVDIVNDIRAELPNASITTDII 313

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VG+PG            ++ +       F YS R GT A  M  QVD   K  R +KLI 
Sbjct: 314 VGYPGEEEEDFQETLDLVQNVKFDSAFTFVYSKRSGTPAAEMAEQVDEQTKKGRIQKLIS 373

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           + +   +   +     V  +L E   +    + +G TR    V+   D  + G++++VKI
Sbjct: 374 VQQEISEQRNKDLENTVQRILVEGVSKNNEDMLSGRTRTDKLVHFPGDKELIGELVDVKI 433

Query: 421 NSFEGEVAEGEI 432
                    GEI
Sbjct: 434 TRGHSWNLYGEI 445


>MIAB_CLOPH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  233 bits (594), Expect = 2e-63
 Identities = 139/436 (31%), Positives = 233/436 (53%), Gaps = 15/436 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQ---IIGRA 63
           T GC++N  +SE +       GY   D +E AD  V NTC+V    + +       +G  
Sbjct: 25  TFGCQMNAKDSEKLAGILETIGYVESD-SEEADFVVYNTCTVRENANTRVYGRIGFLGNL 83

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRN---KGEIVYYVNKARDEGKQ 117
           +++NP   IA+ GC  Q   +          VD+V G+ N     E++Y    AR   K+
Sbjct: 84  KKKNPHMRIALCGCMMQESHVVEKIKKSYRFVDIVFGTHNIFKLAELIY----ARHTTKK 139

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            V       +K+ E+L  E+   K +A + I  GCN FC+YC++PY RG   S++P+ ++
Sbjct: 140 MVIDIWKETDKIVEELPSEQ-KYKFKAGVNIMYGCNNFCSYCIVPYVRGRERSRNPEDII 198

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            EI+ L   G  E++L G +  SYG  LDE V+   LL+ +E+++G++R+R  +  P   
Sbjct: 199 KEIKQLVSKGVVEVMLLGQNVNSYGKTLDEPVSFAQLLQMVEQVEGLKRIRFMTPHPKDL 258

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           + DV+  +   KK+C H HL +QSG    L +MNR+YT ++Y ++V+ ++  + ++S+TT
Sbjct: 259 SNDVIEVMKNSKKICNHIHLPVQSGSTELLMKMNRKYTKEDYLNLVDRIKMAMPNISLTT 318

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            ++++     + F YS R GT A  MENQ+     +ER ++
Sbjct: 319 DIIVGFPGETEEDFLDTLDVVRKVGYDSAYTFIYSKRSGTPAATMENQIPEEVANERFQR 378

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L+   R +    ++   G++ +VL EE  E  + + TG   N + V+ K    + G I++
Sbjct: 379 LLTTIRESSSKISKDDEGKIAEVLVEEVNEQDNSLMTGRLSNNVLVHFKGTKELIGNIVS 438

Query: 418 VKINSFEGEVAEGEIV 433
           VK++  +G    GE++
Sbjct: 439 VKLSECKGFYYMGEMM 454


>MIAB_CLOPE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  231 bits (590), Expect = 7e-63
 Identities = 142/436 (32%), Positives = 221/436 (50%), Gaps = 12/436 (2%)

Query: 6   ATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGR 62
           +T GC++N  +SE ++     +GYE  +  E A + + NTC V    + K          
Sbjct: 15  STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKVFXXXXXXXX 74

Query: 63  ARRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
                   +IA+ GC  Q   +A   +     VD++ G+ N  +   Y+++   EG Q V
Sbjct: 75  XXXXXXXXVIAICGCMMQQVGMADKVLKTFPYVDIIFGTHNAHKFPEYLHRVLQEGVQ-V 133

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           K     +  + E L I+  ++  +AF+ I  GCN FC YC++PY RG   S+  + ++ E
Sbjct: 134 KEILNKEEGIVEGLPIDRKSD-VKAFVTIMYGCNNFCTYCIVPYVRGRERSRKSEDIIKE 192

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I  L   G+KEI L G +  SYG  L+E +    LL ++ ++ G+ERVR  +  P   ++
Sbjct: 193 IEELVSQGYKEITLLGQNVNSYGKGLEEDIDFAGLLRKVNEVKGLERVRFMTSHPKDLSD 252

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           DV+  I    KLC   HL +QSG    LK MNR Y  + Y D+V  ++ +I DV++TTD+
Sbjct: 253 DVIMAIKECDKLCEQVHLPVQSGSSRILKEMNRHYDREYYLDLVKKIKSEIPDVTLTTDI 312

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           I+GFPG             + +       F YS R  T A+ MENQ+  + K +R  +L+
Sbjct: 313 IIGFPGETEEDFLDTLSLCEEVGYDSAFTFIYSRRNHTPADKMENQIPDDIKHDRFNRLV 372

Query: 360 ELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           E   IN+K     ++Y G+V++VL E   +      TG TRN   VN   D  + G+++N
Sbjct: 373 E--AINKKVVIKNKEYEGKVVEVLVEGPSKNDETKLTGRTRNGKLVNFAGDEKLVGELVN 430

Query: 418 VKINSFEGEVAEGEIV 433
           +KI   +     GEIV
Sbjct: 431 LKIVRAQPFSLIGEIV 446


>MIAB_CLOP1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  231 bits (590), Expect = 7e-63
 Identities = 142/436 (32%), Positives = 221/436 (50%), Gaps = 12/436 (2%)

Query: 6   ATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGR 62
           +T GC++N  +SE ++     +GYE  +  E A + + NTC V    + K          
Sbjct: 15  STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKVFXXXXXXXX 74

Query: 63  ARRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
                   +IA+ GC  Q   +A   +     VD++ G+ N  +   Y+++   EG Q V
Sbjct: 75  XXXXXXXXVIAICGCMMQQVGMADKVLKTFPYVDIIFGTHNAHKFPEYLHRVLQEGVQ-V 133

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           K     +  + E L I+  ++  +AF+ I  GCN FC YC++PY RG   S+  + ++ E
Sbjct: 134 KEILNKEEGIVEGLPIDRKSD-VKAFVTIMYGCNNFCTYCIVPYVRGRERSRKSEDIIKE 192

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I  L   G+KEI L G +  SYG  L+E +    LL ++ ++ G+ERVR  +  P   ++
Sbjct: 193 IEELVSQGYKEITLLGQNVNSYGKGLEEDIDFAGLLRKVNEVKGLERVRFMTSHPKDLSD 252

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           DV+  I    KLC   HL +QSG    LK MNR Y  + Y D+V  ++ +I DV++TTD+
Sbjct: 253 DVIMAIKECDKLCEQVHLPVQSGSSRILKEMNRHYDREYYLDLVKKIKSEIPDVTLTTDI 312

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           I+GFPG             + +       F YS R  T A+ MENQ+  + K +R  +L+
Sbjct: 313 IIGFPGETEEDFLDTLSLCEEVGYDSAFTFIYSRRNHTPADKMENQIPDDIKHDRFNRLV 372

Query: 360 ELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           E   IN+K     ++Y G+V++VL E   +      TG TRN   VN   D  + G+++N
Sbjct: 373 E--AINKKVVIKNKEYEGKVVEVLVEGPSKNDETKLTGRTRNGKLVNFAGDEKLVGELVN 430

Query: 418 VKINSFEGEVAEGEIV 433
           +KI   +     GEIV
Sbjct: 431 LKIVRAQPFSLIGEIV 446


>MIAB_CLOPS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  231 bits (589), Expect = 9e-63
 Identities = 142/436 (32%), Positives = 221/436 (50%), Gaps = 12/436 (2%)

Query: 6   ATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGR 62
           +T GC++N  +SE ++     +GYE  +  E A + + NTC V    + K          
Sbjct: 15  STYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVRENAENKVFXXXXXXXX 74

Query: 63  ARRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
                   +IA+ GC  Q   +A   +     VD++ G+ N  +   Y+++   EG Q V
Sbjct: 75  XXXXXXXXVIAICGCMMQQVGMADKVLKTFPYVDIIFGTHNAHKFPEYLHRVLQEGVQ-V 133

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           K     +  + E L I+  ++  +AF+ I  GCN FC YC++PY RG   S+  + ++ E
Sbjct: 134 KEILNKEEGIVEGLPIDRKSD-VKAFVTIMYGCNNFCTYCIVPYVRGRERSRKSEDIIKE 192

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I  L   G+KEI L G +  SYG  L+E +    LL ++ ++ G+ERVR  +  P   ++
Sbjct: 193 IEELVSKGYKEITLLGQNVNSYGKGLEEDIDFAGLLRKVNEVKGLERVRFMTSHPKDLSD 252

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           DV+  I    KLC   HL +QSG    LK MNR Y  + Y D+V  ++ +I DV++TTD+
Sbjct: 253 DVIMAIKECDKLCEQVHLPVQSGSSRILKEMNRHYDREYYLDLVKKIKSEIPDVTLTTDI 312

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           I+GFPG             + +       F YS R  T A+ MENQ+  + K +R  +L+
Sbjct: 313 IIGFPGETEEDFLDTLSLCEEVGYDSAFTFIYSRRNHTPADKMENQIPDDIKHDRFNRLV 372

Query: 360 ELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           E   IN+K     ++Y G+V++VL E   +      TG TRN   VN   D  + G+++N
Sbjct: 373 E--AINKKVVIKNKEYEGKVVEVLVEGPSKNDETKLTGRTRNGKLVNFAGDEKLVGELVN 430

Query: 418 VKINSFEGEVAEGEIV 433
           +KI   +     GEIV
Sbjct: 431 LKIVRAQPFSLIGEIV 446


>Y477_CHLPN RecName: Full=Putative methylthiotransferase
           CPn_0477/CP_0277/CPj0477/CpB0496;         EC=2.-.-.-;
          Length = 421

 Score =  229 bits (583), Expect = 4e-62
 Identities = 138/429 (32%), Positives = 223/429 (51%), Gaps = 25/429 (5%)

Query: 8   LGCRVNTYESEAMTEKFVREGY-EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           LGCRVN YE +A  ++    GY EV+D    AD+ ++NTC+VT   +   R  + +  RQ
Sbjct: 15  LGCRVNQYEVQAYRDQLTILGYQEVLDSEIPADLCIINTCAVTASAESSGRHAVRQLCRQ 74

Query: 67  NPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLK 126
           NP A I V GC  +      + ++    ++ ++ K  ++  +                  
Sbjct: 75  NPTAHIVVTGCLGESDKEFFASLDRQCTLVSNKEKSRLIEKIFSY--------------- 119

Query: 127 NKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEH 186
           +  F + KI  +  K+RAF+K+QDGCN FC+YC+IPY RG   S+  +K+L EI  + + 
Sbjct: 120 DTTFPEFKIHSFEGKSRAFIKVQDGCNSFCSYCIIPYLRGRSVSRPAEKILAEIAGVVDQ 179

Query: 187 GFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRIL 246
           G++E++++GI+   Y    D + +L  L+E++++I G              TED+ R I 
Sbjct: 180 GYREVVIAGINVGDY---CDGERSLASLIEQVDQIPGXXXXXXXXXXXXXXTEDLHRAIT 236

Query: 247 ALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVGFPGX 306
           + +  CP  HL LQSG ++ LKRMNR+Y+  ++ D V   R      + TTDVIVGFPG 
Sbjct: 237 SSRHTCPSSHLVLQSGSNSILKRMNRKYSRGDFLDCVEKFRASDPRYAFTTDVIVGFPGE 296

Query: 307 XXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL-NRIN 365
                      ++ +   K H F +S R+ T+A   +NQ+      ER K L E+  R+ 
Sbjct: 297 SDQDFEDTLRIIEDVGFIKVHSFPFSARRRTKAYTFDNQIPNQVIYERKKYLAEVAKRVG 356

Query: 366 EKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS-GKILNVKINSFE 424
           +K    K +GE  +VL E   ++   V TG++  + KV+      V+   +++V+++  E
Sbjct: 357 QKEMM-KRLGETTEVLVE---KVTGQVATGHSPYFEKVSFPVVGTVAINTLVSVRLDRVE 412

Query: 425 GEVAEGEIV 433
            E   GEIV
Sbjct: 413 EEGLIGEIV 421


>MIAB_AKKM8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  228 bits (580), Expect = 1e-61
 Identities = 139/446 (31%), Positives = 232/446 (52%), Gaps = 24/446 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKS---RQ 58
           K+   T GC++N  +SE +   FV++GY + D  + ADV + N+CS+    ++K+     
Sbjct: 3   KLYIKTYGCQMNERDSEQVARMFVQKGYTMTDREDEADVILFNSCSIREQAEQKALGKMG 62

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVN---KARDE 114
           ++ + +R  P  +  ++GC AQ    E+   +  +D+V+G++    +  +V+   +AR E
Sbjct: 63  LLAKQQRHRPHVVYGMMGCMAQSKKEELFKELPRLDLVVGTQKYHRVFEHVDGILRARQE 122

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKTR----------AFLKIQDGCNRFCAYCLIPYT 164
            +      A     V +  +  +  N+ R          A++ I  GC   CAYC++PYT
Sbjct: 123 RRMDELQTAFSGTHVCDVAEEADSQNRIRDHLNPGVRSTAYVSIMQGCEMKCAYCIVPYT 182

Query: 165 RGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKI 221
           RG+  S+  + V+DE++ LA+ G KE+ L G     YG  ++    K   V LLE + ++
Sbjct: 183 RGAERSRPIRDVVDEVKMLADAGVKEVTLLGQIVNRYGRQMETAGGKGGFVQLLEAVHEV 242

Query: 222 DGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYED 281
           +GI R+R  S  P  F +D+V+    L KLC H H  +QSG D  LK M R Y  + Y D
Sbjct: 243 EGIRRIRFVSPHPIGFRQDLVQAFTYLPKLCSHIHFPMQSGSDRILKMMRRPYRNETYLD 302

Query: 282 IVNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAEN 341
           + + ++    D+SITTD+IVGFPG            ++++      IF+YSPR+GT A  
Sbjct: 303 LCSRMKQARPDLSITTDIIVGFPGETEEDYLLTRQAVEQVQFDNAFIFRYSPRRGTPAAV 362

Query: 342 MENQVDGNKKDERSKKLIELNRINEKAFAEK--YIGEVIDVLFEEEVELGSGVYTGYTRN 399
           MENQ+    K+ R++ L+ +  +NE A  +    +G V +VL E   +  +   +G T  
Sbjct: 363 MENQIPEEVKEARNQDLLAV--VNEIAIRKNRDLVGTVQEVLLEGPSKTNAARLSGRTSQ 420

Query: 400 YIKVNAKADCNVSGKILNVKINSFEG 425
              V   A  +++G+IL ++I    G
Sbjct: 421 NKPVMVDAAPDLAGEILPIRIEESTG 446


>MIAB_FINM2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 461

 Score =  227 bits (579), Expect = 1e-61
 Identities = 134/436 (30%), Positives = 218/436 (50%), Gaps = 15/436 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N ++SE +       G+E  D    AD  + NTC V    + K    +G     
Sbjct: 31  THGCQMNEHDSEKIKTLLENMGFEKSDEKLDADFIIFNTCLVRENAEMKVYGQLGALKNL 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEVSGIEG---VDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           +R+NP+ +IAV GC  Q  P      E    VD+V G  N   + Y +++    GK  V 
Sbjct: 91  KRENPDMLIAVCGCMMQTGPARDIIREKYPQVDIVFGVNNINSLPYLIDRHLSSGKLVVX 150

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                              N+   ++ I  GCN FC YC++PY RG   S+  + +L E+
Sbjct: 151 XXXXXXXXXXXXXXXX---NEYVGYVNIMTGCNNFCTYCIVPYARGREQSRSVESILSEV 207

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + + + G+K+I L G +  SYG  L+  VT  +LL ++  ++G+ER+R  +  P   +++
Sbjct: 208 KRMVDQGYKDITLLGQNVNSYGKTLENPVTFTELLTKVNDVEGLERLRFLTSHPKDISDE 267

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++  +  L K+C + HL  Q+G ++ L+RM+RRYT                 ++ +TD+I
Sbjct: 268 LIEAMGKLDKVCENIHLPFQAGSNSVLERMHRRYTXXXXXXXXXXXXXXXXGITFSTDII 327

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++++   +   FKY+ R GT+A+  E+QVD + K +R ++L++
Sbjct: 328 VGFPGETEEDFQDTLDVVRKVGYEQAFTFKYNRRPGTKADLFEDQVDEDVKQDRLERLLD 387

Query: 361 LNRINEKAFAEK---YIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
              +    F EK   Y+G + +VL E E +    V TG TR +  VN K D +  GK++N
Sbjct: 388 ---VAYPIFYEKNKSYLGTIQEVLIEGESKNNPEVMTGRTRTFKLVNVKCDKSYIGKLVN 444

Query: 418 VKINSFEGEVAEGEIV 433
            KI  F      GE+V
Sbjct: 445 TKIVDFNSFALTGEMV 460


>MIAB_BACCN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  226 bits (576), Expect = 3e-61
 Identities = 142/439 (32%), Positives = 230/439 (52%), Gaps = 10/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFTTEDADVILLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   ++NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKPLKQKNPDLLIGVCGCMSQEESVVNKIMQKHQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
              V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ATVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA +G+KEI L G +  +YG D D+ +  L DL++E+ KID I R+R  +  P
Sbjct: 245 IIKEVRHLAANGYKEITLLGQNVNAYGKDFDDLEYGLGDLMDELRKID-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+YT ++Y ++V  ++  I +V 
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTDMLKIMARKYTREQYLELVRKIKKTIPNVV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ +    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETLSLYREVEFDSAFTFIYSPREGTPAAKMKDNIPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            ++L EL         +KY G++++VL + E +    V  GYTR    VN  A  +V G+
Sbjct: 424 LQRLNELVNEFSAKKNKKYEGQIVEVLVDGESKNNPDVLAGYTRTNKLVNFVAPKSVIGQ 483

Query: 415 ILNVKINSFEGEVAEGEIV 433
           ++ VKI   +     GE+V
Sbjct: 484 LVKVKITEAKTWSLNGELV 502


>MIAB_CARHZ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  225 bits (574), Expect = 5e-61
 Identities = 138/434 (31%), Positives = 226/434 (52%), Gaps = 10/434 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N ++SE +       G+      + AD+ ++NTCSV    + K    IG   + 
Sbjct: 10  THGCQMNVHDSETIAGILESMGFVPSPEEKTADLIIINTCSVRETAENKVFTKIGELKKL 69

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           +R+NP+ +I V GC  Q   +A   +     +D + G+ N  E+   + +  ++ ++ ++
Sbjct: 70  KRENPDLVIGVGGCIPQQEKVAKRLLERFPHLDFIFGTHNLPELPKILERVFEKHERVLE 129

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V    + ++ E + ++      RA++ I  GCN FC YC++PY RG   S+  + +L EI
Sbjct: 130 VWQS-EGQIVEGIPVKREPG-VRAWVTIMYGCNNFCTYCIVPYVRGRERSRKKEDILQEI 187

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           R L   G++E+ L G +  SYG DL  K    +LL +IEKIDG+ RVR  +  P   T+D
Sbjct: 188 RQLVAEGYREVTLLGQNVNSYGKDLKGKPMFAELLADIEKIDGLWRVRFTTSHPRDLTDD 247

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  + + +K+C H HL +Q+G +  LK M+R YT + Y ++V  +R KI  VS TTD+I
Sbjct: 248 VIEVMASSRKICEHLHLPVQAGSNKILKAMHRGYTREYYLNLVEKIRAKIPKVSFTTDII 307

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++++       F Y+ R GT A  M++QV    K  R ++LIE
Sbjct: 308 VGFPGETEEDFEQTLDLVRKVRYDSAFTFVYNKRTGTPAAEMKDQVPEEVKSRRIQELIE 367

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           L         +   G + ++L E + +       G TR    V    + ++ GK++ VKI
Sbjct: 368 LQNGISLELNKNEEGNIHEILVEGKSKTDETKLAGRTRTNKLVVFNGNEDLVGKLVKVKI 427

Query: 421 NSFEGEVAEGEIVL 434
              EG++   E VL
Sbjct: 428 T--EGKLFHLEGVL 439


>MIAB_BACWK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  224 bits (572), Expect = 8e-61
 Identities = 144/441 (32%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFSTEEADVILLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ II V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDLIIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ KID I R+R  +  P
Sbjct: 245 IIKEIRHLAANGYKEITLLGQNVNAYGKDFEDIQYGLGDLMDELRKID-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIDVLGKGGNLVEHIHLPVQSGSTDMLKIMARKYSREHYLELVRKIKETIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMQDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +NE      ++YIG++++VL E E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNTL--VNEYGVNKNKRYIGQIVEVLVEGESKNNPEVLAGYTRTNKLVNFVASKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VKI   +     GE+V
Sbjct: 482 GQLVKVKITEAKTWSLNGELV 502


>MIAB_DESAP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 443

 Score =  224 bits (570), Expect = 1e-60
 Identities = 125/363 (34%), Positives = 198/363 (54%), Gaps = 8/363 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N ++SE MT      GYE       AD+ ++NTC V    + +   ++G   R 
Sbjct: 12  TFGCQMNEFDSELMTGLLEGMGYEPAKSLREADLVLINTCCVRESAENRVWGLLGSLKRY 71

Query: 64  RRQNPEAIIAVVGCYAQIAPTEVSGIEG---VDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           +R  PE I+AV GC  Q   T    I     VD+VLG+ N+ E+   + + R  G++ V 
Sbjct: 72  KRDKPELIVAVSGCLPQQEGTAEEIIRRFPVVDLVLGTHNRHELPGLIEEVR-AGRRPVL 130

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                 + V E L +   +   RA++ +  GCN FC YC++PY RG  CS+ P  V+DE+
Sbjct: 131 GVRQPDSAVPEGLPVRRKSG-LRAWVPVIHGCNNFCTYCVVPYVRGRECSRRPDAVVDEV 189

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
             LA  G++E+ L G +  SYG DL E +    LL  ++ ++G+ R+R  +  P  FT+ 
Sbjct: 190 CGLAAAGYREVTLLGQNVNSYGRDLGEGIDFAALLARLDGVEGLWRIRFTTSHPRDFTDR 249

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++  +    K+C H HL  Q+G +  L+RMNR YT ++Y D+V  +R  + DVS+TTD++
Sbjct: 250 LIEVVARAAKVCEHIHLPAQAGSNRVLQRMNRGYTREDYLDLVARIRAAVPDVSLTTDLM 309

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++R+   +   F Y+PR+GT A    +QV  + K  R ++LI+
Sbjct: 310 VGFPGETEEDFADTLDLVRRVGYDQAFTFVYNPRRGTPAAGWPDQVPEDVKSRRIQELIQ 369

Query: 361 LNR 363
           + +
Sbjct: 370 VQK 372


>MIAB_STAAW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAAS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAAN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAAM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAA9 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAA2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAA1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_BACC4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  223 bits (569), Expect = 2e-60
 Identities = 142/441 (32%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I DV 
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTDMLKIMARKYSREHYLELVRKIKEAIPDVV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N  A  +  +Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNTL--VNTLAIEKNSRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVASKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VKI   +     GE+V
Sbjct: 482 GQLVKVKITEAKTWSLNGELV 502


>MIAB_STAS1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 513

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/423 (33%), Positives = 225/423 (53%), Gaps = 12/423 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E M       GY   +    ADV ++NTC++    + K    IG  +  
Sbjct: 73  TYGCQMNAHDTEVMAGILGALGYTPTEDINHADVILINTCAIRENAENKVFSEIGNLKHL 132

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ PE +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 133 KKEKPETVIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHRLPEILEEAYLSKAMVVE 192

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 193 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 249

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  +YG D+D     L DLLE+I KID I RVR  +  P  FT
Sbjct: 250 VRDLARQGYKEITLLGQNVNAYGKDIDGLAYGLGDLLEDISKID-IPRVRFTTSHPWDFT 308

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+VN ++  I +V++TTD
Sbjct: 309 DRMIEVIANGGNIVPHVHLPVQSGNNAVLKIMGRKYTRESYLDLVNRIKTHIPNVALTTD 368

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M + V  + K +R ++L
Sbjct: 369 IIVGYPNETDEQFEETLTLYDEVEFEHAYTYIYSQRDGTPAAKMNDNVPLDVKKDRLQQL 428

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +   ++Y G+ + VL E   +    V +GYT     VN KA  ++ GKI+NV
Sbjct: 429 NKKVACYSERAMQQYEGQTVQVLCEGVSKKDDTVLSGYTSKNKLVNFKAPKSMIGKIVNV 488

Query: 419 KIN 421
            I+
Sbjct: 489 YID 491


>MIAB_STAAT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  +
Sbjct: 490 RIDEAKQYSLNGSFI 504


>MIAB_STAAE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  +
Sbjct: 490 RIDEAKQYSLNGSFI 504


>MIAB_STAAC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  +
Sbjct: 490 RIDEAKQYSLNGSFI 504


>MIAB_STAA8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  +
Sbjct: 490 RIDEAKQYSLNGSFI 504


>MIAB_STAA3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  223 bits (568), Expect = 2e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  N K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLNVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  +
Sbjct: 490 RIDEAKQYSLNGSFI 504


>MIAB_SYMTH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 470

 Score =  222 bits (565), Expect = 5e-60
 Identities = 147/451 (32%), Positives = 233/451 (51%), Gaps = 20/451 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           +V   T GC++N ++SE M     + GY      + AD+ + NTC+V     + +   IG
Sbjct: 21  RVHIETFGCQMNEHDSEIMYGILAQMGYVKAQGPDDADLLLFNTCAVRESAVEHAFGRIG 80

Query: 62  RARR---QNPEAIIAVVGCYAQIAPTEVSGIEGV----DVVLGSRNKGEIVYYVNKARDE 114
           + +     NP+ II V GC  Q+   +V  I+ +    D++ G+ N   +   V +AR E
Sbjct: 81  QLKPLKYTNPDLIIGVCGCVPQVEG-QVERIKRMFPYLDLIFGTHNIHRLPELVERARSE 139

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
            +  V V   + +  F D+         +A++ I  GC++ C YC++P TRG   S+  +
Sbjct: 140 RETVVDVWESMGDD-FPDILPAAREGDLKAWVTIMYGCDKHCTYCIVPTTRGKERSRPYE 198

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGVDL-----DEKVTLVDLLEEIEKID-GIERVR 228
            +L E++ LA  GFKEI L G +  +YG DL     +      DL+E I++   GIER+R
Sbjct: 199 VILAEVQELARQGFKEITLLGQNVNAYGKDLYGRHGEGAFDFGDLIELIDRNSPGIERIR 258

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P  FT  +V +I   +K+C  FHL +QSG D+ L+RM R Y  K+Y  +V  +R+
Sbjct: 259 FTTNHPKDFTRKMVEQIARAEKVCEWFHLPVQSGSDSVLRRMKRSYNRKQYLRLVGWIRE 318

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
            I D  ITTD+IVGFPG            ++ +      +F YS R GT A  ME+++  
Sbjct: 319 LIPDAVITTDIIVGFPGETEEEFQETLSLVEEVQYDAAFMFMYSERAGTPAAQMEDRLSV 378

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
            +K ER ++L+E+     +A  E  +G+V D+L E   +    V  G+TR  I V    D
Sbjct: 379 PEKKERLQRLMEVQNRIARAKNEARVGKVYDILVEGLDKGKPDVVFGWTRGNILVTFPGD 438

Query: 409 CNVSGKILNVKIN-----SFEGEVAEGEIVL 434
            ++ G+I+ V+I      + EGE+ E  + L
Sbjct: 439 ESLRGRIVPVRITRAGTWTLEGELVESPVTL 469


>MIAB_STAAR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  221 bits (564), Expect = 7e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  + K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLDVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_STAAB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  221 bits (564), Expect = 7e-60
 Identities = 141/435 (32%), Positives = 226/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E +       GY+       ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            ++ P+ +I V GC +Q   +    +   + VD++ G+ N   +   + +A       V+
Sbjct: 134 KKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  V E+L K+ E N K  A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 194 VWSK-EGDVIENLPKVREGNIK--AWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG DL D +  L DLL+ I KI  I RVR  +  P  FT
Sbjct: 251 VRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKI-AIPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+V  ++D+I +V++TTD
Sbjct: 310 DHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDRIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  + K ER ++L
Sbjct: 370 IIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLDVKKERLQRL 429

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +      +    KY G+ + VL E   +    V  GYT     VN KA   + GK++ V
Sbjct: 430 NKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPKEMIGKLVEV 489

Query: 419 KINSFEGEVAEGEIV 433
           +I+  +     G  V
Sbjct: 490 RIDEAKQYSLNGSFV 504


>MIAB_BACCR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (564), Expect = 7e-60
 Identities = 141/441 (31%), Positives = 232/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDFLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I D  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTDMLKIMARKYSREHYLELVRKIKEAIPDAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N  A  +  +Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNTL--VNTLAIEKNSRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVASKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VKI   +     GE+V
Sbjct: 482 GQLVKVKITEAKTWSLNGELV 502


>MIAB_BACC2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (564), Expect = 7e-60
 Identities = 140/441 (31%), Positives = 232/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTTLGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDVEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I D  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTDMLKIMARKYSREHYLELVRKIKEAIPDAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N  A  +  +Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNTL--VNTLAIEKNSRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVASKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTEAKTWSLNGELV 502


>MIAB_CALS8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  221 bits (563), Expect = 9e-60
 Identities = 135/433 (31%), Positives = 217/433 (50%), Gaps = 9/433 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N ++SE +       GY      E AD+ + NTC+V    + +    IG  +R 
Sbjct: 42  TYGCQMNVHDSEKLAGMLNAMGYVETQNLEEADLIIFNTCAVREHAESRVYGNIGPLKRL 101

Query: 66  --QNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
             + PE II V GC  Q   +A         +D++ G+++  +    + KA    K    
Sbjct: 102 KDKKPELIIGVCGCMPQQLEVAQKLAKVFPFLDIIFGTKSLHKFPQLLYKAITTKKTXXX 161

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
                                  AF+ I  GCN FC+YC++PY RG   S+ P++++ EI
Sbjct: 162 XXXXXXXXXXGIPTARREG--VSAFVNIIYGCNNFCSYCIVPYVRGRERSRRPEEIIFEI 219

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + LA +G KE+ L G +  SYG DL + +    LLE++  I+GIER+R  +  P   +++
Sbjct: 220 QQLAANGVKEVTLLGQNVNSYGKDLPDGIPFYKLLEKVNAIEGIERIRFVTSHPKDLSDE 279

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++  +  L+K+C H HL +QSG    L++MNR YT ++Y  +V  L++ I D++ITTD+I
Sbjct: 280 LIFAMRDLEKVCEHIHLPVQSGSTRILRQMNRHYTKEDYLRLVEKLKENIPDIAITTDII 339

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++++     + F YS RKGT+A  M NQV    K ER ++L++
Sbjct: 340 VGFPGETEEDFEDTLDVVRKVEFDSAYTFIYSKRKGTKAAQMPNQVPDEVKHERFQRLVK 399

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           L         ++ +G+V ++L  +     + +  G TR    VN K       K +NVKI
Sbjct: 400 LVEEIALKKNQQMLGKVCEILI-DGYSKRNNLLEGRTRTNKVVNVKCSDEFMYKFVNVKI 458

Query: 421 NSFEGEVAEGEIV 433
                    GE++
Sbjct: 459 LEASRHWLYGEVI 471


>MIAB_MYCPE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 491

 Score =  221 bits (562), Expect = 1e-59
 Identities = 142/435 (32%), Positives = 222/435 (51%), Gaps = 12/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC+ N  ++E M       GYE  +    +D+ ++NTC+V    + K    IG   R 
Sbjct: 60  TFGCQSNLRDTEVMMGMLELIGYEYNEDVNTSDLVLLNTCAVREHAESKVFADIGILDRI 119

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           ++ NP  I  V GC AQ   +    +     VD + G+ N   I+  + +   E    V+
Sbjct: 120 KKSNPNFIFGVCGCMAQEEAVVNRILKSNFNVDFIFGTHNVHRILNLLEQVIFEKNLVVE 179

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V +   N V E+L  +  NN  + F+ +  GC++FC YC++P TRG + S+  + +LDE+
Sbjct: 180 VWSHEGN-VIENLPSKRTNN-LKGFVNVMYGCDKFCTYCIVPMTRGKIRSRRKEDILDEV 237

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
             +   G+KE+ L G +  SYG+D D  E     +LLE++ K  GIERVR  + +P  FT
Sbjct: 238 HQMISEGYKEVTLIGQNVNSYGIDFDNGENYLFNNLLEDVAKT-GIERVRFTTSNPWNFT 296

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
             +V  +     + PH HL +QSG +  LK+MNR     +Y D+V+ +R  I + SITTD
Sbjct: 297 RSIVDTMKKYPNIMPHIHLPIQSGDETILKKMNRPMKIGDYIDLVDYIRANIPNCSITTD 356

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVGFP              KRI       F YS R GT A  + +++  ++K ER ++L
Sbjct: 357 LIVGFPNETKEQFNKTLELYKRIEFDNAFTFIYSKRDGTVAAIIPDEIPLSEKKERLQEL 416

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            E+ +   K   EKY+ +V+DVL +   +    V +GY+  +  VN       SG+I+ V
Sbjct: 417 NEMVKTFSKKNNEKYVNKVLDVLVDGPSKKDKTVISGYSPQWKVVNFTGSAK-SGEIVKV 475

Query: 419 KINSFEGEVAEGEIV 433
            I S       G+++
Sbjct: 476 LITSASRFTLNGKMI 490


>MIAB_GEOKA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 531

 Score =  221 bits (562), Expect = 1e-59
 Identities = 137/439 (31%), Positives = 227/439 (51%), Gaps = 10/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  D  E A+V ++NTC++    + K    +G
Sbjct: 81  KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEEANVILLNTCAIRENAENKVFGELG 140

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +     NP+ ++ V GC +Q   +    +   + VD++ G+ N   + Y +++A    
Sbjct: 141 YLKPLKTTNPDLLLGVCGCMSQEESVVKKILKQYQYVDLIFGTHNIHRLPYILHEAYMSK 200

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +    K +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 201 EMVVEVWSK-EGDVVENLP-KVRKGKIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 258

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +YG D  D +  L DL++E+ KID I R+R  +  P
Sbjct: 259 IIQEVRQLAAQGYKEITLLGQNVNAYGKDFTDIQYGLGDLMDELRKID-IARIRFTTSHP 317

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+YT +EY ++V  ++  I DV+
Sbjct: 318 RDFDDRLIEVLAKRGNLVEHIHLPVQSGSTEILKMMGRKYTREEYLELVRKIKAAIPDVA 377

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +     + F YSPR+GT A NM++ V    K ER
Sbjct: 378 LTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAANMKDNVPMEVKKER 437

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            K+L +L +       ++Y             +    V  GYTR    V+     ++ G+
Sbjct: 438 LKRLNDLVQEIAAKKMKQYXXXXXXXXXXXXSKTNPDVLAGYTRKNKLVHFVGPKSLIGQ 497

Query: 415 ILNVKINSFEGEVAEGEIV 433
           ++NV+I   +     GE+V
Sbjct: 498 LVNVRITQAKTWTLTGELV 516


>MIAB_BACHK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKALKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A    ++Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNDRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_BACCZ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKALKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A    ++Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNDRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_BACC7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEEADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKALKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A  +  +Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNNRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_BACC1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEEADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKALKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A  +  +Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNNRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_BACC0 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A    ++Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNDRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_BACAH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  221 bits (562), Expect = 1e-59
 Identities = 139/441 (31%), Positives = 233/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+NP+ +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNPDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A    ++Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNDRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ VK+   +     GE+V
Sbjct: 482 GQLVKVKVTDAKTWSLNGELV 502


>MIAB_DESRM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  220 bits (561), Expect = 2e-59
 Identities = 126/433 (29%), Positives = 219/433 (50%), Gaps = 9/433 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           + GC++N  ++E++       GY      E AD+ ++NTC V    + K   ++GR R+ 
Sbjct: 23  SFGCQMNERDAESLAGMLEDLGYCPTSAQEEADIILLNTCCVRETAESKVFGLLGRLRKL 82

Query: 66  --QNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
               P+ I+ V GC +Q    A         VD++ G+ N  E+   +++ ++  +  ++
Sbjct: 83  KVAKPDLILGVCGCMSQQEDAAKRIRRSFPFVDLIFGTHNIHELPRMIHQVQENHEAVLE 142

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V A  K  + E + ++   +K +A++ I  GCN FC YC++PY RG   S+ P+ ++DEI
Sbjct: 143 VWATEKG-ITESIPVKR-KDKLKAWVTIMYGCNNFCTYCIVPYVRGRERSRQPEDIIDEI 200

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L + G+KE+ L G +  SYG D        DLL  I+ I G+ERVR  +  P  F + 
Sbjct: 201 KELVQEGYKEVTLLGQNVNSYGKDFKNNYRFADLLMAIDDITGLERVRFMTSHPRDFDQR 260

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++  + + KK+C H+HL  Q+G +  LK MNR YT + Y +++  +++++ + SIT D++
Sbjct: 261 LIEVVASAKKVCEHYHLPAQAGSNRVLKMMNRGYTREHYLELIRKIKERVPNASITADLM 320

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +K++       F Y+ R GT A  +E QV    K ER ++LIE
Sbjct: 321 VGFPGETEEDFQETLDLVKQVRYDSAFTFVYNIRSGTPAAKLE-QVSEEVKSERIQRLIE 379

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
           L  +      +               +    +  G TR    V  +   ++ G+++ ++I
Sbjct: 380 LQNLISLENNQXXXXXXXXXXXXXXTKTNPDLLAGRTRTNKLVVFQGSGHLPGQLVQIRI 439

Query: 421 NSFEGEVAEGEIV 433
                 + EGE+V
Sbjct: 440 TKGRPNLLEGEVV 452


>MIAB_METI4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  220 bits (560), Expect = 2e-59
 Identities = 127/438 (28%), Positives = 226/438 (51%), Gaps = 10/438 (2%)

Query: 3   VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           V   T GC++N  +SE + + F+  GY++    + AD+ ++NTCSV  M ++K+   +  
Sbjct: 4   VFIKTFGCQMNVRDSEQVLQDFIERGYQIASSEKWADIILINTCSVRAMAEEKAIDKLAS 63

Query: 63  ---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
              A+++NP  ++ ++GC AQ    E++     VD+VLG++   ++    +       + 
Sbjct: 64  LKTAKKKNPNLVLGIIGCMAQNRGREIAEKYRFVDLVLGTQKFHKVAEIADNLLKNPDRS 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTR--AFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
                + K +   +   +  + K +  A++ I  GC+  C++C++P TRG   S+   ++
Sbjct: 124 SSYVDLSKEEAAHNAINKHLSTKAQPIAYVSIMQGCSMHCSFCIVPTTRGEERSRPIDEI 183

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVD----LDEKVTLVDLLEEIEKIDGIERVRIGSI 232
            +E++ LAE   KEI+L G     YG      +  K   V LLE++  I+ I+R+R  S 
Sbjct: 184 FEEVKRLAETSVKEIVLLGQIVNRYGAKEFPWVKGKSPFVQLLEKLSTIEEIKRIRFTSP 243

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  F ED++  +  + +LC H HL +QSG D  LK M R Y+  ++  +V+ LR  I  
Sbjct: 244 HPLGFKEDLIAALRDIPQLCEHVHLPVQSGSDKILKAMRRGYSRSKFLSLVDKLRKAIPQ 303

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           ++++TD+IVG+PG            L  +      IF+YS R+GT A ++ +Q+    K 
Sbjct: 304 LALSTDIIVGYPGETEEDFQQTCSLLNEVRFDNAFIFRYSAREGTTAASLGDQLSEEVKF 363

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           ER+ +L+E+        A+K++G+V+++L E E +  +  + G TR    V    +    
Sbjct: 364 ERNYRLLEIQNKITMEKAQKWVGQVVEILVEGESKKNASKFQGRTRTNHLVIIPKNERWR 423

Query: 413 GKILNVKINSFEGEVAEG 430
           G+ L V+I    G    G
Sbjct: 424 GEFLPVRIVETTGHTFYG 441


>MIAB_OCEIH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 519

 Score =  219 bits (559), Expect = 3e-59
 Identities = 134/426 (31%), Positives = 219/426 (51%), Gaps = 10/426 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M       GYE     E AD+ ++NTC++    + K    IG
Sbjct: 77  KFLIRTYGCQMNEHDTEVMAGILSEMGYESTTVTEEADIILLNTCAIRENAENKVFGEIG 136

Query: 62  RARR---QNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +    +NP+ II V GC +Q   +    +   + +D++ G+ N   + + V +A   G
Sbjct: 137 HLKPLKLENPDLIIGVCGCMSQEESVVDRILQKHQHIDLIFGTHNIHRLPHLVKEALF-G 195

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K+ +      +  + E+L  +    K +A++ I  GC++FC YC++P TRG   S+ PK 
Sbjct: 196 KEMIVEVWSKEGDIIENLP-KARKGKIKAWVNIMYGCDKFCTYCIVPMTRGKERSRRPKD 254

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R L   G++E+ L G +  +YG D ++ +  L DL+ +I KID I RVR  +  P
Sbjct: 255 IIQEVRHLVAQGYQEVTLLGQNVNAYGKDFEDIEYGLGDLMNDIHKID-IPRVRFTTSHP 313

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK+MNR+YT +EY ++V  +R  + + +
Sbjct: 314 RDFDDRLIEVLAQGGNLLDHIHLPVQSGSSEILKKMNRKYTREEYLELVRKIRIAMPNAT 373

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP             ++ +     + F YSPR+GT A   ++ V    K +R
Sbjct: 374 LTTDIIVGFPNETEEQFEETMTLVEEVGFEAAYTFIYSPREGTPAARKKDDVPEEVKKQR 433

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L EL      A  + Y G+ + VL E E +    V  GYT     VN K   +  GK
Sbjct: 434 LYRLNELVNKQSAASMKDYAGKKVKVLVEGESKKDPEVLAGYTEKNKLVNFKGPKSSIGK 493

Query: 415 ILNVKI 420
           I+ V+I
Sbjct: 494 IVEVEI 499


>MIAB_BACA2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  219 bits (558), Expect = 4e-59
 Identities = 132/426 (30%), Positives = 224/426 (52%), Gaps = 10/426 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  +  + A+V ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFMALGYEATNSVDDANVILLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   + NP+ I+ V GC +Q   +    +     VD++ G+ N   +   +++A    
Sbjct: 127 HLKALKKNNPDLILGVCGCMSQEESVVNRILKKHPFVDMIFGTHNIHRLPELLSEAYLSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  ++V +  +  V E+L  +  N K + ++ I  GC++FC YC++PYTRG   S+ P++
Sbjct: 187 EMVIEVWSK-EGDVIENLP-KVRNGKIKGWVNIMYGCDKFCTYCIVPYTRGKERSRRPEE 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +YG D ++    L DL++E+ KID I R+R  +  P
Sbjct: 245 IIQEVRRLASEGYKEITLLGQNVNAYGKDFEDMTYGLGDLMDELRKID-IPRIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG  A LK M R+Y  + Y ++V  ++  + + S
Sbjct: 304 RDFDDHLIEVLAKGGNLLDHIHLPVQSGSSAMLKMMARKYDRERYLELVGKIKAAMPNAS 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +     + F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAAKMKDNVPMRVKKER 423

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            ++L +L +       ++Y G  ++VL E E +    +  GYT     VN K   +  GK
Sbjct: 424 LQRLNDLVKEISAKKMKEYEGRTVEVLVEGESKNNPDILAGYTEKSKLVNFKGPKDAIGK 483

Query: 415 ILNVKI 420
           I+ VKI
Sbjct: 484 IVRVKI 489


>MIAB_AQUAE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  219 bits (558), Expect = 4e-59
 Identities = 140/441 (31%), Positives = 225/441 (51%), Gaps = 20/441 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N  +SE +       GYE  D  E AD+ ++NTC++    D+K    +G
Sbjct: 4   KFFIKTFGCQMNFNDSERIRGLLKTIGYEQTDNWEEADLIILNTCTIREKPDQKVLSHLG 63

Query: 62  ---RARRQNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + + +NP+A+IAV GC AQ    E V     +D++  S N  ++   +N+A+     
Sbjct: 64  EYKKIKEKNPKALIAVAGCLAQRTGWELVKKAPVIDIMFSSFNMHQLPELINQAQ----A 119

Query: 118 QVKVGAVLKNKVFEDLKIEEY----NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
             K  A+L     ++ KI EY    +NK  A++ I  GC++ C YC++P TRG   S+  
Sbjct: 120 GYKAIAILDELPQDEDKIWEYPVERDNKYCAYVTIIKGCDKNCTYCVVPRTRGKERSRAL 179

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSID 233
             +LDE++ L + G +EI L G +  ++G D ++ +   +LL ++ KIDG+ER+R  +  
Sbjct: 180 HSILDEVKRLVDDGVREIHLLGQNVTAWGKDFEKPIPFSELLYQVSKIDGVERIRFTTGH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P   T+D++  +  + ++C   HL  Q+G +  L  M+R YT              ++D+
Sbjct: 240 PRDLTDDIIEAMADIPQVCNALHLPFQAGSNRILALMDRGYTXXXXXXXXXXXXXXVKDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           +++TDVIVGFP             LK++   +   FK+SPR GT A  ME Q+  + K E
Sbjct: 300 AMSTDVIVGFPTETEEDFEHTLDVLKKVRFEQVFSFKFSPRPGTPAAEMEGQIPDDVKTE 359

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R ++L+EL +      A+KY G V +VL EEE    +G   G T      + K D ++ G
Sbjct: 360 RMRRLLELQKSILSEIAKKYEGTVQEVLVEEE---KNGELIGRTTTNKWASFKGDPSLLG 416

Query: 414 KILNVKIN-----SFEGEVAE 429
                        S EGE+ E
Sbjct: 417 XXXXXXXXXSSPFSLEGELLE 437


>MIAB_BACP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 508

 Score =  219 bits (557), Expect = 5e-59
 Identities = 137/440 (31%), Positives = 229/440 (52%), Gaps = 12/440 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  +  E A+V ++NTC++    + K    +G
Sbjct: 66  KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTNSTEDANVILLNTCAIRENAENKVFGELG 125

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+ P+ I+ V GC +Q   +    +     VD++ G+ N   +   +++     
Sbjct: 126 HLKALKREKPDLILGVCGCMSQEESVVNRILKKHPFVDLIFGTHNIHRLPELLSECYLSK 185

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  ++V +  +  V E+L       K + ++ I  GC++FC YC++PYTRG   S+ P +
Sbjct: 186 EMVIEVWSK-EGDVIENLP-RARQGKIKGWVNIMYGCDKFCTYCIVPYTRGKERSRRPDE 243

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +YG D ++ +  L  L++E+ KID I R+R  +  P
Sbjct: 244 IIQEVRRLAAEGYKEITLLGQNVNAYGKDFEDMEYGLGHLMDELRKID-IPRIRFTTSHP 302

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG  + LK M R+Y  + Y D+V  +++ + + S
Sbjct: 303 RDFDDHLIEVLAKGGNLLDHIHLPVQSGSSSVLKLMARKYDRERYLDLVRKIKEAMPNAS 362

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +     + F YSPR+GT A  M++ V  + K ER
Sbjct: 363 LTTDIIVGFPNETDEQFEETLSLYREVEFDAAYTFIYSPREGTPAAKMQDNVPMHVKKER 422

Query: 355 SKKLIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
            ++L  L N I+ K   E Y G+ ++VL E E +    +  GYT     VN KA     G
Sbjct: 423 LQRLNALVNEISAKKMKE-YEGQTVEVLVEGESKNNPEILAGYTSKSKLVNFKAPKEAIG 481

Query: 414 KILNVKINSFEGEVAEGEIV 433
            I+ VKI   +    +GE+V
Sbjct: 482 NIVKVKITQAKTWSLDGEMV 501


>MIAB_FUSNN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 435

 Score =  218 bits (555), Expect = 8e-59
 Identities = 143/447 (31%), Positives = 227/447 (50%), Gaps = 29/447 (6%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K +  T GC++N  ES  + + F   GY+V +  + AD   +NTC+V    +  + QI  
Sbjct: 3   KASIITYGCQMNVNESAKIKKIFQNLGYDVTEEIDNADAVFLNTCTVR---EGAATQIFX 59

Query: 62  RARRQNPE-----AIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
                         II V GC+AQ    E V     +D+V+G++N G I   + K  +  
Sbjct: 60  XXXXXXXXXXXRGTIIGVTGCFAQEQGEELVKKFPIIDIVMGNQNIGRIPQAIEKIENNE 119

Query: 116 KQQVKVGAVLKNKVFEDLKIE-------EYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSV 168
                      ++V+ D + E       E+ +   A + I  GCN FC +C++PY RG  
Sbjct: 120 ST---------HEVYTDNEDELPPRLDAEFGSDQTASISITYGCNNFCTFCIVPYVRGRE 170

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVR 228
            S   ++++ ++    + G KEI+L G +  SYG D         LL+EI K++G   VR
Sbjct: 171 RSVPLEEIVKDVEQYVKKGAKEIVLLGQNVNSYGKDFKNGDNFAKLLDEICKVEGDYIVR 230

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             S  P  FT+DV+  I   KK+    HL LQSG    LK+M R YT ++Y  +V+ ++ 
Sbjct: 231 FVSPHPRDFTDDVIEVIAKNKKISKCLHLPLQSGSSQILKKMRRGYTKEKYLALVDKIKS 290

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
           KI  V++T D+IVGFPG            +++++   +++F YS RKGT+A  M+NQ++ 
Sbjct: 291 KIPGVALTADIIVGFPGETEEDFLDTIDVVQKVSFDNSYMFMYSIRKGTKAATMDNQIEE 350

Query: 349 NKKDERSKKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
           + K ER ++L+E+   N+ +F E  KY G ++ VL E   +    V +G T     V  +
Sbjct: 351 SVKKERLQRLMEVQ--NKCSFYESSKYKGRIVKVLVEGPSKKNKEVLSGRTSTNKIVLFR 408

Query: 407 ADCNVSGKILNVKINSFEGEVAEGEIV 433
            +  + G+ +NVKIN  +     GEIV
Sbjct: 409 GNLALKGQFINVKINECKTWTLYGEIV 435


>MIAB_CLOD6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 478

 Score =  217 bits (553), Expect = 1e-58
 Identities = 132/423 (31%), Positives = 227/423 (53%), Gaps = 13/423 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N ++SE +       GY++    E +D+ + NTC+V    + K    +G+ +  
Sbjct: 45  TFGCQMNEHDSEKLCSMLEEMGYQMSMMVEESDLIIYNTCAVRENAELKVYGNLGQLKHL 104

Query: 66  --QNPEAIIAVVGCYAQIAPTEVSGI----EGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             +NP+  IAV GC  Q  P  V  +    + VD++ G+ N  +    + ++ +  K  V
Sbjct: 105 KGKNPDMKIAVCGCMMQ-QPHVVEELRKKYKHVDLIFGTHNLYKFPQLLTESINSDKMLV 163

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
            V  V   +V E L+      + +AF+ I  GCN FC YC++PYTRG   S+ P+ +++E
Sbjct: 164 DVWDV-DGEVIEGLRSNR-KFELKAFVNIMYGCNNFCTYCIVPYTRGRERSRTPEDIINE 221

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           I+ L  +G KEI L G +  SYG  L+  V+  +LL ++  I+GIERVR  +  P   ++
Sbjct: 222 IKELVANGTKEITLLGQNVDSYGKTLENPVSFSELLRKVNDIEGIERVRFMTSHPKDISD 281

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           +V+  I    K+C   HL +Q G  + LK+MNR YT + Y +I+   + ++  ++ +TD+
Sbjct: 282 EVIYAIRDCDKVCEFLHLPIQCGSSSLLKKMNRHYTKEYYLEIIEKAKKEVPGIAFSTDL 341

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           ++GFPG            ++++       F YS R+GT A  MENQ+  + K +R  +++
Sbjct: 342 MIGFPGETEEDLLDTLDVVEKVRYDSAFTFIYSKRQGTPAAKMENQIPEDIKHDRFNRVL 401

Query: 360 E-LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK-ADCNVSGKILN 417
           E +NRI+ +   + Y   +++VL E   +     + G TR    VN +  + ++ GK++ 
Sbjct: 402 EAVNRISAE-INDGYKDRIVEVLVEGRSKNNENKFAGRTRQNKLVNFEGGNDDLIGKLVM 460

Query: 418 VKI 420
           VKI
Sbjct: 461 VKI 463


>MIAB_BACAN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  217 bits (553), Expect = 1e-58
 Identities = 137/441 (31%), Positives = 232/441 (52%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F   GYE     E ADV ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFTALGYEPTFSTEDADVVLLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   R+N + +I V GC +Q   +    +   + VD+V G+ N   + Y +  A    
Sbjct: 127 HLKSLKRRNSDLLIGVCGCMSQEESVVNKIMQKNQHVDMVFGTHNIHRLPYILKDAMFSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +      +A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 ETVVEVWSK-EGDVIENLP-KVRRGDIKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ EIR LA +G+KEI L G +  +YG D ++ +  L DL++E+ K+D I R+R  +  P
Sbjct: 245 IIQEIRHLAANGYKEITLLGQNVNAYGKDFEDIEYGLGDLMDELRKVD-IARIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y+ + Y ++V  +++ I +  
Sbjct: 304 RDFDDHLIEVLGKGGNLVEHIHLPVQSGSTEMLKIMARKYSREHYLELVRKIKEAIPNAV 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +       F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETMSLYREVGFDTAFTFIYSPREGTPAAKMKDNVPMEVKKER 423

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            ++L  L  +N+ A    ++Y G++++VL + E +    V  GYTR    VN  A  ++ 
Sbjct: 424 LQRLNAL--VNKLAIEKNDRYKGQIVEVLVDGESKNNPEVLAGYTRTNKLVNFVAPKSLI 481

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++ +K+   +     GE+V
Sbjct: 482 GQLVKIKVTDAKTWSLNGELV 502


>MIAB_SYNWW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  216 bits (549), Expect = 4e-58
 Identities = 136/436 (31%), Positives = 215/436 (49%), Gaps = 6/436 (1%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           +K    T GC++N  +SE +       G+   +    AD+ V NTCSV +  + K    +
Sbjct: 9   LKYRILTYGCQMNVRDSETIAGLLEGSGFNQAEDLSEADLIVFNTCSVRHSAENKVYGKL 68

Query: 61  GRA---RRQNPEAIIAVVGCYAQIAPTEVS-GIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G     +++ PE +IA  GC AQ+          GVDVV G+ N  E+ Y + +A+++  
Sbjct: 69  GEIASLKKKRPELLIAFGGCMAQLPEVRQKLKKRGVDVVFGTHNIHELPYLIARAKEKRS 128

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
              +V    +  + E L        + AF+ I  GCN FC+YC++PYTRG   S+    +
Sbjct: 129 PVFEVWEK-EGSIVEPLPSCRKPGLS-AFVNIMFGCNNFCSYCIVPYTRGRERSRKADDI 186

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           + E+  LA  G+KE+ L G +  SYG  L EK+   DLL     + GIER+R  +  P  
Sbjct: 187 IRELEELAAAGYKEVTLLGQNVNSYGRGLGEKIEFADLLYRANSVAGIERIRFTTSHPKD 246

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
            ++ +++ I   +KLC H H  LQ+G +  L+RMNR Y+ + Y  +V  +R  +  VSIT
Sbjct: 247 VSDRLLQAIAECEKLCEHIHAPLQAGSNRILQRMNRNYSREHYLKLVERMRHYVPGVSIT 306

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           +D+IVGFPG            ++R+       F YS R GTRA  +  Q+   +K +R +
Sbjct: 307 SDLIVGFPGETEEDFLETLDMVERVRFDAAFTFLYSQRSGTRAAELAEQIPLEEKKQRLE 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           +L            ++  G + +VL E   +      T  TR+   V      ++ G+++
Sbjct: 367 RLNRRQYQIATEINQELQGSIQEVLVEGPSKTNPQKLTSRTRSNRIVIFSGGKDLIGRLI 426

Query: 417 NVKINSFEGEVAEGEI 432
           NVKI   +     GEI
Sbjct: 427 NVKITEAKTFSLFGEI 442


>MIAB_RICBR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  216 bits (549), Expect = 4e-58
 Identities = 142/444 (31%), Positives = 227/444 (51%), Gaps = 21/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKMQDLLYPYGYEPTENIEEADVIILNTCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDARKKQGLNSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGASSFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G   D+KV TL DL+  + KI  +ER+R  
Sbjct: 183 VEQVYREALKIVSSGAKEIMLLGQNVNAYHGKTSDDKVFTLADLIRHLVKIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+D++       KL P  HL +QSG + TLK MNR++    Y DI++ LR   
Sbjct: 243 TSHPIDMTDDLISLHGLEPKLMPFLHLPVQSGSNKTLKAMNRKHDRDYYFDIIDRLRKAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++++   + + FKYSPR GT      +QV  + 
Sbjct: 303 ADIVLSSDFIVGFPGETDEDFADTLDLVRKVKYGQCYSFKYSPRPGTPGATRTDQVPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K ER   L +     + AF E  IG  + VLF+ + +    +   T Y ++    N   D
Sbjct: 363 KSERLTILQKELAAQQLAFNESCIGSTMKVLFDRDGKFDDQIIGKTPYMQSVYIKNPNKD 422

Query: 409 CNVSGKILNVKI-----NSFEGEV 427
             + GKI+ VKI     NS  GE+
Sbjct: 423 --LLGKIIEVKITKAALNSLSGEI 444


>MIAB_RICB8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  215 bits (548), Expect = 5e-58
 Identities = 142/444 (31%), Positives = 227/444 (51%), Gaps = 21/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKMQDLLYPYGYEPTENIEEADVIILNTCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDARKKQGLNSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGASSFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G   D+KV TL DL+  + KI  +ER+R  
Sbjct: 183 VEQVYREALKVVSSGAKEIMLLGQNVNAYHGKTSDDKVFTLADLIRHLVKIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+D++       KL P  HL +QSG + TLK MNR++    Y DI++ LR   
Sbjct: 243 TSHPIDMTDDLISLHGLEPKLMPFLHLPVQSGSNKTLKAMNRKHDRDYYFDIIDRLRKAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++++   + + FKYSPR GT      +QV  + 
Sbjct: 303 ADIVLSSDFIVGFPGETDEDFADTLDLVRKVKYGQCYSFKYSPRPGTPGATRTDQVPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K ER   L +     + AF E  IG  + VLF+ + +    +   T Y ++    N   D
Sbjct: 363 KSERLTILQKELAAQQLAFNESCIGSTMKVLFDRDGKFDDQIIGKTPYMQSVYIKNPNKD 422

Query: 409 CNVSGKILNVKI-----NSFEGEV 427
             + GKI+ VKI     NS  GE+
Sbjct: 423 --LLGKIIEVKITKAALNSLSGEI 444


>MIAB_GEOUR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  215 bits (548), Expect = 5e-58
 Identities = 132/430 (30%), Positives = 217/430 (50%), Gaps = 11/430 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N  +SE +       GY     +  AD+ ++NTCSV    ++K    + +    
Sbjct: 11  TFGCQMNVSDSEKIAALLKGIGYFPTQDSSQADLVILNTCSVRAKAEEKVYNHLVQYKGL 70

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R+ P  I+ V GC AQ     + + +  +D+V G+ N   +   V +A ++G++  +VG
Sbjct: 71  KRKKPGIILGVGGCVAQQEGERLLANVPHLDIVFGTHNLHLLPELV-RAAEKGERLAEVG 129

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +      +   ++E  +    F+ +  GC  FC+YC++PY RG   S+    +L E+R 
Sbjct: 130 FIDNETRLDLFPVDERTDGVSRFVTVMQGCENFCSYCIVPYVRGREISRRSADILGEVRG 189

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           +A +G KE+ L G +  SYG+    +++ + LL E+  I GIER+R  +  P  F++ ++
Sbjct: 190 MAGNGVKEVTLLGQNVNSYGLKSSGEMSFIALLREVSLIPGIERIRFTTSHPKDFSQPLI 249

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                + KLC H HL  QSG +A L  MNR YT +EY   +  L+     + IT D+IVG
Sbjct: 250 DCFAEIPKLCRHIHLPAQSGSNAVLAAMNRGYTREEYLGSIARLKAACPSIQITGDIIVG 309

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++ +  +    F YS R  T+A    ++V  ++K  R  +L++L 
Sbjct: 310 FPGETEEDFQATLSLMEEVRYTDVFSFIYSKRPETKAAGYADEVGQDEKQGRLSRLLDLQ 369

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI-- 420
           R       + ++G V  VL E E   G G + G T     VN  AD ++ G I+NV I  
Sbjct: 370 RRITLETNKSFVGTVQQVLIEGESRRG-GQFYGRTSGNRVVNLAADVSLVGSIVNVMITR 428

Query: 421 ---NSFEGEV 427
              NS +GE+
Sbjct: 429 GDQNSLQGEL 438


>MIAB_THEYD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 431

 Score =  215 bits (547), Expect = 7e-58
 Identities = 139/441 (31%), Positives = 227/441 (51%), Gaps = 27/441 (6%)

Query: 3   VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           V   T GC++N ++SE M      +G+  VD  + AD+ + NTC++ +  ++K    +GR
Sbjct: 6   VYIKTFGCQMNEHDSERMLGILGTKGFIEVDEPKKADIVIFNTCAIRHKAEQKFFSSLGR 65

Query: 63  AR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKA------R 112
            +   ++NP+  I V GC AQ+   ++ + +  +D ++G  N   I   +          
Sbjct: 66  VKHLKKKNPQLKIIVAGCSAQLQGEKLLNKLPYIDYIIGPDNLHVIENIIENQVSHRIFT 125

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
           DE  +   +   +K K           +  +A++ I  GCN +C YC++PYTRG   S+ 
Sbjct: 126 DENPEVANINLPVKRK-----------DCVKAWVNIIYGCNNYCTYCVVPYTRGKERSRP 174

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
              ++ EI  LAE G+KE+ L G +  SY    D       LLE++EKI+GI+R+R  + 
Sbjct: 175 VDDIIKEISLLAEQGYKEVTLLGQNVNSYK---DGNTNFPLLLEKVEKIEGIKRIRFITS 231

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P   ++++V  +   KK+C H HL LQ+G +  LK MNR+YT +EY + +  LR+ I D
Sbjct: 232 HPKDLSKELVDVMKDYKKICEHIHLPLQAGSNKILKLMNRKYTYEEYFEKICWLREAIPD 291

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           ++IT+D+IVGFP             LK I       FK+SPR GT A  ++  +    K 
Sbjct: 292 IAITSDIIVGFPQEQHEDFEKTINALKEIRFDGIFAFKFSPRLGTAAAKLDGHISEEVKA 351

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            R  ++++L     +   ++  G++ +VL E + E   G  TG TR    V   +D   +
Sbjct: 352 ARLIEVLKLQDEITERKNKRLEGKIQEVLVEGKDE--EGFTTGKTRTNKVVKIYSDIK-A 408

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+I+NVKI        EG+I+
Sbjct: 409 GEIVNVKIAKTHRHSLEGDII 429


>MIAB_THEAB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 429

 Score =  215 bits (547), Expect = 7e-58
 Identities = 134/398 (33%), Positives = 217/398 (54%), Gaps = 13/398 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MK    T GC++N  +SE       +EGYE  +    AD+ ++NTC V    + K    I
Sbjct: 1   MKFFIKTYGCQMNENDSEVARYYLEQEGYESAENENEADIVILNTCVVRKKAEDKFLSTI 60

Query: 61  GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           G  R++N +  I V+GC A+    ++    GV+ V+G+R    I   V     E   + K
Sbjct: 61  GELRKKNKK--IGVMGCGAEKLKEDLFK-RGVNFVIGTRAISRIPEAV-----ELSIKGK 112

Query: 121 VGAVLKNKVFE-DLK-IEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
             A+  +K+ E D + I + N+K  A++ I  GCNRFC YC++PYTRG   S+    +L 
Sbjct: 113 KAAIFDDKLDEIDYRNILKRNSKHHAWITIIYGCNRFCTYCIVPYTRGREKSRKMDDILR 172

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           E+++L+ +G +EI   G +  +YG DL++  +L  LL E +KI+ IER+   +  PT F+
Sbjct: 173 EVKNLSLNGVREITYLGQNVDAYGKDLNDGTSLAKLLNETKKIENIERIWFLTSYPTDFS 232

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
            D+ R I + +K+    HL +Q G +  LK+MNRRYT +EY +++  +R+ + D SI++D
Sbjct: 233 LDIAREIASSEKIAKSIHLPVQHGSNKILKKMNRRYTIEEYYELIKSIREIVPDASISSD 292

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGNKKDERSKK 357
           +IVGFP             ++ I   + ++  YSPR+GT A +  E+ V    K  R   
Sbjct: 293 IIVGFPDETEDDFQQTVKLVEEIKFERLNLAIYSPREGTIAWKYFEDNVPRAIKTRRMAY 352

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTG 395
           L+ L +   K   E Y+ + ++V+ EE  +  SG++ G
Sbjct: 353 LLNLQKEINKMLNESYLDKTVEVIVEERAK--SGLFYG 388


>MIAB_CAUSK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  215 bits (547), Expect = 7e-58
 Identities = 134/424 (31%), Positives = 219/424 (51%), Gaps = 13/424 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKS-------RQI 59
           T GC++N Y+SE M +     GY +VD  E AD+ V+NTC +     +K        +Q+
Sbjct: 13  TYGCQMNVYDSERMADVLRPLGYGIVDEPEGADLVVLNTCHIREKATEKVYSELGYIKQM 72

Query: 60  IGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
            GR      +  +AV GC AQ    E+   +  VD+V+G +   ++   + +A     ++
Sbjct: 73  KGRKAEAGGQMTVAVAGCVAQAEGQEIMRRQPAVDLVVGPQAYHQLPELIARAHRATGER 132

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           +        K F+ L  E   +   AFL +Q+GC++FC +C++PYTRG   S+ P+++ D
Sbjct: 133 LSADFAADEK-FDALPAERQVSGVSAFLTVQEGCDKFCTFCVVPYTRGGEWSRPPEQIED 191

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           E R LA+ G +E+ L G +  +Y        TL  L+  + KI G++R+R  +  P    
Sbjct: 192 EARRLADQGVREVTLLGQNVNAYD---GGGYTLARLVRRLAKIPGLDRIRYTTSHPRDMG 248

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           +D++     L +L P+ HL +Q+G D  LK MNR +TA+ Y  ++  +R    D++++ D
Sbjct: 249 DDLIEAHGELPELMPYLHLPVQAGSDKILKAMNRDHTAESYIRLIEKIRQARPDIAMSGD 308

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
            IVGFPG            ++ +  +    FKYS R GT A  M  QVD   K ER ++L
Sbjct: 309 FIVGFPGERDGDFEKTLDLVREVGFASAFSFKYSRRPGTPASAMPGQVDEAVKAERLERL 368

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV 418
            +L    +KAF    +G+ + VLFE++     G   G +     V+A    ++ G+I+ V
Sbjct: 369 NQLLDEQQKAFNILQVGKTMPVLFEKKGR-NPGQIVGRSPYLQAVHAVGSEDLLGQIVPV 427

Query: 419 KINS 422
           +I S
Sbjct: 428 RIES 431


>MIAB_ALKMQ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 476

 Score =  215 bits (547), Expect = 7e-58
 Identities = 141/437 (32%), Positives = 231/437 (52%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY-EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---R 62
           T GC++N ++SE +       GY E  D NE A++ + NTC V    + K    IG    
Sbjct: 45  TYGCQMNEHDSEKLAGILQNIGYIETNDKNE-ANLIIYNTCCVRENAELKVYGNIGSLKN 103

Query: 63  ARRQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARDEGKQQ 118
            +++  +  IAV GC  Q  P  V  I+     VD+V G+ N  +    ++ + +     
Sbjct: 104 LKKEKHDLTIAVCGCMMQ-QPHVVKEIKSKYRHVDLVFGTHNLHKFPELLSTSMESDNMI 162

Query: 119 VKVGAVLKNKVFEDLKI-EEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           + V    +  + E L +  +Y  K  AF+ I  GCN FC YC++P+TRG   S++ ++++
Sbjct: 163 IDVWDK-EGDIVEGLPVTRKYGLK--AFINIMFGCNNFCTYCIVPHTRGRERSREVQEII 219

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
           DE+  LA++G KEI L G +  SYG  L+E+    +LL+ + KI+GIER+R  +  P   
Sbjct: 220 DEVEELAKNGTKEITLLGQNVNSYGKTLEEETDFGNLLKVLNKIEGIERIRFMTSHPKDL 279

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           ++ ++  +    K+C H HL  Q+G +  LK MNR+YT + Y ++V  +R K+ +V++TT
Sbjct: 280 SDSLISAMTVCTKVCAHLHLPFQAGSNDILKAMNRKYTKEAYLELVEKVRSKVPNVALTT 339

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            +++   +  + + YS R+ T A  MEN V  + K ER  +
Sbjct: 340 DIIVGFPGETEDDFKETLNVVEKARFNSAYTYLYSLRQETPAAKMENHVPDDVKHERFNR 399

Query: 358 LIE-LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           LIE +NRI+ +   + Y+ +V++VL E   +       G T     VN   +    G+I+
Sbjct: 400 LIEAVNRISGE-INKAYLNKVVEVLVEGTSKTDDAKLMGRTPQSKLVNFAGNKEDIGQIV 458

Query: 417 NVKINSFEGEVAEGEIV 433
            VKI   +     GE++
Sbjct: 459 RVKITEPKTFSLNGELL 475


>MIAB_MOOTA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  214 bits (546), Expect = 9e-58
 Identities = 124/361 (34%), Positives = 191/361 (52%), Gaps = 8/361 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N  +SE M +     GYE V   E A V +++TC V    + K    +G+  + 
Sbjct: 12  TYGCQMNQRDSEMMADLLQDAGYEPVAREEEAGVIILDTCCVREKAENKVYGKLGQIEKL 71

Query: 66  --QNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
              NP+ +IAV GC  Q   +A         VD++LG+ N  E+   + + +   + ++ 
Sbjct: 72  KSANPDLVIAVAGCMVQQPGVAEKIRQQAPYVDLLLGTGNLQELPQLIEEIKAMHRPRIV 131

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           VG   +  V EDL         +AF+ I  GCN FC YC++PY RG   S+ P+ ++ E+
Sbjct: 132 VGEQ-EGPVVEDLPRRRARG-AQAFVTITYGCNNFCTYCIVPYVRGRERSRRPENIIKEV 189

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           + L + G  E+ L G +  SYG DL + +    LLE +  ++G++R+R  +  P  FT +
Sbjct: 190 KELVDQGVIEVTLLGQNVNSYGRDLRDGINFAGLLERVNAVEGLKRIRYVTSHPRDFTPE 249

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +V  I  L K+C H HL +Q+G +  L+ M+R YT + Y ++V  LR  I  +S+TTD+I
Sbjct: 250 LVTTISRLDKVCEHVHLPVQAGSNRILELMHRGYTREHYLELVADLRRHIPGISLTTDLI 309

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            + R+       F YSPR+GT A  M  Q+    K ER K+L+E
Sbjct: 310 VGFPGETEADFEDTLDLVARVQFDNAFTFMYSPRRGTEAATMPGQLPTAIKKERLKRLME 369

Query: 361 L 361
           L
Sbjct: 370 L 370


>MIAB_CYAP8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  214 bits (546), Expect = 9e-58
 Identities = 133/439 (30%), Positives = 220/439 (50%), Gaps = 16/439 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       G+   +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 17  TFGCQMNKADSERMAGILENMGFIWSEDPNQADLILYNTCTIRDNAEQKVYSYLGRQAKR 76

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + +NP+  + V GC AQ    ++   +  +D+V+G ++   +   + +  D G Q V   
Sbjct: 77  KHENPDLTLIVAGCVAQQEGEQILRRVPELDLVMGPQHANRLEDLLQQVFD-GNQVVATE 135

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +    + ED+     ++   A++ +  GCN  C+YC++P  RG   S+ P+ +L E+  
Sbjct: 136 PI---HIIEDITKPRRDSTITAWVNVIYGCNERCSYCVVPNVRGVEQSRTPEAILAEMEL 192

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L + G+KE+ L G +  +YG DL         + TL DLL  +  + GIER+R  +  P 
Sbjct: 193 LGKQGYKEVTLLGQNIDAYGRDLPGVTESGRHQHTLTDLLYTVHDVVGIERIRFATSHPR 252

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG +  LK M R YT ++Y  I++ +RD + D SI
Sbjct: 253 YFTERLIAACQELSKVCEHFHIPFQSGDNDILKAMKRGYTHEKYRQIIDKIRDYMPDASI 312

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            ++ I   + +   YSPR GT A   +NQ+    K +R 
Sbjct: 313 SADAIVGFPGETEEQFENTLKLVEDIGFDQLNTAAYSPRPGTPAALWDNQLSEEVKSDRL 372

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L        +++Y+G + +VL E++    S    G TR       K D N + G+
Sbjct: 373 QRLNHLVAQKAAERSQRYLGRIEEVLVEDQNPKDSTQVMGRTRGNRLTFFKGDINQLKGR 432

Query: 415 ILNVKINSFEGEVAEGEIV 433
           ++ VKI         GEIV
Sbjct: 433 LIKVKITEVRAFSLTGEIV 451


>MIAB_SULSY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  214 bits (545), Expect = 1e-57
 Identities = 138/441 (31%), Positives = 217/441 (49%), Gaps = 15/441 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MK    T GC++N  +SE M       GY   +  E ADV +VNTCSV    D+K    +
Sbjct: 1   MKFYIKTFGCQMNVNDSEKMAGILQTLGYTPTENWEEADVILVNTCSVREKPDQKVLSAL 60

Query: 61  G---RARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G   + ++ NP A+I V GC AQ A  E+      +D+V G+ N    ++++    +E K
Sbjct: 61  GEFKKVKKHNPNAVIGVCGCLAQRAGYEIYQKAPFIDIVFGTTN----IHHLPNLLEEAK 116

Query: 117 QQVKVGAVLKNKVFEDLKIEEY----NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K                ++     NK  AF+ +  GC++ C YC++P TRG   S+ 
Sbjct: 117 SGNKAXXXXXXXXXXXXXXXQFPTVRENKYTAFVTVIRGCDKKCTYCIVPTTRGRERSRR 176

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
              +L E++ L E G KEI L G +  +YG D  + V   +LL+ + ++DG+ER+R  + 
Sbjct: 177 IGDILREVQYLVEDGVKEIHLIGQNVTAYGKDFGD-VKFWELLKAVAEVDGVERIRFTTG 235

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P    ED ++ +  L ++C   HL +Q+G D  L+ M+R YT KEY   + LL+  I +
Sbjct: 236 HPRDLDEDTIKVMADLPQICEALHLPIQAGSDRILQAMDRGYTQKEYLQKIELLKKYIPN 295

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           ++++TD+IVGFPG            +K +   +   FKYSPR GT A ++       +  
Sbjct: 296 IALSTDIIVGFPGETYEDYLETVKVIKEVEYDQVFAFKYSPRPGTPAADLPMTESPEELS 355

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           +R   LI L +        +Y  +++++L EE  +       G TR    V A+      
Sbjct: 356 KRLNDLINLQKDITFKKNLEYQDKIVEILVEEINQ--ENKLVGRTRTNKLVYAEGSPEYL 413

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           GK++NVKI        EG I+
Sbjct: 414 GKLVNVKIEKVNRFSLEGSII 434


>MIAB_THESQ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 443

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/444 (30%), Positives = 237/444 (53%), Gaps = 25/444 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+    T GC++N  +SE M    ++EG+      E ADV ++NTC+V    ++K+   +
Sbjct: 1   MRFYIKTFGCQMNENDSETMAGLLMKEGFTPASAPEEADVVIINTCAVRRKSEEKAYSEL 60

Query: 61  GRARR--QNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+  +  +  + ++ V GC A+    ++    G D VLG+R     V  V +A     Q 
Sbjct: 61  GQMLKIKRKRKLVVGVAGCVAEKEREKLLE-RGADFVLGTR----AVLKVTEAVKRALQG 115

Query: 119 VKVGAVLKNKVFEDLKIEEY--------NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCS 170
            KV       +FED  ++EY        ++K  A++ I  GC+RFC YC++PYTRG   S
Sbjct: 116 EKVA------LFED-HLDEYTHELPRIRSSKHHAWVTIIFGCDRFCTYCIVPYTRGREKS 168

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIG 230
           +  + +L+E+R LA+ G++E+   G +  +YG DL +  +L  LLEE  KI+GIER+   
Sbjct: 169 RPMEDILEEVRELAKQGYREVTFLGQNVDAYGKDLKDGSSLAKLLEEASKIEGIERIWFL 228

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  PT F+++++  I    K+    HL +QSG +  LK MNR YT +EY  ++  +R K+
Sbjct: 229 TSYPTDFSDELIEVIARNPKVAKSVHLPVQSGSNRILKLMNRSYTKEEYLALLERIRSKV 288

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGN 349
            DV+I++D+IVGFP             +++    + ++  YSPRKGT A ++ +++V   
Sbjct: 289 PDVAISSDIIVGFPTETEEDFMETIDLVEKAQFERLNLAIYSPRKGTVAWKHYKDEVPYE 348

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
           +K  R + L+ L +   +   E+Y G+ + V+ E + +  +G++ G       +  + + 
Sbjct: 349 EKVRRMQFLMNLQKRINRKLNERYKGKTVRVIVEAQAK--NGLFYGRDIRNKIIAFEGEE 406

Query: 410 NVSGKILNVKINSFEGEVAEGEIV 433
            + G+  +VKI         G++V
Sbjct: 407 WMIGRFADVKIEKITAGPLYGKVV 430


>MIAB_THEP1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 443

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/444 (30%), Positives = 237/444 (53%), Gaps = 25/444 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+    T GC++N  +SE M    ++EG+      E ADV ++NTC+V    ++K+   +
Sbjct: 1   MRFYIKTFGCQMNENDSETMAGLLMKEGFTPASAPEEADVVIINTCAVRRKSEEKAYSEL 60

Query: 61  GRARR--QNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+  +  +  + ++ V GC A+    ++    G D VLG+R     V  V +A     Q 
Sbjct: 61  GQMLKIKRKRKLVVGVAGCVAEKEREKLLE-RGADFVLGTR----AVLKVTEAVKRALQG 115

Query: 119 VKVGAVLKNKVFEDLKIEEY--------NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCS 170
            KV       +FED  ++EY        ++K  A++ I  GC+RFC YC++PYTRG   S
Sbjct: 116 EKVA------LFED-HLDEYTHELPRIRSSKHHAWVTIIFGCDRFCTYCIVPYTRGREKS 168

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIG 230
           +  + +L+E+R LA+ G++E+   G +  +YG DL +  +L  LLEE  KI+GIER+   
Sbjct: 169 RPMEDILEEVRELAKQGYREVTFLGQNVDAYGKDLKDGSSLAKLLEEASKIEGIERIWFL 228

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  PT F+++++  I    K+    HL +QSG +  LK MNR YT +EY  ++  +R K+
Sbjct: 229 TSYPTDFSDELIEVIARNPKVAKSVHLPVQSGSNRILKLMNRSYTKEEYLALLERIRSKV 288

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGN 349
            DV+I++D+IVGFP             +++    + ++  YSPRKGT A ++ +++V   
Sbjct: 289 PDVAISSDIIVGFPTETEEDFMETIDLVEKAQFERLNLAIYSPRKGTVAWKHYKDEVPYE 348

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
           +K  R + L+ L +   +   E+Y G+ + V+ E + +  +G++ G       +  + + 
Sbjct: 349 EKVRRMQFLMNLQKRINRKLNERYKGKTVRVIVEAQAK--NGLFYGRDIRNKIIAFEGEE 406

Query: 410 NVSGKILNVKINSFEGEVAEGEIV 433
            + G+  +VKI         G++V
Sbjct: 407 WMIGRFADVKIEKITAGPLYGKVV 430


>MIAB_PARUW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  214 bits (544), Expect = 1e-57
 Identities = 138/429 (32%), Positives = 227/429 (52%), Gaps = 5/429 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR-ARR 65
           T GC++N  +SE M  +    G         AD+ + NTCS+ ++ ++K    +G+    
Sbjct: 23  TYGCQMNELDSEIMIGQLENRGLTRSHDENDADLLIFNTCSIRDLAERKVMGKLGKLGLT 82

Query: 66  QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAV 124
           +  +AII V GC A      +   +  +D VLG+ N  ++ + +++    GKQ ++    
Sbjct: 83  KQSQAIIGVTGCMANAKKDSLFQKLPHIDFVLGTNNIHDLNHVLDEVLASGKQSIRTDDH 142

Query: 125 LKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLA 184
            + ++  D    +  ++ +A++ I  GC++FC YC++PYTRGS  S+ P+ +L+E R L 
Sbjct: 143 FEFEL--DYLNAKREDQIKAYVSIIRGCDKFCTYCVVPYTRGSEVSRAPENILEECRHLV 200

Query: 185 EHGFKEIILSGIHTASYGVD-LDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVR 243
             G+KEI L G +  SYG D L+ K    DLL +++KI G+ERVR  +  P   +++++ 
Sbjct: 201 NQGYKEITLLGQNVNSYGKDKLEWKCLFHDLLYQLDKIPGLERVRFMTSHPVDISKELME 260

Query: 244 RILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVGF 303
            I  LK LC   H  LQ+G +  LK+M+R YT ++Y + V +L++ + +V++ TD+IVGF
Sbjct: 261 AIRDLKTLCEFVHFPLQAGSNRVLKKMHRIYTVEQYLEKVQMLKEIVPNVALGTDIIVGF 320

Query: 304 PGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELNR 363
           P             LK I  S   +F YSPRKGT A    + V    K            
Sbjct: 321 PXXXXXXXXXXYRLLKEIEYSVAFLFSYSPRKGTPAMRWRDDVPEEVKXXXXXXXXXXXX 380

Query: 364 INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKINSF 423
                  + ++G+ ++VL E        +  G TR +  V       + G +  VKI+ +
Sbjct: 381 TIYMKHRQAFLGQTVEVLVERRNFKDDRLVKGRTRCWKNVLFTGGDELVGTMQQVKIHGY 440

Query: 424 EGEVAEGEI 432
             +   G++
Sbjct: 441 SHQTLLGDL 449


>MIAB_HYDS0 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 435

 Score =  213 bits (543), Expect = 2e-57
 Identities = 129/428 (30%), Positives = 221/428 (51%), Gaps = 17/428 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MK    T GC++N  +SE +      +GYE     E AD+ ++NTC++    D+K    +
Sbjct: 1   MKYFIKTYGCQMNINDSEKIKGILQTQGYEPATREEDADLVILNTCTIREKPDQKVWSHL 60

Query: 61  GRARRQ---NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G  ++    NP   I V GC AQ A  E+ S +  +D+V G++N    ++++ K  ++ K
Sbjct: 61  GEIKKLKSINPNIKIGVCGCMAQRAGYEIASKMPFIDLVFGTKN----IHHMPKLLEDVK 116

Query: 117 QQVKVGAVLKNKVFEDLKIEEY----NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              +   +L+ +   +  ++ Y    +N   A++ I  GC++ C YC++P+TRG   S++
Sbjct: 117 VGNRAIEILEEEDPSENILDSYPTVRDNSYCAYVTIMRGCDKECTYCVVPFTRGKERSRN 176

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           P+ +LDE++SL + G  EI L G +  +YG D+D       LLE I KI+G++R+R  + 
Sbjct: 177 PQSILDEVKSLVDSGVMEIHLIGQNVTAYGKDID--YPFYKLLENISKIEGVKRIRFTTG 234

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P   T+D++  +  L  +  H HL  Q+G D  L+ M R YT   Y + +  L+ KI+D
Sbjct: 235 HPIDMTDDIIETMANLPNMVNHLHLPFQAGSDRILELMKRNYTKAYYLNRIEKLKAKIKD 294

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           ++ +TD+I+GFP             ++ +   +   FKYS R  T A  ME+ +    K 
Sbjct: 295 ITFSTDIIIGFPTETEEDFQHTLDVVQTVEFEQVFSFKYSKRPNTPAYYMEDDLTDEIKT 354

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           +R K+L+E+ +       ++Y   V  VL E++       Y G T   +  N  +  ++ 
Sbjct: 355 DRIKRLLEIQKAITSKLMQRYKNTVQKVLVEDK---KGNTYIGRTTTNVWCNITSSQDIL 411

Query: 413 GKILNVKI 420
           GK + V I
Sbjct: 412 GKEVEVLI 419


>MIAB_THEMA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 443

 Score =  213 bits (541), Expect = 3e-57
 Identities = 139/444 (31%), Positives = 231/444 (52%), Gaps = 25/444 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+    T GC++N  +SEAM    V+EG+      E ADV ++NTC+V    ++K+   +
Sbjct: 1   MRFYIKTFGCQMNENDSEAMAGLLVKEGFTPASSPEEADVVIINTCAVRRKSEEKAYSEL 60

Query: 61  GRARRQNPEA--IIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+          ++ V GC A+    E    +G D VLG+R    +   V KA  EG+  
Sbjct: 61  GQVXXXXXXXXIVVGVAGCVAE-KEREKFLEKGADFVLGTRAVPRVTEAVKKAL-EGE-- 116

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKT--------RAFLKIQDGCNRFCAYCLIPYTRGSVCS 170
                  K  +FED  ++EY ++          A++ I  GC+RFC YC++PYTRG   S
Sbjct: 117 -------KVALFED-HLDEYTHELPRIRTSRHHAWVTIIHGCDRFCTYCIVPYTRGRERS 168

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIG 230
           +    +L+E++ LAE G++E+   G +  +YG DL +  +L  LLEE  KI+GIER+   
Sbjct: 169 RPMADILEEVKKLAEQGYREVTFLGQNVDAYGKDLKDGSSLAKLLEEASKIEGIERIWFL 228

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  PT F+++++  I    K+    HL +QSG +  LK MNRRYT +EY  ++  +R K+
Sbjct: 229 TSYPTDFSDELIEVIAKNPKVAKSVHLPVQSGSNRILKLMNRRYTKEEYLALLEKIRSKV 288

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGN 349
            +V+I++D+IVGFP             +++    + ++  YSPR+GT A +  ++ V   
Sbjct: 289 PEVAISSDIIVGFPTETEEDFMETVDLVEKAQFERLNLAIYSPREGTVAWKYYKDDVPYE 348

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
           +K  R + L+ L +   +   E+Y G+ + ++ E + + G   Y    RN I      D 
Sbjct: 349 EKVRRMQFLMNLQKRINRKLNERYRGKTVRIIVEAQAKNGL-FYGRDIRNKIIAFEGEDW 407

Query: 410 NVSGKILNVKINSFEGEVAEGEIV 433
            + G+  +VK+         G++V
Sbjct: 408 MI-GRFADVKVEKITAGPLYGKVV 430


>MIAB_RHIL3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 473

 Score =  213 bits (541), Expect = 3e-57
 Identities = 141/450 (31%), Positives = 228/450 (50%), Gaps = 22/450 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S  M++   R+GYE  +  E+AD+ ++NTC +     +K    +G
Sbjct: 27  KVFIKTYGCQMNVYDSMRMSDALARDGYEPTEDMEVADLVLLNTCHIREKAAEKVYSALG 86

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R           E +I V GC AQ    E+      VDVV+G +    +   + +A+ 
Sbjct: 87  RLREMKKKKAADGREMMIGVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAK- 145

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNN----KTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
           +G++ V     +++K FE L I E          AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 146 QGQRVVDTEYAIEDK-FEHLPIAESRRIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEV 204

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIERV 227
           S+   ++++E   LA+ G +EI L G +  ++       E  +L DLL  + +I G+ R+
Sbjct: 205 SRSVSQIVEEAEKLADSGVREITLLGQNVNAWHGAGSQGEAWSLGDLLYRLAEIPGLARL 264

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L  L P+ HL +QSG D  LK MNRR+TA EY  ++  +R
Sbjct: 265 RYTTSHPRDMDDRLINAHRDLSALMPYLHLPVQSGSDRILKAMNRRHTAAEYLALIERIR 324

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
               D++++ D I GFPG            ++ +  ++   FKYS R GT    +++QV 
Sbjct: 325 TVRPDIALSGDFITGFPGETDEDFKDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVP 384

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              K ER ++L  L    ++ FAE  +G+ ID+L E+   +   +  G +     VN  A
Sbjct: 385 EEIKAERLERLQMLLLKQQQEFAESCVGKEIDLLLEKPGRMPEQL-IGRSPWLQSVNVDA 443

Query: 408 DCNVSGKILNVKI-----NSFEGEVAEGEI 432
             +  G I+ V+I     NS   E AE  +
Sbjct: 444 KASQIGDIIKVRITGTGTNSLFAEHAEAAV 473


>MIAB_GEOTN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 523

 Score =  213 bits (541), Expect = 3e-57
 Identities = 135/439 (30%), Positives = 226/439 (51%), Gaps = 12/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  D  E A+V ++NTC++    + K    +G
Sbjct: 81  KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEDANVILLNTCAIRENAENKVFGELG 140

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +     NP+ ++ V GC +Q   +    +   + VD++ G+ N   + Y +++A    
Sbjct: 141 YLKPLKTTNPDLLLGVCGCMSQEEAVVNKILKQYQYVDLIFGTHNIHRLPYILHEAYMSK 200

Query: 116 KQQVKVGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
           +  V+V +  +  V E+L K+ + N K  A++ I  GC++FC YC++PYTRG   S+ P+
Sbjct: 201 EMVVEVWSK-EGDVVENLPKVRKGNIK--AWVNIMYGCDKFCTYCIVPYTRGKERSRRPE 257

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSID 233
            ++ E+R LA  G+KEI L G +  +YG D ++ +  L DL++E+ KID I R+R  +  
Sbjct: 258 DIIQEVRQLAAQGYKEITLLGQNVNAYGKDFNDIQYGLGDLMDELRKID-IARIRFTTSH 316

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  F + ++  +     L  H HL +QSG    LK M R+YT +EY ++V  ++  I DV
Sbjct: 317 PRDFDDRLIEVLAKRGNLVEHIHLPVQSGSTEILKMMGRKYTREEYLELVRKIKAAIPDV 376

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++TTD+IVGFP              + +     + F YSPR+GT A  M + V    K E
Sbjct: 377 ALTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAAKMNDNVPMEVKKE 436

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R ++L  L +       ++Y             +    V  GYTR    V+     ++ G
Sbjct: 437 RLQRLNALVQEIAAKKMKQYXXXXXXXXXXXXSKTNPDVLAGYTRKNKLVHFVGPKSLIG 496

Query: 414 KILNVKINSFEGEVAEGEI 432
           +++NV+I   +     GE+
Sbjct: 497 QLVNVRITQAKTWTLTGEL 515


>MIAB_BRASO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  213 bits (541), Expect = 3e-57
 Identities = 139/446 (31%), Positives = 229/446 (51%), Gaps = 17/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGY-EVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   + GC++N Y+++ M +    EG+ E  D  + AD+ ++NTC +     +K    +
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDTLGAEGFVETADAGD-ADLVILNTCHIREKASEKVYSEL 64

Query: 61  GRARRQNPEAI-------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           GR R    EA        IAV GC AQ    E+ S    VDVV+G ++   +   + +A 
Sbjct: 65  GRLRVAKEEAARSGRAMQIAVAGCVAQAEGVEIISRAPTVDVVVGPQSYHHLPQLLAQA- 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVC 169
             G++ ++     ++K     K      + R   AF+ +Q+GC++FC +C++PYTRG+  
Sbjct: 124 SRGERAIETEFPAEDKFGFLAKPSREAIRARGVSAFVTVQEGCDKFCTFCVVPYTRGAEM 183

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERV 227
           S+   +++D++  L + G +EI L G +  +Y G   D +  TL  LL  I +I G+ R+
Sbjct: 184 SRPVARIVDDVMQLTDSGVREITLIGQNVNAYHGEGPDGRTWTLGRLLYRIAEIPGVARI 243

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L  + P  HL +QSG D  L  MNR+++A +Y  +V+  R
Sbjct: 244 RYSTSHPNDVDDGLIAAHRDLTAVMPFVHLPVQSGSDRILAAMNRKHSAADYRRVVDRFR 303

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
              +D++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M+  V 
Sbjct: 304 GARDDIAFSSDFIVGFPGETEEDFRATLALIDQIGYAAAYSFKYSPRPGTPAADMQEMVS 363

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
             + DER ++L  L    + AF +  IG V+DVLFE E     G   G T      +  A
Sbjct: 364 ATEMDERLERLQSLIDSQQAAFNKAAIGSVVDVLFEREAR-KPGQLVGRTAYLQPAHVMA 422

Query: 408 DCNVSGKILNVKINSFEGEVAEGEIV 433
             ++ G++L V+I+S E     GE+V
Sbjct: 423 SSDIIGQVLPVRIDSLERYSLLGELV 448


>MIAB_ANOFW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 527

 Score =  213 bits (541), Expect = 3e-57
 Identities = 140/441 (31%), Positives = 225/441 (51%), Gaps = 14/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  D  E A+V ++NTC++    + K    IG
Sbjct: 85  KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDRPEDANVILLNTCAIRENAENKVFGEIG 144

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   + NP+ ++ V GC +Q   +    +   + VD++ G+ N   + Y + +A    
Sbjct: 145 HLKPLKQNNPDLLLGVCGCMSQEESVVNKILKQFQYVDMIFGTHNIHRLPYILKEAYMSK 204

Query: 116 KQQVKVGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
           +  V+V +  +  V E+L K+ + N K  A++ I  GC++FC YC++PYTRG   S+ P+
Sbjct: 205 EMVVEVWSK-EGDVIENLPKVRKGNIK--AWVNIMYGCDKFCTYCIVPYTRGKERSRRPE 261

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGVDL-DEKVTLVDLLEEIEKIDGIERVRIGSID 233
            ++ E+R LA  G+KEI L G +  +YG D  D K  L DL++E+ KID I R+R  +  
Sbjct: 262 DIIQEVRHLAAQGYKEITLLGQNVNAYGKDFTDMKYGLGDLMDELRKID-IPRIRFTTSH 320

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  F + ++  +     L  H HL +QSG    LK M R+YT ++Y ++V  +++ I  V
Sbjct: 321 PRDFDDRLIEVLAKGGNLVEHIHLPVQSGSSEVLKMMARKYTREQYLELVRKIKEAIPGV 380

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++TTD+IVGFP              + +       F YSPR+GT A  M + V    K E
Sbjct: 381 ALTTDIIVGFPNETDEQFEETLSLYREVEFDSAFTFIYSPREGTPAAKMVDNVPMEVKKE 440

Query: 354 RSKKLIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           R ++L  L N I+ K   +               +    V  GYTR    VN     +  
Sbjct: 441 RLQRLNALVNEISAKKM-KXXXXXXXXXXXXXXSKNNPDVLAGYTRKNKLVNFVGPKSAI 499

Query: 413 GKILNVKINSFEGEVAEGEIV 433
           G+++NV+I   +     GE+V
Sbjct: 500 GQLVNVRITEAKTWTLNGEMV 520


>MIAB_EHRRW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  212 bits (540), Expect = 4e-57
 Identities = 128/380 (33%), Positives = 202/380 (53%), Gaps = 7/380 (1%)

Query: 9   GCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR--Q 66
           GC++N Y+S  +       G+ +V+    AD+ ++NTC +     +K    +GR R+  +
Sbjct: 10  GCQMNVYDSLIIENIIKPLGFSIVNEPSEADIVILNTCHIREKAAEKLYSELGRIRKIQE 69

Query: 67  NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVL 125
                I V GC AQ   TE+ +    VD+V+G ++   +   + KAR   KQ + +   +
Sbjct: 70  TKNLTIVVAGCVAQAEGTEIFTRAPFVDIVVGPQSIHTLPELIVKARKIKKQIINIDFPV 129

Query: 126 KNKVFEDLKIEEY--NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
            +K F+ + +EEY  N K  AF+ +Q+GCN+FC++C++PYTRG   S+  + +  E   L
Sbjct: 130 ISK-FDAIAVEEYTKNQKVSAFISVQEGCNKFCSFCVVPYTRGEEYSRTVEAIFKEALIL 188

Query: 184 AEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           A+ G KEI L G +  +Y G     +  L  L++ I KI  IER+   +  P    E + 
Sbjct: 189 ADSGIKEITLIGQNVNAYHGTYKGNEWDLGRLIQHIAKISSIERIYYTTSHPRDMHESLY 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                 KKL P  HL +QSG +  L++MNR++TA+EY +I+  LR    D++ ++D IVG
Sbjct: 249 EAHGIEKKLIPFIHLPVQSGSNKILRKMNRKHTAEEYINIIKTLRKHRSDIAYSSDFIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++ +  S+ + FKYSPR GT +    +Q+    K +R  KL EL 
Sbjct: 309 FPGETDEDFENTIQLIEEVKFSQAYSFKYSPRPGTPSAEYTSQIPDEIKSQRLTKLQELV 368

Query: 363 RINEKAFAEKYIGEVIDVLF 382
              +  F +K IGE   VLF
Sbjct: 369 HKQQLEFNKKMIGETHPVLF 388


>MIAB_DESHY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  212 bits (540), Expect = 4e-57
 Identities = 134/437 (30%), Positives = 210/437 (48%), Gaps = 11/437 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV     GC+++  +++ +TE   ++GY      E AD+ +VNTC V    + K    IG
Sbjct: 9   KVVTLAYGCQMSERDADTLTEISSQKGYVRSQELEQADLIIVNTCCVRESAENKILGKIG 68

Query: 62  RARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARDE 114
             +     NP+  IA+ GC  Q  P  +  +      VD+  G+ N  E   +       
Sbjct: 69  ELKHLKEANPQLKIAISGCMVQ-QPGALERLRKRAPHVDIWAGTHNIHE---FQRLLXXX 124

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
                        +  ++  +     K +A++ I  GCN FC YC++P+ RG   S+ P+
Sbjct: 125 XXXXXXXXXXXXPRETQESVLLAAKGKLKAYVNISYGCNNFCTYCIVPHVRGRERSRQPE 184

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++L EIR+L E G +E+ L G +  SYG DLD      DLL++++ IDG+ RVR  +  P
Sbjct: 185 EILAEIRALVETGCREVTLLGQNVNSYGQDLDRAYDFADLLKDVDSIDGLWRVRFMTSHP 244

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
              ++ ++  I A   LC H HL  Q+G D  LK MNR+YT + Y   +  ++  I  VS
Sbjct: 245 KDLSDKLIETIAAGTHLCEHIHLPFQAGSDEILKGMNRKYTREYYLSRIAQIKVIIPQVS 304

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFPG            ++++  S+   F YS R GT A  M  Q+  + K  R
Sbjct: 305 LTTDIIVGFPGETEEDFEQTLELIRQVRYSQAFTFMYSKRSGTPAAQMAEQIPLDIKKRR 364

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            ++LI +      A+ ++ IG+  +VL E   +      TG TR Y  V    +  + G 
Sbjct: 365 LQQLITVQNAQSLAWRQEMIGKTCEVLVEGPSKSNPDRLTGRTRGYELVVFPGEAQLIGT 424

Query: 415 ILNVKINSFEGEVAEGE 431
           ++ V I         GE
Sbjct: 425 LVQVLIQDANSWTLFGE 441


>MIAB_STAHJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  212 bits (539), Expect = 6e-57
 Identities = 135/424 (31%), Positives = 219/424 (51%), Gaps = 14/424 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N +++E M       GY   +    ADV ++NTC++    + K    IG  +  
Sbjct: 74  TYGCQMNAHDTEVMAGILQALGYTATEDINEADVILINTCAIRENAENKVFSEIGNLKHL 133

Query: 65  -RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            +  PEA+I V GC +Q   +    +   + VD++ G+ N  ++   + +A       V+
Sbjct: 134 KKNRPEALIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHKLPEILEEAYLSKAMVVE 193

Query: 121 VGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           V +  +  + E+L K+ E    T+A++ I  GC++FC YC++P+TRG   S+ P+ +++E
Sbjct: 194 VWSK-EGDIIENLPKVRE--GSTKAWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIEE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEE-IEKIDGIERVRIGSIDPTFFT 238
           +R LA  G+KEI L G +  SYG D+             I KID I RVR  +  P  FT
Sbjct: 251 VRGLARDGYKEITLLGQNVNSYGKDIKXXXXXXXXXXXXISKID-IPRVRFTTSHPWDFT 309

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           + ++  I     + PH HL +QSG +A LK M R+YT + Y D+VN ++  I +V++TTD
Sbjct: 310 DRMIEVIAKGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVNRIKKSIPNVALTTD 369

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVG+P                +     + + YS R GT A  M++ V  + K  R ++L
Sbjct: 370 IIVGYPNETEEQFEETLSLYDEVQFEHAYTYLYSQRDGTPAAKMKDNVPEDVKKARLQRL 429

Query: 359 -IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
             ++   +EKA   +Y G+ + VL E   +    V  GYT     VN K      GK++N
Sbjct: 430 NKKVGHYSEKAM-NQYEGKTVTVLCEGSSKKDDTVLAGYTEKNKLVNFKGPREAIGKLVN 488

Query: 418 VKIN 421
           V+I+
Sbjct: 489 VEID 492


>MIAB_EHRRG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  212 bits (539), Expect = 6e-57
 Identities = 128/380 (33%), Positives = 202/380 (53%), Gaps = 7/380 (1%)

Query: 9   GCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR--Q 66
           GC++N Y+S  +       G+ +V+    AD+ ++NTC +     +K    +GR R+  +
Sbjct: 10  GCQMNVYDSLIIENIIKPLGFSIVNELSEADIVILNTCHIREKAAEKLYSELGRIRKIQE 69

Query: 67  NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVL 125
                I V GC AQ   TE+ +    VD+V+G ++   +   + KAR   KQ + +   +
Sbjct: 70  TKNLTIVVAGCVAQAEGTEIFTRAPFVDIVVGPQSIHTLPELIVKARKIKKQIINIDFPV 129

Query: 126 KNKVFEDLKIEEY--NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
            +K F+ + +EEY  N K  AF+ +Q+GCN+FC++C++PYTRG   S+  + +  E   L
Sbjct: 130 ISK-FDAIAVEEYTKNQKVSAFISVQEGCNKFCSFCVVPYTRGEEYSRTVEAIFKEALIL 188

Query: 184 AEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           A+ G KEI L G +  +Y G     +  L  L++ I KI  IER+   +  P    E + 
Sbjct: 189 ADSGIKEITLIGQNVNAYHGTYKGNEWDLGRLIQHIAKISSIERIYYTTSHPRDMHESLY 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                 KKL P  HL +QSG +  L++MNR++TA+EY +I+  LR    D++ ++D IVG
Sbjct: 249 EAHGIEKKLIPFIHLPVQSGSNKILRKMNRKHTAEEYINIIKTLRKHRSDIAYSSDFIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++ +  S+ + FKYSPR GT +    +Q+    K +R  KL EL 
Sbjct: 309 FPGETDEDFENTIRLIEEVKFSQAYSFKYSPRPGTPSAEYTSQIPDEIKSQRLTKLQELV 368

Query: 363 RINEKAFAEKYIGEVIDVLF 382
              +  F +K IGE   VLF
Sbjct: 369 HKQQLEFNKKMIGETHPVLF 388


>MIAB_RICFE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  211 bits (538), Expect = 7e-57
 Identities = 152/446 (34%), Positives = 241/446 (54%), Gaps = 18/446 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++ TC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEDADVIILITCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ S    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDTRKKQGLNSAIIVVAGCVAQAEGEEIFSRAPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F++L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDNLPEQLYPQGASSFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI L G +  +Y G   D+K+ TL DLL  + +I  +ER+R  
Sbjct: 183 VEQVYREALKVVSSGAKEITLLGQNVNAYHGKGPDDKIFTLADLLGHLAQIPNLERLRYM 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+D+++      KL P  HL +QSG +  LK MNR++    Y DI+N LR+  
Sbjct: 243 TSHPIDMTDDLIKLHGTEPKLMPFLHLPVQSGSNKILKAMNRKHDRDYYFDIINRLRETR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++R+   + + FKYSPR GT      +QV  + 
Sbjct: 303 PDIVLSSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATRTDQVPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRN-YIKVNAKA 407
           K ER   L +     + AF E  +G ++ VLF+   +    +   T Y ++ YI+   K 
Sbjct: 363 KSERLTILQQELTAQQLAFNESCVGSIMKVLFDRNGKFDDQIIGKTPYMQSVYIQNPNK- 421

Query: 408 DCNVSGKILNVKINSFEGEVAEGEIV 433
             ++ GKI +VKI         GE++
Sbjct: 422 --SLLGKITDVKITKAASNSLTGEVI 445


>MIAB_OCHA4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 462

 Score =  211 bits (538), Expect = 7e-57
 Identities = 138/435 (31%), Positives = 227/435 (52%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 19  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 78

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 79  RLRKMKDAREANGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRS 138

Query: 114 EGKQQVKVGAVLKNKVFEDL---KIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    L++K FE L   K EE   +   AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 139 -GEKVVETEYALEDK-FEHLPSPKREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 196

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++    D   +  L +LL  + +I GI R+
Sbjct: 197 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGAGDDGREWGLGELLFRLARIPGIARL 256

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 257 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYVRLIERIR 316

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 317 EVRPDLALSGDFIVGFPGETDQDFEDTMRLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 376

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDER ++L  L    + AF +  IG  +DVL E+   + +G   G +   + V    
Sbjct: 377 EAVKDERLQRLQALLSEQQYAFQDSMIGREMDVLLEKPGRV-AGQMVGRSPWLLPVIIDD 435

Query: 408 DCNVSGKILNVKINS 422
             +  G I++VKI S
Sbjct: 436 SNDRVGDIIHVKITS 450


>MIAB_SYNJA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 453

 Score =  211 bits (537), Expect = 1e-56
 Identities = 134/438 (30%), Positives = 215/438 (49%), Gaps = 21/438 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N  +SE M       GY   +    AD+ + NTC++ +  ++K    +G   + 
Sbjct: 10  TFGCQMNRADSERMAGILESLGYVPAEDELQADLVLFNTCTIRDNAEQKVYSYLGIQAQR 69

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD------EGK 116
           +R+NP   + V GC AQ     +   +  +D+V+G +       YVN+  D       G 
Sbjct: 70  KRKNPAIKLIVAGCVAQQEGERLLRRVPELDLVMGPQ-------YVNRLGDLLAQVEAGN 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           Q V    V   ++ ED+     +++  A++ +  GCN  C YC++P  RG   S+ P+ +
Sbjct: 123 QVVATEPV---EIPEDITKPRRDSRVTAWINVIYGCNERCTYCIVPLVRGREQSRQPQAI 179

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
             EI  +A  G++E+ L G +  +YG DLD K  L  LL  +  ++GIER+R  +  P +
Sbjct: 180 RAEIEDVARAGYREVTLLGQNIDAYGRDLDPKTNLASLLRFVHSVEGIERIRFATSHPRY 239

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FTE+++     L K+C HFH+  Q+G DA LKRM R YT + Y  ++ L+R  + + +I+
Sbjct: 240 FTEELIATCAELPKVCEHFHIPFQAGSDAVLKRMRRGYTQERYRQLIQLIRQYMPEATIS 299

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
            D IVGFPG            ++ I     +   YSPR GT A    +QV   +K +R +
Sbjct: 300 ADAIVGFPGETEAQFQETLQLVQDIGFDFLNTAAYSPRPGTPAAEWPDQVPEEEKSDRLQ 359

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC-NVSGKI 415
           +L  L      A + + +G+V +VL E           G TR    V    D   + G +
Sbjct: 360 RLNRLVAEVAAARSARLLGQVQEVLVEGPNPKNPRQAMGRTRGNRIVFFDGDPEQLQGSL 419

Query: 416 LNVKINSFEGEVAEGEIV 433
           + V+I +       GEIV
Sbjct: 420 VPVRITATRAFSLSGEIV 437


>MIAB_SYNAS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 461

 Score =  211 bits (536), Expect = 1e-56
 Identities = 141/436 (32%), Positives = 212/436 (48%), Gaps = 10/436 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           TLGC++N ++SE +      +GY   +    AD+ ++NTCS+     +K++  +GR    
Sbjct: 24  TLGCQMNVHDSEQIAALMEEKGYICTEDANEADLIILNTCSIREKAAQKAKSQLGRYXXX 83

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
                   I V GC AQ    E+ + +  +D + G+ N  ++  ++++     K+ V+  
Sbjct: 84  XXXXXXXXIGVGGCLAQQLGDELLTKVPDIDFIFGTHNIHQLPDFISRIEKSRKKIVETT 143

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
                     L +   N +  +F+ I  GCN FC+YC++PY RG   S+ P+ ++ EIR 
Sbjct: 144 LHPSTPSIGVLALP-CNGQVSSFVTIMQGCNNFCSYCIVPYVRGREESRPPEDIIHEIRM 202

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           LA+HG KE+ L G +  SY      ++   +LL EIEKI GIER+R  +  P   +E ++
Sbjct: 203 LADHGVKEVTLLGQNVNSYARKTSGEMGFAELLREIEKIKGIERMRFTTSHPKDLSEFLI 262

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                L KLC H HL  QSG D  L  MNR YT  +Y   V  LR    D+SIT DVIVG
Sbjct: 263 TAFSDLSKLCHHIHLPFQSGSDRILALMNRGYTKSDYLAKVERLRTVCPDISITADVIVG 322

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            + +I       FKYS R+GT A  M+ +V    K ER + L  L 
Sbjct: 323 FPGESDEDFKETIDMMNQIRFDNLFSFKYSEREGTAAVKMDGKVSEPLKLERLQILQALQ 382

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI-- 420
             +     +   G+  DVL E   +      TG T     VN     ++ G +++V I  
Sbjct: 383 EQHTLEKNKAMEGKQEDVLVEGFSKNCRKDLTGRTSTNKIVNFSGCVDLIGDMVSVLIKE 442

Query: 421 ---NSFEGEVAEGEIV 433
              +S  GE+   E+V
Sbjct: 443 AYLHSLRGEMLCEEVV 458


>MIAB_MARMM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  211 bits (536), Expect = 1e-56
 Identities = 138/442 (31%), Positives = 221/442 (50%), Gaps = 21/442 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+S+ M +     GYE  +  E AD+ ++NTC +     +K    +GR R  
Sbjct: 12  TYGCQMNVYDSDRMKDVLTPLGYESAETPEGADLVILNTCHIREKAAEKVYSELGRLRPL 71

Query: 67  NPEAI------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKG---EIVYYVNKARDEGK 116
             E        IAV GC AQ    E+      VD+V+G +      E++   ++A+ E  
Sbjct: 72  KDEKAASGGMTIAVAGCVAQAEGAEIMKRAPVVDLVVGPQTYHKLPELIAQAHRAKGEAL 131

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
                     +++  D ++E Y+    AF+ +Q+GC++FC +C++PYTRG+  S+   ++
Sbjct: 132 DTEFEVEDKFDRLGSDRQVEGYS----AFVTVQEGCDKFCTFCVVPYTRGAEWSRPVDQI 187

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY------GVDLDEKVTLVDLLEEIEKIDGIERVRIG 230
           + EIR+LA  G +E+ L G +  ++      G + +    L  L+  +  I GIER+R  
Sbjct: 188 VAEIRALAAKGIREVTLLGQNVNAFHGAPPSGREAEGAWGLGQLVRHVALIGGIERIRFT 247

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P    E +++      KL P+FHL +Q+G D  LK MNR++TA+EY  I++ LR   
Sbjct: 248 TSHPRDMDEVLIQAFADTPKLMPYFHLPVQAGSDKILKSMNRQHTAEEYVAIIDRLRAAR 307

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D++I+ D+IVGFPG            ++R+  +    FKYS R GT    M NQVD   
Sbjct: 308 PDIAISGDMIVGFPGETDADFEATLDLVRRVKFASCFSFKYSKRPGTPGAAMFNQVDEGV 367

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN 410
           K  R   L EL    + AF E  IG  + VLFE+   +G G   G +     V+      
Sbjct: 368 KSARLAVLQELLSDQQAAFNESMIGRTLPVLFEKPGRMG-GQLHGRSPYLQSVHVDGPAE 426

Query: 411 VSGKILNVKINSFEGEVAEGEI 432
           + G++  V+I +       G +
Sbjct: 427 LIGQVGEVRIEAASRNSLSGSL 448


>MIAB_UNCTG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 418

 Score =  210 bits (535), Expect = 2e-56
 Identities = 130/437 (29%), Positives = 224/437 (51%), Gaps = 30/437 (6%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M     T+GC++N  +S+ +   F   G    +    ADV ++NTCSV +  ++K+   +
Sbjct: 1   MNYLIETIGCQMNVCDSDMLVSIFSAYGASKANNLSEADVVILNTCSVRSQAEQKAFSYL 60

Query: 61  GRAR---RQNPEAIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   ++NP   I V+GC A+ + P        VD+++G+++ G     +        
Sbjct: 61  GRVKEFKQKNPCIKIVVIGCMAERLGPNIKKRFSSVDLIIGAKDIGNAALKIMNLFRTDY 120

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
              KV + +K+K+               ++ I  GC+ +C+YC +P+ RG   S + + +
Sbjct: 121 SAKKVNSEIKSKIVR-------------YITIMRGCDNYCSYCAVPFVRGREVSINCETI 167

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           ++E  S+ ++G +EIIL G +  SY     E V    L+++   I+ +ER+R  +  P  
Sbjct: 168 VNECSSMVKNGAREIILLGQNVNSYQY---EDVNFASLIKKTAAIENLERIRFMTNHPKD 224

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
            ++D+++ +    K+CPH H+ +QS  D  LK MNR+Y+ + Y  ++  LR  + DVS+T
Sbjct: 225 LSDDLIKIMATEPKVCPHIHIPMQSASDKILKAMNRKYSYEHYLGLIKKLRTAVPDVSVT 284

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +K I     ++F+YSPR  T+A  M + V   +K  R  
Sbjct: 285 TDIIVGFPGETDEDFEDTLKAVKTIRFGGLYVFRYSPRPDTKAAEMIDDVPFEEKKRRHA 344

Query: 357 KLI-ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
            ++ E N+I+ +  +E  +G    VL E   E+ +G+    T+N  KV A+      GK 
Sbjct: 345 VVLKESNKISIEIVSE-MLGSTQQVLAE---EIKNGIIKARTKNGRKVFAEGRKEYIGKH 400

Query: 416 LNV-----KINSFEGEV 427
           +NV     KINS  G++
Sbjct: 401 INVNIKEAKINSLFGDI 417


>MIAB_THEM4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 430

 Score =  210 bits (534), Expect = 2e-56
 Identities = 129/397 (32%), Positives = 214/397 (53%), Gaps = 13/397 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N  +SE        EGYE+ +    AD+ ++NTC V    + K    IG
Sbjct: 3   KIHIKTYGCQMNENDSEVAKFYLEEEGYEITNNENDADIVILNTCVVRKKSEDKFYSHIG 62

Query: 62  RARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKV 121
             ++QN   II ++GC A+    ++    GV  V+G+R    I   V +A +  K     
Sbjct: 63  ELKKQNK--IIGIMGCGAEKEKEKLFK-RGVKFVIGTRAIPLIPQAVERAINGKKS---- 115

Query: 122 GAVLKNKVFED--LKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
            A+ ++K+ E    KI + N+K  A++ I  GCNRFC YC++PYTRG   S+    +++E
Sbjct: 116 -AIFEDKMDEIDYKKILKRNSKHHAWITIIYGCNRFCTYCIVPYTRGREKSRKMDDIINE 174

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           + +LA+ G KE+   G +  +YG DL++  +L  LL   + I+ IER+   +  PT F+ 
Sbjct: 175 VENLAKSGIKEVTYLGQNVDAYGKDLNDGSSLAKLLNLTKDIEEIERIWFLTSYPTDFSL 234

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           D+   +    K+  + HL +Q G +  LK+MNRRYT +EY +++N +R  + D SI++D+
Sbjct: 235 DIAHEVANSSKITKNIHLPVQHGSNKILKKMNRRYTIEEYIELINDIRKIVPDASISSDI 294

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGNKKDERSKKL 358
           IVGFP             +K I   + ++  YSPR+GT A +  E+ V    K +R   +
Sbjct: 295 IVGFPDETEEDFEKTVELVKNIKFERLNLAIYSPREGTIAWKYFEDNVPRIIKTKRMAYI 354

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTG 395
           + L +   K   E Y+ + ++++ E + +  SG+Y G
Sbjct: 355 LNLQKEINKQLNENYLNKTVEIIVETKAK--SGLYYG 389


>MIAB_ANAVT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  210 bits (534), Expect = 2e-56
 Identities = 134/437 (30%), Positives = 211/437 (48%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       G+E  +    ADV + NTC++ +  ++K    +GR    
Sbjct: 12  TFGCQMNKADSERMAGILEDMGFEFSEDPNNADVILYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P+  + V GC AQ      +  +  +D+V+G ++   +   +      G Q V   
Sbjct: 72  KHEQPDLTLVVAGCVAQQEGEALLRRVPELDLVMGPQHANRLKDLLESVF-AGNQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           AV    + ED+     ++   A++ +  GCN  C YC++P  RG   S+ P+ V  E+  
Sbjct: 131 AV---HIMEDITQARRDSTVTAWVNVIYGCNERCTYCVVPNVRGVEQSRTPEAVRAEMEE 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV-------TLVDLLEEIEKIDGIERVRIGSIDPT 235
           L   G+KEI L G +  +YG DL           T  DLL  +  + GIER+R  +  P 
Sbjct: 188 LGRQGYKEITLLGQNIDAYGRDLPGATPEGRHLHTFTDLLYYVHDVPGIERIRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I++ +R  + D SI
Sbjct: 248 YFTERLIKACAELPKVCEHFHIPFQSGDNQLLKAMARGYTQEKYRRIIDTIRRYMPDASI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            +  I   + +   YSPR GT A   ENQ+    K +R 
Sbjct: 308 SADAIVGFPGETEEQFENTLKLVDDIGFDQLNTAAYSPRPGTPAALWENQLSEETKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L  +     +++Y+G + +VL EE+         G TR       K D N + G+
Sbjct: 368 QRLNHLVNVKAAERSQRYMGRIEEVLVEEQNPKDQTQVMGRTRGNRLTFFKGDINELKGQ 427

Query: 415 ILNVKINSFEGEVAEGE 431
           ++ VKIN        GE
Sbjct: 428 LVKVKINEVRAFSLTGE 444


>MIAB_DICT6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  209 bits (533), Expect = 3e-56
 Identities = 141/439 (32%), Positives = 215/439 (48%), Gaps = 13/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           K    T GC++N  +SE +       GY   +  E AD+ ++NTCSV    ++K      
Sbjct: 3   KYYIITYGCQMNKSDSEKVAGILENLGYTPSEKMEEADIILLNTCSVRERAEEKVFXXXX 62

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
                        I + GC AQ    E +     VD VLGS    E+   +     +GK+
Sbjct: 63  XXXXXXXXXXXXXIGIFGCMAQRMKEELIEKFPHVDFVLGSYKFTELPKILESL--DGKK 120

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +V +   + +    D ++ +  NK +A++ I  GCN FC YC++PY RG   S+DP++++
Sbjct: 121 KVVLAEDIPSPQDVDFRVIKRENKFQAWIPIIYGCNNFCTYCIVPYLRGREKSRDPEEII 180

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E+  LA  G  E+ L G +  SYG DL   V L DLL EI +I  I+R+R  +  P   
Sbjct: 181 REVEYLASQGVVEVTLLGQNVDSYGKDLGN-VDLADLLVEIHRIPRIKRIRFLTSHPRDV 239

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           ++ ++R +    K+CPH+HL LQ+G D  L+RM R YT  EY+ ++  +R +I   S +T
Sbjct: 240 SDKLIRVVATHPKVCPHWHLPLQAGSDRILRRMGRGYTYSEYKALIEKIRAEIPKASFST 299

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            L+ I     ++  YS R GT A N E+ +     + + + 
Sbjct: 300 DIIVGFPGEEEEDFLATRRALEEIKFDTVNLAIYSKRPGTPAANYEDLI---PYETKKRW 356

Query: 358 LIELNRINEKAFAEK---YIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             EL  +  K   EK    +G+   VL EE         +G T NY  V  +A+  + GK
Sbjct: 357 FDELENLQRKIIYEKNLSRVGKEEIVLAEEVNPKNPRELSGRTENYRLVFFEAEKELIGK 416

Query: 415 ILNVKINSFEGEVAEGEIV 433
            L VKI        +GE++
Sbjct: 417 FLLVKITEARLWSLKGEVI 435


>MIAB_RICRS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  209 bits (532), Expect = 4e-56
 Identities = 151/445 (33%), Positives = 242/445 (54%), Gaps = 23/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSIKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDTRTKQGLSSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y   T AF+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGTSAFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G    +K+ +L DLL+ + +I  +ER+R  
Sbjct: 183 VEQVYREALKVVSSGAKEIMLLGQNVNAYHGKGPADKIFSLADLLKHLAQIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P     D+++      KL P  HL +QSG +  LK MNR++  + Y DI+N LR+  
Sbjct: 243 TSHPIDMNNDLIKLYGTEPKLMPFLHLPVQSGSNKILKAMNRKHDREYYFDIINRLREAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  + 
Sbjct: 303 PDIVLSSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATRTDQIPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRN-YIKVNAKA 407
           K ER   L +     + AF    +G  + VLF+   +    +   T Y ++ YI+   K 
Sbjct: 363 KSERLTILQQELMAQQLAFNTSCVGSTMKVLFDRNGKFDDQIIGKTPYMQSVYIQNPNK- 421

Query: 408 DCNVSGKILNVKI-----NSFEGEV 427
             ++ GKI++VKI     NS  GE+
Sbjct: 422 --SLLGKIIDVKITKASLNSLTGEI 444


>MIAB_RICRO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  209 bits (532), Expect = 4e-56
 Identities = 151/445 (33%), Positives = 242/445 (54%), Gaps = 23/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSIKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDTRTKQGLSSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y   T AF+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGTSAFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G    +K+ +L DLL+ + +I  +ER+R  
Sbjct: 183 VEQVYREALKVVSSGAKEIMLLGQNVNAYHGKGPADKIFSLADLLKHLAQIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P     D+++      KL P  HL +QSG +  LK MNR++  + Y DI+N LR+  
Sbjct: 243 TSHPIDMNNDLIKLYGTEPKLMPFLHLPVQSGSNKILKAMNRKHDREYYFDIINRLREAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  + 
Sbjct: 303 PDIVLSSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATRTDQIPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRN-YIKVNAKA 407
           K ER   L +     + AF    +G  + VLF+   +    +   T Y ++ YI+   K 
Sbjct: 363 KSERLTILQQELMAQQLAFNTSCVGSTMKVLFDRNGKFDDQIIGKTPYMQSVYIQNPNK- 421

Query: 408 DCNVSGKILNVKI-----NSFEGEV 427
             ++ GKI++VKI     NS  GE+
Sbjct: 422 --SLLGKIIDVKITKASLNSLTGEI 444


>MIAB_PETMO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  209 bits (532), Expect = 4e-56
 Identities = 132/439 (30%), Positives = 236/439 (53%), Gaps = 10/439 (2%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MK    T GC++N  ESE M      EG+E  +  + AD+ ++N+C+V    + K    I
Sbjct: 1   MKFYIRTFGCQMNINESEIMAGLLKEEGFEWTENPKEADIILINSCAVREKAENKMYGAI 60

Query: 61  G---RARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G   + + +N   I+ V GC A+     +    + +D V G+RN  +I   V +A + GK
Sbjct: 61  GGYGKLKDENKNLILGVGGCSAEKERENLLERFKNIDFVFGTRNVVDIGNLVKRALN-GK 119

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           +       L +  ++  K+    +K  A++ I  GCN++C+YC++PYTRG   S+  + +
Sbjct: 120 RFADFSDKLNDVNYDIPKMPI--SKHHAWITIIYGCNKYCSYCIVPYTRGFEKSRPMEDI 177

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLL-EEIEKIDGIERVRIGSIDPT 235
           + E+ S A+ G+KEI   G +  SYG D  +K + +DLL ++  + D I+R+   +  P+
Sbjct: 178 IREVESYAKKGYKEITFLGQNVDSYGKDFGDKKSKLDLLIQKAAEFDSIKRIWFLTSYPS 237

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
             T+ +++ +   +K   +FHL  QSG +  LK MNR+YT +E+ ++VN ++ ++ +V++
Sbjct: 238 DITDSLIQTVANEEKAANYFHLPAQSGSNKILKAMNRKYTREEFIELVNKVKKEVANVTV 297

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMEN-QVDGNKKDER 354
           ++D I GFP             +K+    + +I +YSPR+GT A   +N  V  + K++R
Sbjct: 298 SSDFITGFPSETDEDFEETVDLIKQCRFERINIAEYSPREGTIAYKYQNDDVPKHIKNKR 357

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L+EL +       EKY+ + + V+ +E     +G Y G T N   +  +++  ++G+
Sbjct: 358 LQYLMELQKRINLEENEKYLEQEV-VIIQEGKAGKNGTYMGRTMNNKLIIFESNEELNGE 416

Query: 415 ILNVKINSFEGEVAEGEIV 433
            L VK+N        GE+V
Sbjct: 417 FLKVKVNKITPGPLYGEVV 435


>MIAB_BACSK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 520

 Score =  209 bits (532), Expect = 4e-56
 Identities = 140/439 (31%), Positives = 220/439 (50%), Gaps = 11/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N ++SE M+   +  G+        AD+ ++NTC++    + K    IG
Sbjct: 78  KFLIRTYGCQMNVHDSENMSGLLLGMGFXXXXXXXXADIILLNTCAIRENAENKVFGEIG 137

Query: 62  RARRQNPEA---IIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
                       II V GC +Q   +    +   + +D++ G+ N   + + +  A   G
Sbjct: 138 NXXXXXXXXXXXIIGVCGCMSQEESVVGKIMEKHQHIDLIFGTHNIHRLPHLLRDAIF-G 196

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K+ V      +  + E++      NKT+A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 197 KEMVIEVWSKEGDIVENMP-RSRKNKTQAWVNIMYGCDKFCTYCIVPYTRGKERSRLPED 255

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           ++ E+R LA  G+KEI L G +  +YG DL     L DL+ EI KID I RVR  +  P 
Sbjct: 256 IIAEVRDLARQGYKEITLLGQNVNAYGKDLPGSYRLGDLMNEIHKID-IPRVRFTTSHPR 314

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            F + ++  +     L  H HL +Q G    LK M R+YT ++Y  + N ++  I + S 
Sbjct: 315 DFDDHLIEVLAQGGNLVEHIHLPVQHGNSDILKLMGRKYTREQYITLANKIKQAIPNASF 374

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           TTD+IVGFP             ++ I     + + YSPR+GT A  ME+ V  + K ER 
Sbjct: 375 TTDLIVGFPNETEEQFQDMLSLVEEIQFDAAYTYIYSPREGTPAARMEDNVPMSVKKERL 434

Query: 356 KKLIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            +L  L N I+ K   + Y  ++++VL E E +  + V  G TR    VN     +  G+
Sbjct: 435 ARLNALVNDISNKRNLD-YQDKIVEVLVEGESKKNTDVLAGRTRTNRLVNFVGPKSAIGE 493

Query: 415 ILNVKINSFEGEVAEGEIV 433
           I+ VKI   +    +GEIV
Sbjct: 494 IVYVKITEAKTWSLDGEIV 512


>MIAB_ARCB4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 436

 Score =  209 bits (531), Expect = 5e-56
 Identities = 142/446 (31%), Positives = 228/446 (51%), Gaps = 30/446 (6%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   TLGC++N  +S+ +  +  + +GY      E AD+ ++NTCSV     +K    I
Sbjct: 6   KLFIQTLGCQMNDTDSQHIQAELEKHKGYVTTQNIEDADLIIINTCSVRERPVQKLFSEI 65

Query: 61  GRARRQNPE-AIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+  ++  E A I V GC A  +    +     VD V+G+RN  +I           K  
Sbjct: 66  GQFNKKKKEGAKIGVCGCTASHLGQDIIKRAPYVDFVVGARNISKI-----------KDV 114

Query: 119 VKVGAVLKNKVFEDLKIEEYN----NKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
           V V   ++  +  D    E++    NK RA + I  GC++ C YC++P TRG   S  P+
Sbjct: 115 VDVKGAVEVSIDNDESTYEFSTAKTNKYRASVNISVGCDKKCTYCIVPSTRGEEISIPPE 174

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYG---VDLDEKVTLVDLLEEIEKIDGIERVRIGS 231
            +++++R   E G  E++L G +  SYG    D  EK T   LL+++ KIDG+ER+R  S
Sbjct: 175 MIVEQVRKSVEQGAVEVMLLGQNVNSYGRKFSDKREKYTFTKLLQDVSKIDGLERIRFTS 234

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P    ++ +       K+    H+ LQSG  + LK M R Y+ + + +  + +R+ + 
Sbjct: 235 PHPLHMDDEFIEEFAKNPKISKCIHMPLQSGSTSVLKAMKRGYSKEWFLNRASKMRELVP 294

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           ++ ITTD+IV FPG            ++++   +   FKYSPR GT A N++   D    
Sbjct: 295 NLRITTDIIVAFPGETQEDFLDTLDVVEQVKFDQIFNFKYSPRPGTEALNLK---DKELP 351

Query: 352 DE-RSKKLIELNRINEKAFAE---KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
           DE  S++LI+L  ++++   E   K IGE +++L E      +G   GYT NY++V AK 
Sbjct: 352 DEIGSQRLIDLIELHKRYLEESMPKLIGETLNILVESLKP--NGEVCGYTDNYLQVFAKG 409

Query: 408 DCNVSGKILNVKINSFEGEVAEGEIV 433
              + GK +NVKI        +GE+V
Sbjct: 410 SDELLGKFVNVKITDVTRTSLKGEVV 435


>MIAB_SYNP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  208 bits (530), Expect = 6e-56
 Identities = 130/439 (29%), Positives = 213/439 (48%), Gaps = 16/439 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY   +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 11  TFGCQMNKADSERMAGILEEMGYHFTEDPYAADLVLYNTCTIRDNAEQKVYSYLGRQAKR 70

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +++ P+  + V GC AQ    + +  +  +D+++G ++   +   + +   EG  QV   
Sbjct: 71  KQEKPDLTLIVAGCVAQQEGESLLRRVPELDLIMGPQHANRLQDLLEQV--EGGSQVVAT 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             +   + ED+     ++   A++ +  GCN  C YC++P  RG+  S+ P+ +  E+  
Sbjct: 129 EPIH--IVEDITKPRRDSTVTAWVNVIYGCNEHCTYCVVPGVRGTEQSRYPEAIRAEMEE 186

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L   GFKE+ L G +  +YG DL         K TL DLL  +  + GIER+R  +  P 
Sbjct: 187 LGRQGFKEVTLLGQNIDAYGRDLPGTTPEGRNKYTLTDLLYYVHDVPGIERIRFATSHPR 246

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I+N +R  + D SI
Sbjct: 247 YFTERLIKACQELPKVCEHFHIPFQSGDNEVLKAMRRGYTHEKYRRIINTIRSYMPDASI 306

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IV FPG            +  I   + +   YSPR GT A   +NQ+    K +R 
Sbjct: 307 SADAIVAFPGETEEQFENTLKLVDEIGFDQLNTAAYSPRPGTPAATWDNQLSEEVKGDRL 366

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L        +++Y G + +VL E++         G TR       + + N + GK
Sbjct: 367 QRLNHLVAQKAAERSQRYAGRIEEVLVEDQNPKNPSQVMGRTRGNRLTFFEGEINELKGK 426

Query: 415 ILNVKINSFEGEVAEGEIV 433
           I+ VKI         GE V
Sbjct: 427 IVAVKITEARAFSLTGEAV 445


>MIAB_SYNJB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  208 bits (530), Expect = 6e-56
 Identities = 131/438 (29%), Positives = 216/438 (49%), Gaps = 21/438 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N  ++E M       GY   +    AD+ + NTC++ +  ++K    +G   + 
Sbjct: 10  TFGCQMNRADTERMAGILESLGYVATEDELQADLVLYNTCTIRDNAEQKVYSYLGIQAQR 69

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD------EGK 116
           +R+NP   + V GC AQ    ++   +  +D+V+G +       YVN+  D       G 
Sbjct: 70  KRKNPAIKLIVAGCVAQQEGEKLLRRVPELDLVMGPQ-------YVNRLGDLLAQVEAGN 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           Q V    V   ++ ED+     +++  A++ +  GCN  C YC++P  RG   S+ P+ +
Sbjct: 123 QVVATDPV---EIPEDITKPRRDSQVTAWINVIYGCNERCTYCIVPRVRGQEQSRQPQAI 179

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
             EI  +A  G++E+ L G +  +YG DLD K  L  LL  +  ++GIER+R  +  P +
Sbjct: 180 RAEIEDVARAGYREVTLLGQNIDAYGRDLDPKTNLASLLRFVHSVEGIERIRFATSHPRY 239

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FTE+++     L K+C HFH+  Q+G +  LKRM R YT + Y  I+ L+R  + + +I+
Sbjct: 240 FTEELITTCAELPKVCEHFHIPFQAGSNEVLKRMRRGYTHERYRQIIQLIRQYMPEAAIS 299

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
            D IVGFPG            ++ I   + +   YSPR GT A    +QV   +K +R +
Sbjct: 300 ADAIVGFPGETEAQFQETLQLVQDIGFDQVNTAAYSPRPGTPAAEWPDQVPEEEKSDRLQ 359

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC-NVSGKI 415
           +L  L      A + + +G+V +VL E           G TR    V  + D   + G +
Sbjct: 360 RLNRLVAEVAAARSARLLGQVQEVLVEGPNPKNPRQAMGRTRGNRLVFFEGDPEELQGSL 419

Query: 416 LNVKINSFEGEVAEGEIV 433
           + V+I +       GE V
Sbjct: 420 VPVRITATRAFSLTGEAV 437


>MIAB_SYNFM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  208 bits (530), Expect = 6e-56
 Identities = 138/433 (31%), Positives = 210/433 (48%), Gaps = 8/433 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N Y+S+         GY        ADV  +NTCSV +  ++K    +GR RR 
Sbjct: 19  TFGCQMNEYDSQRALRLLCAVGYRPTSDIADADVIFLNTCSVRDKAEQKVYSFLGRLRRL 78

Query: 66  --QNPEAIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
               P   I V GC AQ +    +   E VD+V+G+R  G I   + +     ++   + 
Sbjct: 79  KAHRPWLKIVVAGCVAQQLGDGLLKRFEHVDLVVGTRGIGSIASLLEEVERSKRRVAHLP 138

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A        D           A + I  GCN FC YC++P+ RG   S+ P  +L EI  
Sbjct: 139 AEELQGFTTDKCRTVGTGDVVAQVTIMQGCNNFCTYCIVPHVRGRERSRAPDDILREIDF 198

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           LA  G +E++L G +  SYG  L + ++  DLL  I K   I RVR  +  P   TED++
Sbjct: 199 LASRGAREVLLLGQNVNSYGRGLPDPISFPDLLRRIGKETSIRRVRFTTSHPKDLTEDLI 258

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                L  LC H HL  QSG D  LK M+R YTA++Y + +  LR+   +++++TDVIVG
Sbjct: 259 ECFAGLPFLCKHLHLPFQSGSDGILKLMHRGYTARQYLEKIARLREVCPEIALSTDVIVG 318

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL--IE 360
           FP             ++ +       F+YS R  TRA    ++V  + K  R  +L  I+
Sbjct: 319 FPAESEEDYLQTLRLIEEVRFDSLFSFRYSDRPLTRAAGFPDKVPMDVKVRRLARLQSIQ 378

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI 420
            +   +K  AE   G V +VL E   +  +G  TG T+    +N +   +++GKI+ V+I
Sbjct: 379 ADITLQKNLAE--TGTVREVLVEGPSKASNGQMTGRTQQNRIINFQCPVDLTGKIVPVRI 436

Query: 421 NSFEGEVAEGEIV 433
            +      +GE++
Sbjct: 437 VAAYSHSLKGELL 449


>MIAB_SILST RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  208 bits (530), Expect = 6e-56
 Identities = 139/444 (31%), Positives = 223/444 (50%), Gaps = 22/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    +GY      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLYIKTYGCQMNVYDSERMAETLGGQGYVETQTPDDADMILLNTCHIREKAAEKVYSELG 65

Query: 62  R---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R    + + P+  I V GC AQ    E+   +  VD+V+G ++   +     KA    K 
Sbjct: 66  RFKGLKAEKPDLKIGVAGCVAQAEGEEIMRRQPLVDLVVGPQSYHRLPEMEAKAGTGEK- 124

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRA------FLKIQDGCNRFCAYCLIPYTRGSVCSK 171
                 VL     E+ K E+   + +A      FL +Q+GC++FCA+C++PYTRG+  S+
Sbjct: 125 ------VLDTDFPEEDKFEKLKRRPKAKRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSR 178

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIG 230
              +VL E   L E G +EI L G +  +Y G   +  +TL  L+ E++KIDG+ER+R  
Sbjct: 179 PVDRVLREAEDLVERGVREITLLGQNVNAYHGAGPNGDMTLAQLIWELDKIDGLERIRFT 238

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P    +D++      KKL P+ HL +Q+G D  LKRMNR +TA+ Y  ++  +R   
Sbjct: 239 TSHPNDMMDDLIEAHGTCKKLMPYLHLPVQAGSDKILKRMNRSHTAESYIRLIERIRAAR 298

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ I+ D IVGFP             ++ +     + FKYS R GT A     QVD  +
Sbjct: 299 PDILISGDFIVGFPEETEEDFQATLDLVEEVKYGTAYSFKYSTRPGTPAAE-RAQVDPKE 357

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN 410
            D+R ++L  +    ++   +  +G  + VLFE+     +G   G + +Y+     ADC+
Sbjct: 358 ADDRLQRLQAVLTRQQREVQDSMVGRELGVLFEKAGRF-AGQMVGKS-DYLHAVHVADCD 415

Query: 411 VS-GKILNVKINSFEGEVAEGEIV 433
              G +  V+I S       GE++
Sbjct: 416 AKIGDLRRVRIVSSGANSLAGELI 439


>MIAB_ANAPZ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  208 bits (530), Expect = 6e-56
 Identities = 138/432 (31%), Positives = 229/432 (53%), Gaps = 16/432 (3%)

Query: 9   GCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR-QN 67
           GC++N Y++  M +     GY  V   E AD+ ++NTC +     +K    +GR R  + 
Sbjct: 11  GCQMNVYDALMMEDLLRPVGYAAVSRPEDADIILINTCHIREKASEKLYSTLGRMRVIKK 70

Query: 68  PEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLK 126
            E I+ V GC AQ     V      V+VV+G +    +   + K + + K+Q+ +   + 
Sbjct: 71  EECILIVAGCVAQAEGEAVFERAPYVNVVVGPQGLHTLPELIMKVKRD-KKQINIEFPVV 129

Query: 127 NKVFEDLKIE-EYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAE 185
           +K F+ + I+ + N    A++ IQ+GC++FC +C++PYTRG   S+D + +L+E++ L +
Sbjct: 130 SK-FDAISIDRKANGGVSAYVSIQEGCDKFCTFCVVPYTRGPEYSRDVEAILEEVKQLTD 188

Query: 186 HGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRR 244
            G KEI+L G +  +Y G     +  L  L++++  IDG+ER+R  +  P      +   
Sbjct: 189 RGTKEIVLIGQNVNAYHGTYKGNEWDLGKLIQKVSLIDGVERIRYTTSHPRDMHPSLYEA 248

Query: 245 ILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVGFP 304
               KKL P  HL +QSG DA L++MNR++TA+EY  +V  L+D  +++++++D IVGFP
Sbjct: 249 HRDEKKLAPFVHLPVQSGSDAILRKMNRKHTAEEYLRVVEQLKDSNKNMALSSDFIVGFP 308

Query: 305 GXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELNRI 364
           G            ++ +  + ++ FKYSPR GT      NQV   +K  R   L  L   
Sbjct: 309 GETEKDFEETMKLVESVGFALSYSFKYSPRPGTPGAEYSNQVPEEEKSARLAALQGLLTK 368

Query: 365 NEKAFAEKYIGEVIDVLFEEEVELGSGVYTG---YTRNYIKVNAKA---DC---NVSGKI 415
            +  F +   G V+DVL  +   + S    G   YT++ I ++A +   DC    V  +I
Sbjct: 369 QQLQFNKSMEGRVMDVLVGDPSSMRSDRIFGKSEYTQS-IHISAPSGSEDCFNRMVRVEI 427

Query: 416 LNVKINSFEGEV 427
           L+ + NS EG V
Sbjct: 428 LHGRQNSLEGTV 439


>MIAB_RICCN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  208 bits (529), Expect = 8e-56
 Identities = 151/445 (33%), Positives = 241/445 (54%), Gaps = 23/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDTRTKQGLSSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y   T AF+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGTSAFISVQEGCDKFCTFCVVPYTRGAEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G    +K+ +L DLL+ + +I  +ER+R  
Sbjct: 183 VEQVYREALKVVSSGAKEIMLLGQNVNAYHGKGPADKIFSLADLLKHLAQIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P     D+++      KL P  HL +QSG +  LK MNR++  + Y DI+N LR+  
Sbjct: 243 TSHPIDMNNDLIKLYGTEPKLMPFLHLPVQSGSNKILKAMNRKHDREYYFDIINRLREAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  + 
Sbjct: 303 PDIVLSSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATRTDQIPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRN-YIKVNAKA 407
           K ER   L +     + AF    +G  + VLF+   +    +   T Y ++ YI+   K 
Sbjct: 363 KSERLTILQQELMAQQLAFNTSCVGSTMKVLFDRNGKFDDQIIGKTPYMQSVYIQNPNK- 421

Query: 408 DCNVSGKILNVKI-----NSFEGEV 427
             ++ GKI +VKI     NS  GE+
Sbjct: 422 --SLLGKISDVKITKASLNSLTGEI 444


>MIAB_BURPP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  208 bits (529), Expect = 8e-56
 Identities = 143/446 (32%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLGAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP  II V GC A Q     VS    VD+V G +    +   ++K R+ G+
Sbjct: 64  GRVRELKEANPNLIIGVGGCVASQEGAAIVSRAPYVDLVFGPQTLHRLPQMIDKRRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L     +  + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDISFPEIEK-FDHLPPARVDGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L EI  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEIAGLADQGVREVTLLGQNVNAYRAGLTLGSTEIADFAQLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEEDFDKMMALVHEMKYDTSFSFIYSPRPGTPAANLHDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA----D 408
           +R + L      N +  ++  +G++  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVQRISDSMVGKIERILVERPARKDPNELAGRTENNRVVNFPAPIASH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKI         GE+VL
Sbjct: 422 ARLIGQMVDVKIVKAYPHSLRGELVL 447


>MIAB_RHIME RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 472

 Score =  207 bits (528), Expect = 1e-55
 Identities = 134/432 (31%), Positives = 222/432 (51%), Gaps = 15/432 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M++   R+GY   D  E AD  ++NTC +     +K    +G
Sbjct: 23  KVFVKTYGCQMNVYDSDRMSDALSRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELG 82

Query: 62  RARR-------QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R        +  E +I V GC AQ    E+   +  VD+V+G +    +   + +AR 
Sbjct: 83  RLRELKKAKALEGREMLIGVAGCVAQAEGDEILRRVPAVDLVIGPQTYHRLPDALKRAR- 141

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVCS 170
            G++ V+    +++K       ++   + R   AFL +Q+GC++FC +C++PYTRGS  S
Sbjct: 142 AGQRIVETEYAIEDKFVHLPAPDKAKTRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVS 201

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVD--LDEKVTLVDLLEEIEKIDGIERVR 228
           +   +++ E   L E G +EI L G +  ++  +     + +L DLL  + +IDG+ R+R
Sbjct: 202 RPVAQIVAEAEKLVEGGVREITLLGQNVNAWHGEGPHGREWSLGDLLRRLGEIDGLARLR 261

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    + ++    ++ KL P+ HL +QSG D  LK MNRR+TA EY  +V  +R 
Sbjct: 262 YTTSHPRDMDDSLIEAHRSMAKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVERIRA 321

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D++++ D IVGFPG            ++ +  ++   FKYS R GT    ++ QV  
Sbjct: 322 AQPDLALSGDFIVGFPGETDQDFEDTLRLVEEVNYAQAFSFKYSTRPGTPGAELKEQVPE 381

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
           + K +R + L  L    ++ FAE  +G  ID+L E+   +  G   G +     VN  A 
Sbjct: 382 DVKAKRLEILQALLVKQQRGFAEACVGREIDLLLEKPGRM-PGQLVGRSPWLQPVNVDAK 440

Query: 409 CNVSGKILNVKI 420
            +  G I+ V+I
Sbjct: 441 ASQIGDIIRVRI 452


>MIAB_EHRCJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  207 bits (528), Expect = 1e-55
 Identities = 128/383 (33%), Positives = 197/383 (51%), Gaps = 7/383 (1%)

Query: 9   GCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR--Q 66
           GC++N Y+S  M       G+ VV     ADV ++NTC +     +K    +G+ R+  +
Sbjct: 10  GCQMNVYDSLIMENIIKPLGFTVVSEPSEADVVILNTCHIREKASEKLYSELGKIRKIQE 69

Query: 67  NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVL 125
           N +  I V GC AQ    E+      VD+V+G ++   +   + KA    KQ + +   +
Sbjct: 70  NKDLTIVVAGCVAQAEGEEIFERSPFVDIVVGPQSIHTLPELLVKAHRIKKQVINIDFPV 129

Query: 126 KNKVFEDLKIEEY--NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
            +K F+ + +EEY  N +T AF+ +Q+GCN+FC +C++PYTRG   S+  + + +E   L
Sbjct: 130 ISK-FDAIPVEEYTKNQETSAFISVQEGCNKFCTFCVVPYTRGEEYSRTVEAIFNEALVL 188

Query: 184 AEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           A+ G KEI L G +  +Y G     +  L  L++ I KI  IER+R  +  P    + + 
Sbjct: 189 ADSGIKEITLIGQNVNAYHGTYKGCEWDLGKLIQHIAKIPNIERIRYTTSHPRDMHQSLY 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                 +KL P  HL +QSG D  LK+MNR++TA+EY DI++ LR +  D++ ++D IVG
Sbjct: 249 EAHKLEEKLMPFVHLPVQSGSDRILKKMNRKHTAEEYIDIISHLRKQRPDIAFSSDFIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++++  S+ + FKYSPR GT      NQV    K           
Sbjct: 309 FPGETEEDFENTIKLVEKVKFSQAYSFKYSPRPGTPGAEYPNQVPEEIKSXXXXXXXXXX 368

Query: 363 RINEKAFAEKYIGEVIDVLFEEE 385
                AF    IGE   VLF  +
Sbjct: 369 XXXXXAFNRSMIGETCTVLFSSK 391


>MIAB_DESPS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  207 bits (528), Expect = 1e-55
 Identities = 125/393 (31%), Positives = 201/393 (51%), Gaps = 19/393 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE + +     GY        AD+ ++NTCS+    ++K    +G  RR 
Sbjct: 10  TYGCQMNLRDSEIIAQILNNNGYVETSEIGGADLVLLNTCSIRAKAEQKVMSKLGELRRN 69

Query: 67  ---NPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
              NP   I V GC AQ    ++   +  VD+V+G+    + +Y +N+  +  + +  + 
Sbjct: 70  KKINPRMQICVAGCVAQQEGKQIQAKMPHVDLVIGT----QYIYAINELLERSRTEGPIT 125

Query: 123 AV-LKNKV-----FEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           A  L +K        +   +E+  + R F+ I  GCN FC YC++PYTRG   S+  K +
Sbjct: 126 ATNLDDKYVIPQFIPETTGKEHEGEFRKFVTIMQGCNNFCTYCVVPYTRGREVSRSIKDI 185

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG-----VDLDEKVTLVDLLEEIEKIDGIERVRIGS 231
           ++EI  L + G KEI L G +  SY       + D   T  DLL ++  ++G++R+R  +
Sbjct: 186 VEEITVLVKSGIKEITLLGQNVNSYAQTNTVTEDDTPATFSDLLRQVAAVEGLKRLRFTT 245

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
            +P   + D+++    L  LCP FHL +Q+G +  LK M R+YT + Y D+V  LR+   
Sbjct: 246 SNPKDLSNDLMQCFKDLDVLCPQFHLPVQAGSNKVLKEMGRKYTVESYLDLVTQLRENCP 305

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           +++ITTD+IVGFPG            L+ +    +  FKYS R GT+A  + N+VD + K
Sbjct: 306 EIAITTDIIVGFPGETDEEFEETMKMLETVRYHGSFSFKYSDRPGTKANELTNKVDESVK 365

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEE 384
             R  +             ++YIG   +VL EE
Sbjct: 366 SARLARFQARQDEIGLERNQEYIGTTQEVLIEE 398


>MIAB_DECAR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  207 bits (527), Expect = 1e-55
 Identities = 142/444 (31%), Positives = 217/444 (48%), Gaps = 16/444 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     EG    D  E AD+ + NTCSV     +K    +
Sbjct: 4   KLFIRTFGCQMNEYDSDKMADVLNASEGVIKTDNPEEADIILFNTCSVREKAQEKVFHDL 63

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R   + NP  +I V GC A Q     ++    VDVV G +    +   + + + +GK
Sbjct: 64  GRVRHLKKLNPNLVIGVGGCVASQEGDAIIARAPYVDVVFGPQTLHRLPQLIAERKAKGK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V V      K F+ +   E    + AF+ I +GC++FC +C++PYTRG   S+    V
Sbjct: 124 AAVDVSFPEIEK-FDAMPPSEIKGAS-AFVSIMEGCSKFCTFCIVPYTRGGEVSRPFNDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD---EKVTLVDLLEEIEKIDGIERVRIGSID 233
           L E+  LA HG  E+ L G +  +Y  D++   EK  L  L+E I ++ GIER+R  +  
Sbjct: 182 LTEVADLAAHGVGEVTLLGQNVNAYRGDMEGTEEKADLALLIEYIAEVPGIERIRYTTSH 241

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P   T+ +    + + KL  H HL +Q+G D  L  M R YT  EY+ I+  LR    D+
Sbjct: 242 PREMTQSLFDTYVKVPKLVSHLHLPVQAGSDRVLAAMKRGYTTLEYKSIIRKLRAARPDI 301

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D IVGFPG            +  +    +  F YSPR GT A  ++   D    D 
Sbjct: 302 SLSSDFIVGFPGETDEDFEKTMKLIDDVGFDSSFSFIYSPRPGTPALELD---DSTPADV 358

Query: 354 RSKKLIEL-NRINE--KAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN 410
           +S +L+ L  RI+E  +A ++  +G +  VL E   +       G T N   VN   +  
Sbjct: 359 KSARLLRLQKRIDEQAQAISQTMVGSIQRVLVEGTSKKDVHELAGRTDNNRIVNFSGNPR 418

Query: 411 VSGKILNVKINSFEGEVAEGEIVL 434
           +    ++V+I S       GEIV+
Sbjct: 419 LINTFVDVRITSSLSHTLRGEIVI 442


>MIAB_BUCBP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  207 bits (527), Expect = 1e-55
 Identities = 135/438 (30%), Positives = 222/438 (50%), Gaps = 13/438 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  +T+   ++ GYE     ++A+V ++NTCS+     +K    +
Sbjct: 5   KIYIKTWGCQMNEYDSALITQILKQKHGYENTKDPKLANVLILNTCSIREKAQEKVFHQL 64

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +++NP  IIAV GC A Q           VD++ G++     ++Y+     E K
Sbjct: 65  GRWKKLKQKNPNLIIAVGGCVATQEGKNIYKRANYVDIIFGTQT----LHYLPNMIQEVK 120

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTR--AFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
           +  K    +   + E     EY  K +  AF+ I +GCN+FC++C++PYTRG   S+   
Sbjct: 121 KNKKSVTNIDFPLTEKFNFIEYPRKPKVTAFVSIMEGCNKFCSFCIVPYTRGHEISRPVD 180

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSI 232
            +L EI +L+  G KEI L G +  SY G   +  +    +LL  +  IDGI+R+R  + 
Sbjct: 181 DILLEISTLSSRGVKEIHLLGQNVNSYKGKTFNGDICKFSNLLRLVASIDGIDRIRFTTS 240

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
           +P  FT+D++     + K+    HL +QSG +  L+ M R +T  EY+ I+N +     +
Sbjct: 241 NPFEFTDDIIEIYAEIPKIVSFLHLPVQSGSNRILQLMKRMHTIDEYKTIINKILKLRPN 300

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           + I++D I+GFPG            +K + +  ++ F YSPR GT A  +++ V   +K 
Sbjct: 301 IQISSDFIIGFPGETLIDFEQTLQLIKDLNIDMSYSFIYSPRPGTPASELQDNVTLCEKQ 360

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           +R   L  L R N   + +K +G +  VL E   +       G T N   VN K + N+ 
Sbjct: 361 KRLHILQTLIRNNTTMWNQKMLGSIQSVLVEGRSQKNPKELFGRTENNRIVNFKGNQNMI 420

Query: 413 GKILNVKINSFEGEVAEG 430
           G+ +N+KI         G
Sbjct: 421 GEFINLKITKINPNSLRG 438


>MIAB_BURXL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  207 bits (526), Expect = 2e-55
 Identities = 142/446 (31%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLGAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP  II V GC A Q   + V+    VD+V G +    +   ++K R+ G+
Sbjct: 64  GRVRELKEANPNLIIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDKRRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L     +  + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDISFPEIEK-FDHLPPARVDGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L EI  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEIAGLADQGVREVTLLGQNVNAYRAGLTLGSTEIADFAQLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDLIVGFPGETEEDFDKMMTLVHEMKYDTSFSFIYSPRPGTPAANLHDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA----D 408
            R + L      N +  ++  +G++  +L E           G T N   VN  A     
Sbjct: 362 RRLQHLQATIEENVQRISDSMVGKIERILVERPARKDPNELAGRTENNRVVNFPAPVASH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKI         GE+VL
Sbjct: 422 ARLIGQMVDVKIVKAYPHSLRGELVL 447


>MIAB_RICAH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  206 bits (525), Expect = 2e-55
 Identities = 149/444 (33%), Positives = 241/444 (54%), Gaps = 31/444 (6%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+S  M +     GYE  +  E ADV ++NTC +     +K+   +GR ++ 
Sbjct: 9   TYGCQMNVYDSVKMQDLLYPFGYEPTENIEEADVIILNTCHIREKAAEKTYSELGRIKKL 68

Query: 67  NP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
                      AII V GC AQ    E+ +    VD+V+G ++   +   ++K     K 
Sbjct: 69  QDTRKKQGLNSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKIVRHAKH 128

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +  V + K F++L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S++ ++V 
Sbjct: 129 LIDLDFVEEAK-FDNLPEQLYPQGASSFISVQEGCDKFCTFCVVPYTRGAEFSRNVEQVY 187

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGV--DLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
            E   +   G KEI+L G +  +Y      D+  +L DLL+ + +I  +ER+R  +  P 
Sbjct: 188 REALQVVSGGAKEIMLLGQNVNAYNWKGSADKIFSLADLLKHLAQIPNLERLRYMTSHPI 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
             T+D+++      KL P  HL +QSG +  LK MNR++  + Y DI+N LR+   D+ +
Sbjct: 248 DMTDDLIQLHGTEPKLMPFLHLPVQSGSNKILKAMNRKHDREYYFDIINRLREARPDIVL 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  + K ER 
Sbjct: 308 SSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATRTDQIPEHIKSERL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFE-----EEVELGSGVY--TGYTRNYIKVNAKAD 408
             L +     + A  E  +G  I VLF+     ++  +G  +Y  + Y +N  K      
Sbjct: 368 TILQKELMDQQLACNESCVGSTIKVLFDRSGKFDDQIIGKTIYMQSVYIQNPNK------ 421

Query: 409 CNVSGKILNVKI-----NSFEGEV 427
            ++ GKI++VKI     NS  GE+
Sbjct: 422 -SLLGKIIDVKITKASLNSLTGEI 444


>MIAB_ROSDO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  206 bits (524), Expect = 3e-55
 Identities = 129/390 (33%), Positives = 201/390 (51%), Gaps = 10/390 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M+E  V EGY      E AD+ ++NTC +     +K    +G
Sbjct: 6   KLFIKTYGCQMNVYDSERMSEALVAEGYVETKTAEDADMILLNTCHIREKAAEKVYSELG 65

Query: 62  RARR---QNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R +     NP+  + V GC AQ    E+   +  VD+V+G ++   +     + R EG +
Sbjct: 66  RLKSLKADNPDLKLGVAGCVAQAEGEEIMRRQPAVDLVVGPQSYHRLPQMEARLR-EGHK 124

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            +      ++K  E            AFL +Q+GC++FCA+C++PYTRG+  S+   +VL
Sbjct: 125 ALDTDFPPEDKFEELXXXXXXXXXXSAFLTVQEGCDKFCAFCVVPYTRGAEVSRPVTRVL 184

Query: 178 DEIRSLAEHGFKEIILSGIHTASY---GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           DE R L E G +EI L G +  +Y   G D +EK TL  L+  +  IDG+ER+R  +  P
Sbjct: 185 DEARDLVERGVREITLLGQNVNAYHGAGADGNEK-TLAQLIWALNDIDGLERIRFTTSHP 243

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
               +D++       KL P+ HL +QSG D  LKRMNR++TA  Y  ++  +R    D+ 
Sbjct: 244 NDMQDDLIEAHRDCPKLMPYLHLPVQSGSDRILKRMNRKHTADSYLRLIERIRVGRPDIL 303

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           ++ D IVGFP             ++ +     + FKYS R GT A     QVD  + DER
Sbjct: 304 LSGDFIVGFPEETEADFQATLDLIEAVNYGYAYSFKYSTRPGTPAAE-RAQVDPVEADER 362

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEE 384
            +++  L    ++   +  +G  + VL E+
Sbjct: 363 LQRIQALITRQQQDIQQSMVGRDVSVLIEK 392


>MIAB_RICCK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  206 bits (524), Expect = 3e-55
 Identities = 146/444 (32%), Positives = 238/444 (53%), Gaps = 16/444 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  + ADV ++NTC +     +K    +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKMQDLLYPFGYESTENIKEADVIILNTCHIREKAAEKIYSELG 63

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQDTRKKHGLSSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y     AF+ +Q+GC++FC +C++PYTRG   S++
Sbjct: 124 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGASAFISVQEGCDKFCTFCVVPYTRGVEFSRN 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +  +G +EI+L G +  +Y G  +D+K+ +L DL+  + +I  +ER+R  
Sbjct: 183 VEQVYREALKVVSNGAREIMLLGQNVNAYHGKGVDDKIFSLADLIRYLAQIPNLERLRYT 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+D+++      KL P  HL +QSG +  LK MNR++  + Y +I+N LR+  
Sbjct: 243 TSHPIDMTDDLIKLHSIESKLMPFVHLPVQSGSNKILKAMNRKHDREYYFNIINRLREAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            +++I   + + FKYSPR GT      +Q+  + 
Sbjct: 303 PDIVLSSDFIVGFPGXXXXXXXXXXXXVRKIKYGQCYSFKYSPRPGTPGATRTDQIPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K ER   L +     + AF E  +G  + VLF+   +    +   T Y ++    N   D
Sbjct: 363 KSERLTILQKELSSQQLAFNESCVGSTMKVLFDRSGKFDGQIIGKTPYMQSVYINNTNQD 422

Query: 409 CNVSGKILNVKINSFEGEVAEGEI 432
             +  KI++VKI         GEI
Sbjct: 423 --LLCKIIDVKITKATSNSLTGEI 444


>MIAB_FERNB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 430

 Score =  206 bits (524), Expect = 3e-55
 Identities = 133/433 (30%), Positives = 225/433 (51%), Gaps = 9/433 (2%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T GC++N  +SE + +    EG E+ D    ADV ++NTC+V    ++K     
Sbjct: 1   MKVHIFTYGCQMNENDSEIVKQLLKDEGIELTDDENDADVVILNTCAVRKKSEEKVYS-- 58

Query: 61  GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
                         +GC A+     +    GV  V+G+R   ++   V  A++ G +Q+ 
Sbjct: 59  HXXXXXXXXXXXXXMGCVAEKEKENLFK-RGVSFVIGTRALTKVPDAVLNAKN-GNKQIY 116

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +   L     E  K+E  ++   A++ I  GC+RFC YC++PYTRG   S+   +VL E+
Sbjct: 117 LEDTLDE--IEYHKVETRSSNHHAWVTIIHGCDRFCTYCIVPYTRGREKSRPIDEVLKEV 174

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
            SL++ G+KE    G +  +YG DL +  +L  LL+   +ID ++R+   +  PT F+ +
Sbjct: 175 ESLSQRGYKEFTFLGQNVDAYGKDLRDGTSLAKLLKLASQIDNVKRLWFLTSYPTDFSLE 234

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           + + +L  +K+    HL +Q G D  LK MNRRYT +EY D++N +R  + D SI++D+I
Sbjct: 235 IPKVMLESEKVARSIHLPVQHGSDKILKAMNRRYTRQEYIDLINEIRKIVPDASISSDII 294

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGNKKDERSKKLI 359
           VGFPG            +K +   + ++  YSPR+GT A + +++ V    K  R   L+
Sbjct: 295 VGFPGENDEDFEATVELVKLLKFERLNLAVYSPREGTVAWKYLKDDVPYQVKVRRMSYLL 354

Query: 360 ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
            L +   K   + Y+G+ ++V+ E + +  +G++ G       ++ +A+    GK + VK
Sbjct: 355 NLQKTINKELNKSYLGKEVEVIVEAQAK--NGLFYGRDIRNKIISFEANPESIGKNVIVK 412

Query: 420 INSFEGEVAEGEI 432
           +N        GEI
Sbjct: 413 VNKISAGPLYGEI 425


>MIAB_SALTO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 499

 Score =  206 bits (523), Expect = 4e-55
 Identities = 137/434 (31%), Positives = 214/434 (49%), Gaps = 21/434 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY-EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR 65
           T GC++N ++SE +     + GY      ++  DV V NTC+V    D +    +G+ R 
Sbjct: 16  TYGCQMNVHDSERIAGLLEQAGYLRAGAADDTPDVVVFNTCAVRENADNRLYGNLGQLRP 75

Query: 66  ---QNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKV 121
              Q+PE  IAV GC AQ   +E V     VDVV G+ N G +   + +AR     +V++
Sbjct: 76  RKDQHPEMQIAVGGCLAQKDRSEIVRRAPWVDVVFGTHNIGSLPVLLERARHNAAAEVEI 135

Query: 122 GAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
              L+  VF         +    ++ I  GCN  C +C++P  RG    + P ++L E+R
Sbjct: 136 LESLE--VFPSTLPTRRESTYAGWVSISVGCNNTCTFCIVPALRGKEKDRRPGEILSEVR 193

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           SL + G  E+ L G +  SYG++  ++     LL     IDG+ERVR  S  P  FT+DV
Sbjct: 194 SLVDEGVLEVTLLGQNVNSYGIEFGDRYAFGKLLRACGDIDGLERVRFTSPHPKDFTDDV 253

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +  +     +CP  H+ LQSG D  L+ M R Y ++ Y  I+  +R  + D +ITTD+IV
Sbjct: 254 IAAMAETPNVCPSLHMPLQSGSDDMLRAMRRSYRSERYLGIIEKVRAAMPDAAITTDIIV 313

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++    S    F+YS R GT A  M +Q+      ER ++LI+ 
Sbjct: 314 GFPGETEADFERTLDVVRAARFSSAFTFQYSKRPGTPAATMADQLPKAVVQERYERLIDC 373

Query: 362 NRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
             + E  +AE  + +G+ ++VL    V +G G      R   +    +     G++++  
Sbjct: 374 --VEEITWAENRRLLGKTVEVL----VAVGEG------RKDERTGRLSGRARDGRLVHFD 421

Query: 420 INSFEGEVAEGEIV 433
             S  G+V  G+IV
Sbjct: 422 AGSLAGQVRPGDIV 435


>MIAB_BRASB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 466

 Score =  206 bits (523), Expect = 4e-55
 Identities = 137/443 (30%), Positives = 220/443 (49%), Gaps = 15/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+        AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDTLGAEGFVETAEAGDADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E V+    VDVV+G ++   +   + +A  
Sbjct: 66  RLRVAKEEAARQGRAMQIAVAGCVAQAEGAEIVTRAPTVDVVVGPQSYHHLPELLARA-G 124

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVCS 170
            G+  ++     ++K     +      + R   AF+ +Q+GC++FC +C++PYTRGS  S
Sbjct: 125 RGEPAIETEFPAEDKFGFLARPSREAIRARGVSAFVTVQEGCDKFCTFCVVPYTRGSEMS 184

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT--LVDLLEEIEKIDGIERVR 228
           +   ++LDE+  L E+G +EI L G +  +Y  +  +  T  L  LL  I +I G+ R+R
Sbjct: 185 RPVARILDEVTRLTENGVREITLIGQNVNAYHGEAPDGSTWTLGRLLYGIAEIPGVARIR 244

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    + ++     L  + P  HL +QSG D  L  MNR++ A +Y  +V+  R 
Sbjct: 245 YSTSHPNDVDDSLIAAHRDLASVMPFVHLPVQSGSDRILGLMNRKHGASDYRKVVDRFRA 304

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M+  V  
Sbjct: 305 ARPDIAFSSDFIVGFPGETEEDFRATLALIAQIGYAAAYSFKYSPRPGTPAADMQEMVSA 364

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
            + DER ++L  L    + AF +  IG V+DVLFE       G   G T      +  A 
Sbjct: 365 TEMDERLERLQSLIDSQQAAFNKAAIGTVVDVLFERAAR-KPGQLVGRTAYLQPAHVMAP 423

Query: 409 CNVSGKILNVKINSFEGEVAEGE 431
            N+ G++L V+I+S E     GE
Sbjct: 424 DNIIGQVLPVRIDSLERYSLLGE 446


>MIAB_SINMW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 472

 Score =  205 bits (522), Expect = 5e-55
 Identities = 135/432 (31%), Positives = 219/432 (50%), Gaps = 15/432 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M++   R+GY   D  E AD  ++NTC +     +K    +G
Sbjct: 23  KVFVKTYGCQMNVYDSDRMSDALSRDGYVATDVLEEADFVLLNTCHIREKAAEKVYSELG 82

Query: 62  RAR-------RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R       R+  E +I V GC AQ    E+      VD+V+G +    +   + +AR 
Sbjct: 83  RLRDLKKAKAREGREMLIGVAGCVAQAEGKEILRRAPAVDLVIGPQTYHRLPEALRRART 142

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVCS 170
            G++ V+    +++K       ++   + R   AFL +Q+GC++FC +C++PYTRGS  S
Sbjct: 143 -GERIVETDYAIEDKFVHLPAPDKAKTRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVS 201

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIERVR 228
           +   +++ E   L E G +EI L G +  ++        +  L DLL  + +I+G+ R+R
Sbjct: 202 RPVAQIVAEAEKLVEGGVREITLLGQNVNAWHGAGPHGREWGLGDLLRRLGEIEGLARLR 261

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    + ++    ++ KL P+ HL +QSG D  LK MNRR+TA EY  +V  +R 
Sbjct: 262 YTTSHPRDMDDSLIEAHRSMAKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVARIRA 321

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D++++ D IVGFPG            +  +  ++   FKYS R GT    +E QV  
Sbjct: 322 VQPDLALSGDFIVGFPGETDEDFEDTLRLVDAVNYAQAFSFKYSTRPGTPGAELEQQVPE 381

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
           + K +R + L  L    ++ FAE  +G  ID+L E+   +  G   G +     VN  A 
Sbjct: 382 DVKAKRLEILQALLIKQQRGFAEACVGREIDLLLEKPGRM-PGQLVGRSPWLQPVNVDAK 440

Query: 409 CNVSGKILNVKI 420
            +  G I+ V+I
Sbjct: 441 ASQIGDIIRVRI 452


>MIAB_PROMS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  204 bits (520), Expect = 9e-55
 Identities = 135/444 (30%), Positives = 216/444 (48%), Gaps = 20/444 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M     + GY   D    AD+ + NTC++ +  ++K    +GR    
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYTRADNELNADLVLYNTCTIRDNAEQKVYSFLGRQAKR 84

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P   + V GC AQ    + +  +  +D+V+G ++   +   + K  D G Q   V 
Sbjct: 85  KHKTPSLKLVVAGCLAQQEGESLLRRVPELDLVMGPQHVNNLENLLGKV-DLGNQ---VA 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +N + ED+      +    ++ I  GCN  C+YC++P  RG   S+ P  +  EI+ 
Sbjct: 141 ATEENFISEDITSARRESSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPNAIKSEIQK 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA   FKEI L G +  +YG DL        ++ TL DLL  I  + GI R+R  +  P 
Sbjct: 201 LAGDNFKEITLLGQNIDAYGRDLPGTTKEGRKENTLTDLLYYIHDVKGIRRIRFATSHPR 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F++ +++    L K+C HFH+  QSG D  LK+M+R YT K+Y++I+  +R  + D SI
Sbjct: 261 YFSKRLIQACYELDKVCEHFHIPFQSGNDEILKQMSRGYTIKKYKNIIENIRSLMPDASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  I   + +   YSPR  T A    NQ+    K  R 
Sbjct: 321 TADAIVAFPGETEKQYQDTLKLITEIGFDQVNTAAYSPRPNTPAAVWSNQLSEEVKKARL 380

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           +++ +L     ++  ++YI  +  VL E      S    G TR     ++++    D N 
Sbjct: 381 QEINDLVEKTARSRNKRYINNIESVLIEGLNPKNSSQIMGRTRTNRLTFVEIPKNIDFNF 440

Query: 412 S-GKILNVKINSFEGEVAEGEIVL 434
           S G  ++V+IN        GE+ L
Sbjct: 441 SLGDEIDVRINETRPFSLTGELYL 464


>MIAB_COPPD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 426

 Score =  204 bits (520), Expect = 9e-55
 Identities = 136/435 (31%), Positives = 222/435 (51%), Gaps = 16/435 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MK    T GC++N  +SE ++      G+E       +D+ V+NTCSV    ++++   I
Sbjct: 1   MKYYIFTYGCQMNKNDSEMVSGILKSSGWEEAKNVVDSDLVVINTCSVRLHAEERAIGTI 60

Query: 61  GRARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             +           +GC +++   E+ S    V  VLG   +  I+  +N     G++++
Sbjct: 61  --SAXXXXXXXXXXMGCMSEVRGNEIMSRFPHVQAVLGPSYEAHILDVLN-----GERRI 113

Query: 120 KVGAVLKNKV-FEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
            VG     KV FE         K   ++ I  GC+ FC YC++P+TRG V S+DP+ +L+
Sbjct: 114 LVG---DEKVDFEKYSSANRKEKHSVYVSIMKGCDDFCTYCIVPFTRGRVQSRDPESILE 170

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           E+R   ++G  EI L G +   YG DL      V L+E +  IDG+ R+R  S  P  F 
Sbjct: 171 EVRVCVDNGAVEITLLGQNVNDYGKDLSGW-DFVSLVERVATIDGVRRIRFMSPHPANFK 229

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           +D + R+  L ++ P++HL LQSG D  L+RMNR+YT  E+ ++V  +R+ + +V+I TD
Sbjct: 230 KDDITRLANLPQVAPYYHLPLQSGDDEILRRMNRKYTTGEFAELVGFIRESVPNVAIGTD 289

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQ-VDGNKKDERSKK 357
           +IVGFPG            L+++     ++  YSPR GT A   E   V       R  +
Sbjct: 290 LIVGFPGESDEHFQNTFKFLEKMQFDVVYMAIYSPRPGTAAARQETSFVPAEVAKARYDE 349

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS-GKIL 416
           L+ L      +  ++Y+G + +VL + E +  +G + G T     V   +  +VS G+ +
Sbjct: 350 LLRLQEKISYSINQRYVGTLQEVLIDRE-DKTTGKFIGRTPTNKTVVFTSIRHVSPGEFV 408

Query: 417 NVKINSFEGEVAEGE 431
           +V+IN  +  V  GE
Sbjct: 409 DVRINEAKSWVLYGE 423


>MIAB_THEFY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 494

 Score =  204 bits (519), Expect = 1e-54
 Identities = 129/383 (33%), Positives = 197/383 (51%), Gaps = 8/383 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N ++SE ++      GY+        DV V NTC+V    D +    +G+ R  
Sbjct: 11  TYGCQMNVHDSERLSGLLEAAGYQRAAEGTTPDVVVFNTCAVRENADNRLYGNLGQLRPV 70

Query: 66  --QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
              NP+  IAV GC AQ    E+      VDVV G+ N G +   + +AR + + QV++ 
Sbjct: 71  KDANPDMQIAVGGCLAQKDRGEIIRRAPWVDVVFGTHNIGSLPALLERARVQREAQVEIV 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L EIR+
Sbjct: 131 ESLER--FPSTLPTRRESVYAAWVAISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIRA 188

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           +   G  E+ L G +  +YG +  ++     LL    +I+G+ERVR  S  P  FT+DV+
Sbjct: 189 VVAEGAIEVTLLGQNVNAYGSEFGDRQAFSKLLRACGEIEGLERVRFTSPHPRDFTDDVI 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  L+ M R Y A+ +  IV  +R+ I D +ITTDVIVG
Sbjct: 249 AAMAETPNVMPQLHMPLQSGSDRILRAMRRSYRAERFLRIVEKVREAIPDAAITTDVIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL- 361
           FPG            ++ +  +    F+YS R GT A +M+NQV      ER ++L+EL 
Sbjct: 309 FPGETEEDFAETLRVMEEVRFAHAFTFQYSKRPGTPAASMDNQVPREVVKERYQRLLELQ 368

Query: 362 NRINEKAFAEKYIGEVIDVLFEE 384
            RI+E+  A K++G  ++VL  E
Sbjct: 369 ERISEEENA-KFVGREVEVLVAE 390


>MIAB_RHOP5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 465

 Score =  204 bits (519), Expect = 1e-54
 Identities = 133/445 (29%), Positives = 223/445 (50%), Gaps = 15/445 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSFGCQMNVYDAQRMVDALAPEGFVETQSADDADLVILNTCHIREKAAEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARD 113
           + R    +A        IAV GC AQ    E+   +  VDVV+G ++   +   + KAR 
Sbjct: 66  KLRLLKQDAASHGRRFEIAVAGCVAQAEGAEIIRRQPAVDVVVGPQSYHHLPELLEKARR 125

Query: 114 EGKQ-QVKVGAVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
           +G+  + +     K  V    + +    +   AF+ +Q+GC++FC++C++PYTRG+  S+
Sbjct: 126 DGRALETEFPIEDKFGVLPPPRPDAIRARGVSAFVTVQEGCDKFCSFCVVPYTRGAEMSR 185

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY---GVDLDEKVTLVDLLEEIEKIDGIERVR 228
              K+LD+++ L ++G +EI L G +  +Y   G D D   TL  LL  +  + G+ R+R
Sbjct: 186 PVAKILDDVKRLIDNGVREITLIGQNVNAYHGEGPD-DRPWTLGALLRHLASVPGVARLR 244

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    ++++     L  L P  HL +QSG DA L  MNRR++A +Y  +++  R 
Sbjct: 245 YSTSHPLDVDDELIAAHRELPGLMPFVHLPVQSGSDAILAAMNRRHSADDYRRVIDRFRQ 304

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
               ++ ++D IVGFPG            + +I  +  + FKYSPR GT A  ++  V  
Sbjct: 305 ADPSIAFSSDFIVGFPGETDRDFEATLALVTQIGYAGAYSFKYSPRPGTPAAELQEMVAP 364

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
              D+R ++L  L    + AF    IG  +DVLFE       G   G T      +  A 
Sbjct: 365 AVMDQRLEQLQGLIDSQQAAFNRASIGTTVDVLFERAAR-HPGQIVGRTAYLQPAHVMAA 423

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
            ++ G++L V I+S E     GE+V
Sbjct: 424 DDIVGQVLPVTIHSLERYSLIGELV 448


>MIAB_PROMM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  204 bits (519), Expect = 1e-54
 Identities = 138/432 (31%), Positives = 207/432 (47%), Gaps = 20/432 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY        AD+ + NTC++ +  ++K    +GR    
Sbjct: 35  TFGCQMNKADSERMAGILEAMGYHEAPAELEADLVLYNTCTIRDNAEQKVYSYLGRQARR 94

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R +P   + V GC AQ      +  I  +D+V+G ++   +   + +  D G+Q V   
Sbjct: 95  KRTHPHLKLVVAGCVAQQEGEALLRRIPELDLVMGPQHANRLEALLTQV-DNGQQVV--- 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A   N + EDL     ++   A++ +  GCN  C YC++P  RG   S+ P+ +  EI  
Sbjct: 151 ATDDNHILEDLTTARRDSTICAWVNVIYGCNERCTYCVVPSVRGKEQSRSPEAIRLEIEG 210

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA  GF+EI L G +  +YG DL         + TL DLL  I  ++GIER+R  +  P 
Sbjct: 211 LAARGFREITLLGQNIDAYGRDLPGITPEGRRQNTLTDLLHHIHDVEGIERIRFATSHPR 270

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG +  LK M R YT + Y  IVN +R+ + D +I
Sbjct: 271 YFTERLIEACFDLPKVCEHFHIPFQSGDNDVLKAMARGYTVERYRRIVNRIRELMPDAAI 330

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TDVIV FPG            L+ +   + +   YSPR  T A    NQ+    K ER 
Sbjct: 331 STDVIVAFPGETDAQFQNTLNLLEEVGFDQVNTAAYSPRPNTPAATWSNQLPEAVKVERL 390

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           K+L  L          +Y G+V  VL E           G TR     +        C  
Sbjct: 391 KQLNALVERIALQRNSRYSGKVEQVLAEGINPKKPQQLMGRTRTNRLTFFATEGPQGCRY 450

Query: 412 S-GKILNVKINS 422
           S G +++++INS
Sbjct: 451 SPGDLVDIQINS 462


>MIAB_PARL1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  204 bits (519), Expect = 1e-54
 Identities = 131/396 (33%), Positives = 200/396 (50%), Gaps = 15/396 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GY  VD  E AD+ ++NTC +     +K    +G
Sbjct: 16  KIFVKTYGCQMNVYDSARMVDVMAPSGYTEVDAPEDADIVILNTCHIREKAAEKVYSELG 75

Query: 62  RARR-------QNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARD 113
           R R        +  E +I V GC AQ    E+      VD+VLG +    +  YV +  +
Sbjct: 76  RLRELKKEKSGRGEELLIGVAGCVAQAEGEEMRRRAPVVDLVLGPQTYHRLPEYVARLAN 135

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNK----TRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G   V+    + +K F  L + E          AFL IQ+GC++FC +C++PYTRGS  
Sbjct: 136 GGPGIVETEFPVDDK-FASLPMAEKRKTLARGATAFLTIQEGCDKFCTFCVVPYTRGSEF 194

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHT-ASYGVD-LDEKVTLVDLLEEIEKIDGIERV 227
           S+   ++LDE RSL + G +EI L G +  A +G D      TL  L+  + +I+G+ R+
Sbjct: 195 SRPVARILDEARSLVDAGVREITLLGQNVNAWHGEDQAGRPATLGYLIRALAEIEGLARL 254

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    E+++     +  L P+ HL +QSG D  L  MNRR+ A  Y  I+  +R
Sbjct: 255 RYTTSHPRDMDEELIAAHRDVPALMPYLHLPVQSGSDRILAAMNRRHDADSYHRIIGRIR 314

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
               D+++++D IVGFPG            ++ +  ++ + FKYSPR GT A   E+QV 
Sbjct: 315 AAKPDIALSSDFIVGFPGETEADFEATLDLIRTVGFAQAYSFKYSPRPGTPAATEEDQVP 374

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFE 383
              K ER ++L  L    + AF     G  + VLF+
Sbjct: 375 EEVKSERLQRLQALLGEQQLAFNAGCAGRTMPVLFD 410


>MIAB_EHRCR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  204 bits (519), Expect = 1e-54
 Identities = 122/383 (31%), Positives = 200/383 (52%), Gaps = 7/383 (1%)

Query: 9   GCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR--Q 66
           GC++N Y+S  M       G+ VV+    A++ ++NTC +     +K    +G+ R+  +
Sbjct: 10  GCQMNVYDSLIMENIIKPLGFTVVNEPSEANIVILNTCHIREKASEKLYSELGKMRKIQE 69

Query: 67  NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVL 125
             +  I V GC AQ    ++ +    VD+V+G ++   +   + KAR   KQ + +   +
Sbjct: 70  TKDLTIVVAGCVAQAEGEQIFARAPFVDIVVGPQSIHTLPELIIKARRMKKQVINIDFPI 129

Query: 126 KNKVFEDLKIEEY--NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
            +K F+ + +EEY  N +  AF+ +Q+GCN+FC +C++PYTRG   S+  + + +E   L
Sbjct: 130 ISK-FDAIPVEEYTKNQEVSAFISVQEGCNKFCTFCVVPYTRGEEYSRTVEAIFNEALVL 188

Query: 184 AEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           ++ G KEI L G +  +Y G     +  L  L++ + KI  IER+R  +  P    + + 
Sbjct: 189 SDSGVKEITLIGQNVNAYHGTYKGCEWDLGKLIQYLAKIPNIERIRYTTSHPRDMHQSLY 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
               +  KL P  HL +QSG D  LK+MNR++TA+EY DI+N LR +  D++ ++D IVG
Sbjct: 249 EAHRSETKLMPFVHLPIQSGSDRILKKMNRKHTAEEYIDIINNLRKQRPDIAFSSDFIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++ +  S+ + FKYSPR GT +    NQ+    K +R        
Sbjct: 309 FPGETEEDFEHTMKLVQEVNFSQAYSFKYSPRPGTPSAEYPNQIPEEIKSQRIFXXXXXX 368

Query: 363 RINEKAFAEKYIGEVIDVLFEEE 385
                AF    IG+   VLF  +
Sbjct: 369 XXXXXAFNRNMIGQTCSVLFNNK 391


>MIAB_BURS3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  204 bits (519), Expect = 1e-54
 Identities = 141/446 (31%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL----DEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALAAGSSEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVNHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +    + K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMSYDTSFSFIYSPRPGTPAANLHDDTPRDVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BACSU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  204 bits (519), Expect = 1e-54
 Identities = 132/440 (30%), Positives = 220/440 (50%), Gaps = 12/440 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  +  + A+V ++NTC++    + K    +G
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFMALGYEATNSVDDANVILLNTCAIRENAENKVFGELG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   + NP+ I+ V GC +Q   +    +     VD++ G+ N   +   +++A    
Sbjct: 127 HLKALKKNNPDLILGVCGCMSQEESVVNRILKKHPFVDMIFGTHNIHRLPELLSEAYLSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V+V +  +  V E+L  +  N K + ++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 EMVVEVWSK-EGDVIENLP-KVRNGKIKGWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +YG D ++    L DL++E+ KID I R+R  +  P
Sbjct: 245 IIQEVRRLASEGYKEITLLGQNVNAYGKDFEDMTYGLGDLMDELRKID-IPRIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y  + Y ++V  +++ + + S
Sbjct: 304 RDFDDRLIEVLAKGGNLLDHIHLPVQSGSSEVLKLMARKYDRERYMELVRKIKEAMPNAS 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +     + F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAAKMKDNVPMRVKKER 423

Query: 355 SKKLIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
            ++L  L N I+ K                   +    +  GYT     VN K      G
Sbjct: 424 LQRLNALVNEISAKKMXXXXXXXXXXXXXXXS-KNNPDILAGYTEKSKLVNFKGPKEAIG 482

Query: 414 KILNVKINSFEGEVAEGEIV 433
           KI+ VKI   +    +GE+V
Sbjct: 483 KIVRVKIQQAKTWSLDGEMV 502


>MIAB_BACLD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 509

 Score =  204 bits (519), Expect = 1e-54
 Identities = 132/440 (30%), Positives = 223/440 (50%), Gaps = 12/440 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N +++E M   F+  GYE  D  E A+V ++NTC++    + K    IG
Sbjct: 67  KFYIRTYGCQMNEHDTEVMAGIFMALGYEPTDSTEDANVILLNTCAIRENAENKVFGEIG 126

Query: 62  RAR---RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
             +   + NP+ I+ V GC +Q   +    +     VD++ G+ N   +   +++A    
Sbjct: 127 HLKALKKDNPDLILGVCGCMSQEESVVNRILKKHPFVDLIFGTHNIHRLPELLSEAYLSK 186

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  ++V +  +  V E+L  +    K + ++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 187 EMVIEVWSK-EGDVIENLP-KVRTGKIKGWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 244

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +YG D ++ +  L  L++E+ KID I R+R  +  P
Sbjct: 245 IIQEVRRLAAEGYKEITLLGQNVNAYGKDFEDMEYGLGHLMDELRKID-IPRIRFTTSHP 303

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +QSG    LK M R+Y  + Y ++V  ++  + + S
Sbjct: 304 RDFDDHLIEVLAKGGNLLDHIHLPVQSGSSDVLKLMARKYDRERYLELVAKIKKAMPNAS 363

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +TTD+IVGFP              + +     + F YSPR+GT A  M++ V    K ER
Sbjct: 364 LTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAAKMKDNVPMRVKKER 423

Query: 355 SKKLIE-LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
            ++L E +N I+ K   +               +    +  GYTR    VN K      G
Sbjct: 424 LQRLNEVVNEISAKKM-KXXXXXXXXXXXXXXSKNNPDILAGYTRKNKLVNFKGPKEAIG 482

Query: 414 KILNVKINSFEGEVAEGEIV 433
           +++NVKI+  +    +GE+V
Sbjct: 483 QLVNVKIHQAKTWSLDGEMV 502


>MIAB_RICM5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  204 bits (518), Expect = 2e-54
 Identities = 149/445 (33%), Positives = 242/445 (54%), Gaps = 23/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  M +     GYE  +  E A V ++NTC +     +K+   +G
Sbjct: 5   KLYIKTYGCQMNVYDSVKMQDLLYPFGYEPTENIEEAAVIILNTCHIREKAAEKTYSELG 64

Query: 62  RARRQNP--------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++            AII V GC AQ    E+ +    VD+V+G ++   +   ++K  
Sbjct: 65  RIKKLQDTRTKQGLSSAIIVVAGCVAQAEGEEIFTRTPYVDIVVGPQSYYNLPELISKVV 124

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              K  + +  V + K F+ L  + Y   T AF+ +Q+GC++FC +C++PYTRG+  S++
Sbjct: 125 RHEKHLIDLDFVEEAK-FDQLPEQLYPQGTSAFISVQEGCDKFCTFCVVPYTRGAEFSRN 183

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E   +   G KEI+L G +  +Y G    +K+ +L DLL+ + +I  +ER+R  
Sbjct: 184 VEQVYREALKVVSSGAKEIMLLGQNVNAYHGKGPADKIFSLADLLKHLAQIPNLERLRYI 243

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P    +D+++      KL P  HL +QSG +  LK MNR++  + Y DI+N LR+  
Sbjct: 244 TSHPIDMNDDLIKLHGTEPKLMPFLHLPVQSGSNKILKAMNRKHDREYYFDIINRLREAR 303

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
             + +++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  + 
Sbjct: 304 PAIVLSSDFIVGFPGXXXXXXXXXXXXVRRVKYGQCYSFKYSPRPGTPGATKTDQIPEHI 363

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRN-YIKVNAKA 407
           K ER   L +     + AF E  +G  + VLF+   +    +   T Y ++ YI+   K 
Sbjct: 364 KSERLTILQQELMAQQLAFNESCVGSTMKVLFDRNGKCDDQIIGKTPYMQSVYIQNPNK- 422

Query: 408 DCNVSGKILNVKI-----NSFEGEV 427
             ++ GKI+++KI     NS  GE+
Sbjct: 423 --SLLGKIVDIKITKASLNSLTGEI 445


>MIAB_RHIEC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 469

 Score =  204 bits (518), Expect = 2e-54
 Identities = 140/451 (31%), Positives = 221/451 (49%), Gaps = 24/451 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S  M++   R+GYE  +  E AD+ ++NTC +     +K    +G
Sbjct: 23  KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALG 82

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R           E +I V GC AQ    E+      VDVV+G +    +   + +A+ 
Sbjct: 83  RLREMKKKKAADGREMMIGVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAK- 141

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRA-----FLKIQDGCNRFCAYCLIPYTRGSV 168
           EG++ V     +++K FE L + E + K RA     FL +Q+GC++FC +C++PYTRGS 
Sbjct: 142 EGQRVVDTEYAIEDK-FEHLPVAE-SRKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSE 199

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIER 226
            S+   ++++E   L E G +EI L G +  ++       E  +L DLL  + +I G+ R
Sbjct: 200 VSRPVSQIVEEAEKLVEGGVREITLLGQNVNAWHGAGPRGEAWSLGDLLYRLAEIPGLAR 259

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L+ L P+ HL +QSG D  LK MNRR+TA EY  ++  +
Sbjct: 260 LRYTTSHPRDMDDRLIAAHRDLRALMPYLHLPVQSGSDRILKAMNRRHTAAEYLSLIERI 319

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R    D++++ D I GFPG            ++ +  ++   FKYS R GT    +++QV
Sbjct: 320 RAVRPDIALSGDFITGFPGETDKDFEDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQV 379

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
                                 FAE  IG+ ID+L E+   +  G   G +     VN  
Sbjct: 380 PEEIXXXXXXXXXXXXXXXXXEFAESCIGKEIDLLLEKPGRM-PGQLIGRSPWLQSVNVD 438

Query: 407 ADCNVSGKILNVKI-----NSFEGEVAEGEI 432
           A  +  G I+ V+I     NS   E AE  +
Sbjct: 439 AKASQIGDIIKVRITGTGTNSLFAERAEAAV 469


>MIAB_PROM3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  204 bits (518), Expect = 2e-54
 Identities = 139/435 (31%), Positives = 211/435 (48%), Gaps = 26/435 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY        AD+ + NTC++ +  ++K    +GR    
Sbjct: 35  TFGCQMNKADSERMAGILEAMGYHEAPAELEADLVLYNTCTIRDNAEQKVYSYLGRQARR 94

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R +P   + V GC AQ      +  I  +D+V+G ++   +   + +  D G+Q V   
Sbjct: 95  KRTHPHLKLVVAGCVAQQEGEALLRRIPELDLVMGPQHANRLEALLTQV-DNGQQVV--- 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A   N + EDL     ++   A++ +  GCN  C YC++P  RG   S+ P+ +  EI  
Sbjct: 151 ATDDNHILEDLTTARRDSTICAWVNVIYGCNERCTYCVVPSVRGKEQSRSPEAIRLEIEG 210

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA  GF+EI L G +  +YG DL         + TL DLL  I  ++GIER+R  +  P 
Sbjct: 211 LAARGFREITLLGQNIDAYGRDLPGITPEGRRQNTLTDLLHHIHDVEGIERIRFATSHPR 270

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG +  LK M R YT + Y  IVN +R+ + D +I
Sbjct: 271 YFTERLIEACFDLPKVCEHFHIPFQSGDNDVLKAMARGYTVERYRRIVNRIRELMPDAAI 330

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TDVIV FPG            ++ +   + +   YSPR  T A    NQ+    K ER 
Sbjct: 331 STDVIVAFPGETDAQFQNTLNLVEEVGFDQVNTAAYSPRPNTPAATWSNQLPEVVKVERL 390

Query: 356 KKLIELNRINEKAFAE---KYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKAD 408
           K   +LN + E+   +   +Y G+V  VL E           G TR     +        
Sbjct: 391 K---QLNALVERVALQRNSRYSGKVEQVLAEGINPKKPQQLMGRTRTNRLTFFAAEGPQS 447

Query: 409 CNVS-GKILNVKINS 422
           C  S G +++V+INS
Sbjct: 448 CRYSPGDLVDVQINS 462


>MIAB_METFK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  204 bits (518), Expect = 2e-54
 Identities = 137/439 (31%), Positives = 203/439 (46%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           ++   T GC++N Y+S  M +     EG +  D  E ADV ++NTCSV     +K    +
Sbjct: 6   RIFIKTFGCQMNEYDSSRMLDMLQAAEGMQTTDNPEEADVILLNTCSVREKAQEKVFSHL 65

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ +I V GC A Q   + V+    VDVV G +    +   +   R  G 
Sbjct: 66  GRFAPLKEKNPDLVIGVGGCVASQEGESIVARAPYVDVVFGPQTLHRLPDMIESKRRTGI 125

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L          AFL I +GC+++C +C++PYTRG   S+    +
Sbjct: 126 SQVDISFPEVEK-FDHLPPPRVEGAA-AFLSIMEGCSKYCTFCVVPYTRGDEVSRPFDDI 183

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL--DEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E   LAE G KEI L G +   Y  +    E   L  L+E + +I  IER+R  +  P
Sbjct: 184 LTEAIQLAEQGVKEITLLGQNVNGYRSETADGEMADLALLIEYLAEIPEIERIRYTTSHP 243

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
              T  ++     + KL  H HL +Q+G D  L  M R YT  +Y+ I+  LR    D+ 
Sbjct: 244 NEMTPALIDCYARIPKLVSHLHLPVQAGSDRVLMNMKRNYTVLQYKSIIRKLRAARPDIC 303

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++ +    +  F YSPR GT A  + +     +K  R
Sbjct: 304 ISSDFIVGFPGETEQDFEATMKLMRDVGFDFSFSFIYSPRPGTPASYLPDDCSPEEKQSR 363

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L  LN    KA +   +G +  VL E      +    G T N   VN   D  +  +
Sbjct: 364 LSRLQALNEAQGKAISASMVGSIQRVLIESVSAKRADELAGRTDNNRIVNFPGDTALINQ 423

Query: 415 ILNVKINSFEGEVAEGEIV 433
            +NV+I         GE+V
Sbjct: 424 FVNVRITEALSHTLRGELV 442


>MIAB_DESOH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 466

 Score =  204 bits (518), Expect = 2e-54
 Identities = 132/412 (32%), Positives = 211/412 (51%), Gaps = 15/412 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T+GC++N Y+S  ++      G+  V+  E AD+  VNTC++     +K+   +GR    
Sbjct: 8   TIGCQMNVYDSSQLSAILTAMGHRSVNAPEQADLVFVNTCTIRAKAKQKATSFVGRLAAM 67

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ--QVK 120
           +R  P+ I+ V GC AQ    ++      VD+V G+   G +  ++     +G +   V+
Sbjct: 68  KRARPDMIVGVGGCLAQEEGRQLLDAFPCVDIVFGTHALGRLPGHIQAVAHQGDRIVDVE 127

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           + A +   V   L+  + +  T  F+ I  GC+ FC YC++PY RG   S+ P+ +LDEI
Sbjct: 128 MTAAIDESVHA-LQGPDSSGVT-GFITIMRGCDNFCTYCVVPYVRGRETSRAPEHILDEI 185

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           R+    G +EI L G +  SYG   +   +  DLL  + +IDG+ R+R  +  P   + +
Sbjct: 186 RARVAGGLREITLLGQNVNSYG-QKEGLCSFADLLARVNEIDGLHRIRFTTSHPKDLSPE 244

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +     +L KLC H HL  QSG DA LKRMNRRYT + Y + ++ LR+    ++++TD+I
Sbjct: 245 LAAAFTSLDKLCSHVHLPAQSGSDAVLKRMNRRYTRQAYLEKLHWLREAQPGMALSTDII 304

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++++       F YS R    A   + +VD  +K +R   L+E
Sbjct: 305 VGFPGETEQDFLQTLDLIEKVRYDSIFAFMYSDRPLAPARAFDGKVDEAEKQQRIYALLE 364

Query: 361 L-NRIN-EKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN 410
           L NRI  EK  A +  G V  VL E + +  S      T + ++   +  CN
Sbjct: 365 LQNRITAEKNRALE--GRVEQVLVEGKSK--SSGRNDITADTVQWTGRTTCN 412


>MIAB_COREF RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 524

 Score =  204 bits (518), Expect = 2e-54
 Identities = 130/438 (29%), Positives = 218/438 (49%), Gaps = 23/438 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N ++SE ++      GY      +  D+ V NTC+V    D++    +G  R  
Sbjct: 33  TFGCQMNVHDSERLSGLLEEAGYTAAGEGDTPDLIVFNTCAVRENADQRLYGTLGNLRAV 92

Query: 65  -RQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
              +P   IAV GC AQ    T V     VDVV G+ N   +   +N+A    K +V++ 
Sbjct: 93  KENHPGMQIAVGGCLAQKDKDTVVKKAPWVDVVFGTHNIASLPTLLNRAEHNQKAEVEIV 152

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 153 DSLEQ--FPSVLPAKRESAYAGWVSVSVGCNNTCTFCIVPSLRGKEQDRRPGDILAEVQA 210

Query: 183 LAEHGFKEIILSGIHTASYGVDL------DEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  +YGV+        ++     LL     I+G+ERVR  S  P  
Sbjct: 211 LVDQGVSEVTLLGQNVNAYGVNFVDPELERDRSAFSKLLRACGDIEGLERVRFTSPHPAE 270

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +     +CP  H+ LQSG D  LK M R Y + ++  I++ +R KI   SIT
Sbjct: 271 FTSDVIDAMAETPNICPQLHMPLQSGSDRVLKEMRRSYRSAKFLAILDEVRAKIPHASIT 330

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   +  + F+YSPR GT A + ENQV      ER +
Sbjct: 331 TDIIVGFPGETEEDFQATLDVVEKARFTSAYTFQYSPRPGTPAADYENQVPKKVVQERYE 390

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           +L+ L     +   +K+IG+ +++L    V+ G G     T+   +++ +A     G+++
Sbjct: 391 RLMALQERICEEENQKFIGQTVELL----VQAGGGRKNDATK---RMSGRAR---DGRLV 440

Query: 417 N-VKINSFEGEVAEGEIV 433
           +   + + +GE+  G++V
Sbjct: 441 HFTPVGTIDGEIRPGDVV 458


>MIAB_RHIE6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 469

 Score =  203 bits (517), Expect = 2e-54
 Identities = 140/451 (31%), Positives = 221/451 (49%), Gaps = 24/451 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S  M++   R+GYE  +  E AD+ ++NTC +     +K    +G
Sbjct: 23  KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALG 82

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R           E +I V GC AQ    E+      VDVV+G +    +   + +A+ 
Sbjct: 83  RLREMKKKKAADGREMMIGVTGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAQ- 141

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRA-----FLKIQDGCNRFCAYCLIPYTRGSV 168
           +G++ V     +++K FE L I E + K RA     FL +Q+GC++FC +C++PYTRGS 
Sbjct: 142 QGQRVVDTEYAIEDK-FEHLPIAE-SRKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSE 199

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIER 226
            S+   ++++E   L E G +EI L G +  ++       E  +L DLL  + +I G+ R
Sbjct: 200 VSRPVSQIVEEAEKLVEAGVREITLLGQNVNAWHGAGPRGEAWSLGDLLYRLAEIPGLAR 259

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L+ L P+ HL +QSG D  LK MNRR+TA EY  ++  +
Sbjct: 260 LRYTTSHPRDMDDRLIEAHRDLRALMPYLHLPVQSGSDRILKAMNRRHTAAEYLSLIERI 319

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R    D++++ D I GFPG            ++ +  ++   FKYS R GT    +++QV
Sbjct: 320 RTVRPDIALSGDFITGFPGETDADFEDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQV 379

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
                                 FAE  IG+ ID+L E+   +  G   G +     VN  
Sbjct: 380 PEEIXXXXXXXXXXXXXXXXXEFAESCIGKEIDLLLEKPGRM-PGQLIGRSPWLQSVNVD 438

Query: 407 ADCNVSGKILNVKI-----NSFEGEVAEGEI 432
           A  +  G I+ V+I     NS   E AE  +
Sbjct: 439 AKASQIGDIIKVRITGTGTNSLFAERAEAAV 469


>MIAB_ALHEH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  203 bits (517), Expect = 2e-54
 Identities = 139/438 (31%), Positives = 214/438 (48%), Gaps = 8/438 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           +V   T GC++N Y+S+ M +  V+E GY  VD    ADV ++NTCSV     +K    +
Sbjct: 4   RVYVKTHGCQMNEYDSDKMADVLVKERGYTRVDSPGDADVILLNTCSVREKAQEKVFSEL 63

Query: 61  GRAR--RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           GR +  +    A+I V GC A Q     V     VDVV G +    +   +++ARD G+ 
Sbjct: 64  GRWKDYKTRNGAVIGVGGCVASQEGEAIVQRAPHVDVVFGPQTLHRLPEMIDRARDGGRS 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            V V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+  + V+
Sbjct: 124 VVDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPFEDVI 181

Query: 178 DEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDPT 235
            E+ SLAE G +E+ L G +  +Y G   D  V  L  L+  +  +DGI R+R  +  P 
Sbjct: 182 AEVASLAEQGVREVTLLGQNVNAYRGPMADGTVCDLALLIHYVAALDGIGRIRFTTSHPV 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            F++ ++       KL  H HL +QSG D  LK M R +TA EY D +  ++     +SI
Sbjct: 242 EFSDSLIEAYREEPKLAGHLHLPVQSGSDLVLKLMKRGHTAAEYLDKIERIKAARPGISI 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
            +D IVG+PG            ++ +   ++  F YSPR GT A ++ +      K ER 
Sbjct: 302 ASDFIVGYPGESEADFEDTLRLIEAVGFDQSFSFLYSPRPGTPAASLSDSTPAEVKRERL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
            +L E    N +  +E  +G V  VL +          +G T N   VN      + G  
Sbjct: 362 YRLQETINANARRISESMVGTVQRVLVDGRSRKDPNEISGRTENNRVVNFAGHPRLIGHF 421

Query: 416 LNVKINSFEGEVAEGEIV 433
           + V+I   +     GE++
Sbjct: 422 VEVRITEAKPNSLRGELL 439


>MIAB_TRIEI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  203 bits (516), Expect = 3e-54
 Identities = 131/444 (29%), Positives = 217/444 (48%), Gaps = 21/444 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       G    +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 12  TFGCQMNKADSERMAGILDNMGLISSEDPNKADIILYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P+  + V GC AQ     +   +  +D+++G ++   +   + +  + G Q V   
Sbjct: 72  KHKQPDLTLIVAGCVAQQEGAALLRRVPELDLIMGPQHANRLQDLLEQVFN-GNQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +    + ED+     ++K  A++ I  GCN  C YC++P  RG   S+ P+ +  E+  
Sbjct: 131 PI---HIVEDITKPRRDSKITAWVNIIYGCNEHCTYCVVPSVRGVEQSRTPEAIRAEMEE 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L   G++EI L G +  +YG DL         K T  DLL  +  + G+ER+R  +  P 
Sbjct: 188 LGRQGYQEITLLGQNIDAYGRDLPGVTKEGRNKYTFTDLLYYVHDVPGVERIRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++R    L K+C HFH+  QSG +  LK M R YT ++Y  I++ +R+ + D SI
Sbjct: 248 YFTERLIRACAELPKVCEHFHIPFQSGDNKLLKAMARGYTHEKYRRIIDKIRELMPDASI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            ++ I   + +   YSPR GT A   ENQ+    K +R 
Sbjct: 308 SADAIVGFPGETEAQFENTLKLVEDIGFDQLNTAAYSPRPGTPAALWENQLGEEVKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD-CNVSGK 414
           ++L  L  +     +++Y+G + +VL E+     +    G TR       + D   + GK
Sbjct: 368 QRLNHLVGVKAADRSQRYMGRIEEVLVEDMNPKNAAQVMGRTRGNRLTFFEGDIAQLKGK 427

Query: 415 ILNVKIN-----SFEGEVAEGEIV 433
           ++ VKI      S  GEV E  +V
Sbjct: 428 LVKVKITEVRPFSLTGEVKEFVLV 451


>MIAB_RALSO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  203 bits (516), Expect = 3e-54
 Identities = 148/449 (32%), Positives = 213/449 (47%), Gaps = 24/449 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 3   KVFIKTFGCQMNEYDSDKMADVLNAAEGLVPTDTPEDADVILFNTCSVREKAQEKVFSDL 62

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +    +NP+ ++ V GC A Q   + V+    VDVV G +    +   ++  R  G+
Sbjct: 63  GRVKALKARNPDLVVGVGGCVASQEGASIVARAPYVDVVFGPQTLHRLPELIDARRRTGR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV V      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 123 PQVDVSFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL---DEKVTLVDLLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y   +    E+     LLE + +I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYIGKMGGTSERADFALLLEYVAEIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT  ++      +KL  H HL +Q G D  L  M R YT  EY+ I+  LR    D+
Sbjct: 241 PKEFTARLIEAYATNRKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSIIRKLRAIRPDI 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           SI TD IVGFPG            +  I    +  F YSPR GT A N+ +      K E
Sbjct: 301 SIATDFIVGFPGETDADFAKTMDLVHEIGYDNSFSFIYSPRPGTPAANLHDDTPHAVKLE 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN--------A 405
           R K L      N    +E  +G V  +L E           G T N   VN        A
Sbjct: 361 RLKHLQATIDANMARISEGMVGSVQRILVEGPSRKDPSELHGRTENNRVVNFALPDLPQA 420

Query: 406 KADCNVSGKILNVKI-----NSFEGEVAE 429
           + D  + G++L+V+I     +S  G+V E
Sbjct: 421 RRD-QLVGQMLDVRIVHAYPHSLRGDVVE 448


>MIAB_LEPBP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  203 bits (516), Expect = 3e-54
 Identities = 136/389 (34%), Positives = 218/389 (56%), Gaps = 14/389 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  + E F +E YE  +  E +D+  +NTC+V      K     Q
Sbjct: 19  KVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKIYGRLQ 78

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NP  +I V+GC AQ    ++   E  +D+++G  N   +   +   R+ G++
Sbjct: 79  SLGYLKKKNPNLVIGVLGCMAQNLGEDLFHQELPLDLIVGPDNYRTLPELIQNIRN-GEK 137

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            V++  + +++ +++L+ +  N   +AF+ I  GCN FC +C++PYTRG   S++PK ++
Sbjct: 138 DVQLTRLSRSETYDELEPKVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSREPKSII 196

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            EI+ L E G K++ L G +  SY     E      L+E I K   IERVR  S  P  F
Sbjct: 197 HEIKQLQEMGVKQVTLLGQNVNSYSY---ESYDFCALVESILKETTIERVRFTSPHPKDF 253

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            + ++  +    +     H+ LQ+G    L+ M R YT +EY D+V  ++  I D+ IT+
Sbjct: 254 PDHLISLMAKEDRFSSQIHMPLQAGSSKVLRDMKRSYTKEEYLDLVKKIQSVIPDIGITS 313

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG                    +++FKYS R+GT A+     +D   ++ +S++
Sbjct: 314 DIIVGFPGXXXXXXXXXXXXXXXXXXDMSYMFKYSEREGTIAK--RKFIDDVPEEVKSRR 371

Query: 358 LIELNRINEKAFAEK---YIGEVIDVLFE 383
           LIEL  +  K   EK    IG++  +L E
Sbjct: 372 LIELVELQTKISLEKNTSKIGKIFSILIE 400


>MIAB_LEPBA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  203 bits (516), Expect = 3e-54
 Identities = 136/389 (34%), Positives = 218/389 (56%), Gaps = 14/389 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  + E F +E YE  +  E +D+  +NTC+V      K     Q
Sbjct: 19  KVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKIYGRLQ 78

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NP  +I V+GC AQ    ++   E  +D+++G  N   +   +   R+ G++
Sbjct: 79  SLGYLKKKNPNLVIGVLGCMAQNLGEDLFHQELPLDLIVGPDNYRTLPELIQNIRN-GEK 137

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            V++  + +++ +++L+ +  N   +AF+ I  GCN FC +C++PYTRG   S++PK ++
Sbjct: 138 DVQLTRLSRSETYDELEPKVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSREPKSII 196

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            EI+ L E G K++ L G +  SY     E      L+E I K   IERVR  S  P  F
Sbjct: 197 HEIKQLQEMGVKQVTLLGQNVNSYSY---ESYDFCALVESILKETTIERVRFTSPHPKDF 253

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            + ++  +    +     H+ LQ+G    L+ M R YT +EY D+V  ++  I D+ IT+
Sbjct: 254 PDHLISLMAKEDRFSSQIHMPLQAGSSKVLRDMKRSYTKEEYLDLVKKIQSVIPDIGITS 313

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG                    +++FKYS R+GT A+     +D   ++ +S++
Sbjct: 314 DIIVGFPGXXXXXXXXXXXXXXXXXXDMSYMFKYSEREGTIAK--RKFIDDVPEEVKSRR 371

Query: 358 LIELNRINEKAFAEK---YIGEVIDVLFE 383
           LIEL  +  K   EK    IG++  +L E
Sbjct: 372 LIELVELQTKISLEKNTSKIGKIFSILIE 400


>MIAB_DESDG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  203 bits (516), Expect = 3e-54
 Identities = 125/382 (32%), Positives = 189/382 (49%), Gaps = 6/382 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +S+ +       G+  V  +E A +Y++NTCSV +  ++K   ++GR RR+
Sbjct: 10  TFGCQMNVNDSDWLARALEARGFTQVPEHEAA-IYIINTCSVRDKPEQKVYSLLGRIRRE 68

Query: 67  NPE---AIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
                   + V GC AQ I          V +V G+         + +   E   ++ + 
Sbjct: 69  TKNRRNVTVCVGGCVAQQIGKGFFKRFSQVRLVFGTDGAASAPQAIERLVQEPHARISLL 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
              +     D   E       A++ I  GCN FCAYC++PYTRG   S+    VLDE R+
Sbjct: 129 DFSEEFPERDAGWENGEVPVSAYVNIMQGCNNFCAYCIVPYTRGRQKSRSSAAVLDECRT 188

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           L  +G +EI L G +  SYG+D   +  T   LL ++  I G+ER+R  +  P     +V
Sbjct: 189 LVGNGAREITLLGQNVNSYGLDPHGDGTTFARLLHDVAAIPGLERLRFMTPHPKDIAGEV 248

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +    ALK LCP  HL LQSG D  LK M R+Y    Y DIV  L+    D+ IT+D+IV
Sbjct: 249 IEAFGALKNLCPRVHLPLQSGSDRVLKAMGRKYDMARYMDIVTRLKAVRPDIQITSDLIV 308

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++ +   ++  F YS R GTRAE +  ++   +K  R  +L E+
Sbjct: 309 GFPGETEADFEQTLEAMRTVPFVQSFSFIYSDRPGTRAEMLPGKLSREEKTARLVRLQEV 368

Query: 362 NRINEKAFAEKYIGEVIDVLFE 383
                +A  +  +G+ + VLFE
Sbjct: 369 QNEYSEAALQAMVGKTVMVLFE 390


>MIAB_BURM1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  202 bits (515), Expect = 3e-54
 Identities = 141/446 (31%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDSPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRTSGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        T AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPT-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL----DEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSSEVADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVNHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +    + K 
Sbjct: 302 LSLSTDLIVGFPGETEEDFDKMMALVHDMRYDTSFSFIYSPRPGTPAANLHDDTPRDVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + +      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQLVQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLAAH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_CYAA5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  202 bits (514), Expect = 4e-54
 Identities = 127/439 (28%), Positives = 218/439 (49%), Gaps = 16/439 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       G++  +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 14  TFGCQMNKADSERMAGILEDMGFKWSEDPNTADLILYNTCTIRDNAEQKVYSYLGRQAKR 73

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + ++P+  + V GC AQ    ++   +  +D+V+G ++   +   + +  D G Q V   
Sbjct: 74  KHEHPDLTLVVAGCVAQQEGEKILRRVPELDLVMGPQHANRLQDLLTQVFD-GNQVVATE 132

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +    + ED+     ++   A++ I  GCN  C+YC++P  RG   S+ P+ +  E+  
Sbjct: 133 PI---HIVEDITKPRRDSTVTAWVNIIYGCNERCSYCVVPNVRGVEQSRTPEAIYAEMEL 189

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L + G+KE+ L G +  +YG DL         + TL DLL ++  I GIER+R  +  P 
Sbjct: 190 LGKQGYKEVTLLGQNIDAYGRDLPGVTETGRHQHTLTDLLYQVHDISGIERLRFATSHPR 249

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I++ +R+ + D SI
Sbjct: 250 YFTERLIKACHELPKVCEHFHIPFQSGDNDVLKAMKRGYTHEKYRHIIDKIREYMPDASI 309

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            +  I   + +   YSPR GT A   +NQ+    K +R 
Sbjct: 310 SADAIVGFPGETEAQFENTLKLVDDIGFDQLNTAAYSPRPGTPAAIWDNQLSEEIKSDRL 369

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L        +++Y+  + +VL E+E    +    G TR       + D   + G+
Sbjct: 370 QRLNHLVAQKAAQRSQRYLNRIEEVLVEDENPKDNTQVMGRTRGNRLTFFEGDIEALKGQ 429

Query: 415 ILNVKINSFEGEVAEGEIV 433
           ++ VKI         GE +
Sbjct: 430 LIKVKITEVRAFSLTGEAI 448


>MIAB_CLAM3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 528

 Score =  202 bits (514), Expect = 4e-54
 Identities = 134/431 (31%), Positives = 211/431 (48%), Gaps = 17/431 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE +T      GY   +  E AD+ V+NTC+V    D K    +G     
Sbjct: 25  TYGCQMNVHDSERLTGSLEAAGYVSAEGAE-ADIVVINTCAVRENADNKLYGNLGHLAGV 83

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R++    IAV GC AQ    T +     VDVV G+ N G +   + +AR  G+ Q+++ 
Sbjct: 84  KRRHEGMQIAVGGCLAQKDRATVLEKAPWVDVVFGTHNMGALPTLLERARHNGEAQLEIL 143

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F      + +     ++ I  GCN  C +C++P  RG    + P  +L EI++
Sbjct: 144 ESLET--FPSTLPTKRDEIASGWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIQA 201

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL     I+G+ER+R  S  P  FT+DV+
Sbjct: 202 LVDDGAVEVTLLGQNVNSYGVEFGDRQAFGKLLRAAGAIEGLERIRFTSPHPAAFTDDVI 261

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  LK M R Y ++ +  I++ +R +I D +ITTD+IVG
Sbjct: 262 DAMAETPAVMPQLHMPLQSGSDRVLKAMRRSYRSERFLGILDRVRTRIPDAAITTDIIVG 321

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    S    F+YS R GT A  ME QV  +   ER  +L  L 
Sbjct: 322 FPGETEEDFQETLRVVEAARFSSAFTFQYSIRPGTPAATMEEQVPADVVKERYGRLTALQ 381

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKINS 422
                   ++ +G  ++VL    V    G   G TR   +V  +A     G+++++ + +
Sbjct: 382 ERISHEENQRVVGRTVEVL----VSAHEGRKDGDTR---RVTGRAQ---DGRLVHLDVPA 431

Query: 423 FEGEVAEGEIV 433
             GE   G+ V
Sbjct: 432 GSGEPRPGDAV 442


>MIAB_BURTA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  202 bits (514), Expect = 4e-54
 Identities = 141/446 (31%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDSPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L EI  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEIAGLADQGVREVTLLGQNVNAYRGALTAGAHEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSLIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETEADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           ER + L      N    ++  +G+V  +L E           G T N   VN      A 
Sbjct: 362 ERLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLTAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 ARLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_SILPO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  202 bits (513), Expect = 6e-54
 Identities = 137/438 (31%), Positives = 223/438 (50%), Gaps = 15/438 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    +GY      E AD+ ++NTC +     +K    +G
Sbjct: 6   KLFIKTYGCQMNVYDSERMAEALGGQGYVETQSAEDADMILLNTCHIREKAAEKVYSELG 65

Query: 62  R---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R    +   P+  I V GC AQ    E+   +  VD+V+G ++   +     K R  G++
Sbjct: 66  RFKGLKAAKPDLKIGVAGCVAQAEGEEIMRRQPLVDLVVGPQSYHRLPELEAKTR-AGEK 124

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            +      ++K FE LK      +   AFL +Q+GC++FCA+C++PYTRG+  S+   ++
Sbjct: 125 ALDTDFPEEDK-FEKLKGRPKAKRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSRPADRI 183

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L E   L E G +EI L G +  +Y G   +  +TL  L+ E++KIDG+ER+R  +  P 
Sbjct: 184 LREANELVERGVREITLLGQNVNAYHGAGPNGDMTLAGLIWELDKIDGLERIRFTTSHPN 243

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +D++       KL P+ HL +Q+G D  LKRMNR +TA+ Y  ++  +R    D+ +
Sbjct: 244 DMADDLIEAHGTCAKLMPYLHLPVQAGSDKILKRMNRSHTAESYLRLIERIRAARPDIVM 303

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFP             ++++     + FKYS R GT A     QVD  + D+R 
Sbjct: 304 SGDFIVGFPEETEADFQDTLDLVEQVRYGYAYSFKYSTRPGTPAAE-RAQVDPAEADDRL 362

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++L  +   +++   +  +G  + VLFE+      G   G +     V+ +     +G+I
Sbjct: 363 QRLQAVITRHQREIQDGMVGREVSVLFEKPGR-QPGQMVGKSEYLHAVHVQDPGLEAGQI 421

Query: 416 LNVKI-----NSFEGEVA 428
             V+I     NS  GE+A
Sbjct: 422 ARVRIVASGANSLAGELA 439


>MIAB_BURA4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  202 bits (513), Expect = 6e-54
 Identities = 140/446 (31%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYIKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   +++ R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDQRRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSTEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEEDFDKMMALVHEMSYDTSFSFIYSPRPGTPAANLHDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    +   +G+V  +L E          +G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISRSMVGKVERILVEGPSRKDPNELSGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE++L
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELLL 447


>MIAB_BARQU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  202 bits (513), Expect = 6e-54
 Identities = 136/447 (30%), Positives = 220/447 (49%), Gaps = 26/447 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ MT+    +GY        AD+ ++NTC +     +K    +G
Sbjct: 16  KVFIKTYGCQMNVYDSQRMTDSLSSKGYVATQTPNDADLILLNTCHIREKAAEKLYSDLG 75

Query: 62  R------ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDE 114
           R      AR  +   +I V GC AQ    E+      VD+V+G +    +   + + + +
Sbjct: 76  RLRVMRQARTLDKPLMIGVTGCVAQAEGNEILRRAPMVDLVIGPQMYHRLPDLLEQTK-Q 134

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKT------RAFLKIQDGCNRFCAYCLIPYTRGSV 168
           GK+ V+    +++K      +  +N +        AFL +Q+GC++FC +C++PYTRG+ 
Sbjct: 135 GKKIVETDYPVEDKFAH---LPPHNKRAVRKRGVSAFLTVQEGCDKFCTFCVVPYTRGAE 191

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT--LVDLLEEIEKIDGIER 226
            S+  +++ +E R L E G KEI L G +   +   +    T  L DLL  + K+DG++R
Sbjct: 192 ISRSVEQITEEARQLIEAGVKEITLLGQNVNGWHGQIANGKTWRLGDLLYHLAKLDGLKR 251

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L  L P+ HL +QSG D  LK MNR++ +  Y  ++  +
Sbjct: 252 LRYTTSHPRDMDDSLIAAHRDLDILMPYLHLPVQSGSDRILKAMNRQHKSIHYLHLIEKI 311

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R    D++ + D IVGFPG            +K++  S  + FKYSPR GT    M+N V
Sbjct: 312 RTARPDIAFSGDFIVGFPGETDEDFEETVKLIKQVQYSSAYSFKYSPRPGTVGATMKNHV 371

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
           D   KD R             AF    IG+  DVL  E+V   SG   G +   + V   
Sbjct: 372 DEAVKDARXXXXXXXXXXXXNAFLRSKIGQTTDVLI-EKVGRHSGQMVGRSPWLLPVVVD 430

Query: 407 ADCNVSGKILNVKI-----NSFEGEVA 428
            + + +G ++++ I     NSF GE+A
Sbjct: 431 TEAS-TGTVMSIHIKNAGSNSFVGEIA 456


>MIAB_ACTP7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  202 bits (513), Expect = 6e-54
 Identities = 143/444 (32%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ D  E ADV ++NTCS+     +K    +
Sbjct: 3   KLHITTWGCQMNEYDSSKMADLLNSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQL 62

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   +  P+ II V GC A      +      VD+V G +    +   +NK R   +
Sbjct: 63  GRWKNWKKDKPDLIIGVGGCVASQEGEHIRDRAPFVDIVFGPQTLHRLPEMINKIRGGDR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 AIVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+RVR  +  P
Sbjct: 181 LFEIAQLAEQGVREVNLLGQNVNAYRGETFDGGICTFAELLRLVAAIDGIDRVRYTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR+   ++ 
Sbjct: 241 IEFTDDIIEVYRDTPELVSFLHLPIQSGADRVLTMMKRNHTALEYKAIIRKLREVRPNIQ 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++++    +  F YS R GT A ++ + +   +K ER
Sbjct: 301 ISSDFIVGFPGETAEDFEQTMKVIEQVNFDMSFSFIYSARPGTPAADLPDDISEEEKKER 360

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
             +L +  RIN +A  F+   +G    VL E   +      TG T N   VN +   ++ 
Sbjct: 361 LARLQQ--RINHQAMQFSRAMLGTEQRVLVEGPSKKDIMELTGRTENNRIVNFQGTPDMI 418

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  G+V   E
Sbjct: 419 GKFVDIKITDVYTNSLRGDVVRTE 442


>MIAB_ACTP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  202 bits (513), Expect = 6e-54
 Identities = 143/444 (32%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ D  E ADV ++NTCS+     +K    +
Sbjct: 3   KLHITTWGCQMNEYDSSKMADLLNSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQL 62

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   +  P+ II V GC A      +      VD+V G +    +   +NK R   +
Sbjct: 63  GRWKNWKKDKPDLIIGVGGCVASQEGEHIRDRAPFVDIVFGPQTLHRLPEMINKIRGGDR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 AIVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+RVR  +  P
Sbjct: 181 LFEIAQLAEQGVREVNLLGQNVNAYRGETFDGGICTFAELLRLVAAIDGIDRVRYTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR+   ++ 
Sbjct: 241 IEFTDDIIEVYRDTPELVSFLHLPIQSGADRVLTMMKRNHTALEYKAIIRKLREVRPNIQ 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++++    +  F YS R GT A ++ + +   +K ER
Sbjct: 301 ISSDFIVGFPGETAEDFEQTMKVIEQVNFDMSFSFIYSARPGTPAADLPDDISEEEKKER 360

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
             +L +  RIN +A  F+   +G    VL E   +      TG T N   VN +   ++ 
Sbjct: 361 LARLQQ--RINHQAMQFSRAMLGTEQRVLVEGPSKKDIMELTGRTENNRIVNFQGTPDMI 418

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  G+V   E
Sbjct: 419 GKFVDIKITDVYTNSLRGDVVRTE 442


>MIAB_SYNR3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 453

 Score =  201 bits (512), Expect = 8e-54
 Identities = 126/388 (32%), Positives = 195/388 (50%), Gaps = 15/388 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY      + AD+ + NTC++ +  ++K    +GR    
Sbjct: 13  TFGCQMNKADSERMAGILESMGYCAGSGEDQADLVLYNTCTIRDNAEQKVYSYLGRQARR 72

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP   + V GC AQ    + +  +  +D+V+G ++   +   +++   E  QQV   
Sbjct: 73  KRDNPALTLVVAGCVAQQEGESLLRRVPELDLVMGPQHANRLDTLLSQV--EAGQQVV-- 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A   + + ED+     ++   A++ +  GCN  C YC++P  RG   S+ P+ +  E+  
Sbjct: 129 ATDDHHILEDITTARRDSSLCAWVNVIYGCNERCTYCVVPSVRGQEQSRLPQAIRLEMEG 188

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA  G+KEI L G +  +YG DL         + TL DLL  +  + GIER+R  +  P 
Sbjct: 189 LAASGYKEITLLGQNIDAYGRDLPGITPEGRRQNTLTDLLHHVHDVKGIERIRFATSHPR 248

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG D  LK M R YT   Y  IV  +R  + D +I
Sbjct: 249 YFTERLIEACAELPKVCEHFHVPFQSGDDELLKAMARGYTTARYRRIVEQIRKLMPDAAI 308

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            +  I     +   YSPR  T A +  +QV+ + K ER 
Sbjct: 309 SADAIVGFPGETDAQFRRTLELVDEIGFDLLNTAAYSPRPNTPAADWPDQVEEHVKVERL 368

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFE 383
           K+L  L     KA +++Y+G V +VL E
Sbjct: 369 KELNALVERKAKACSQRYLGRVEEVLAE 396


>MIAB_RHOS1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 436

 Score =  201 bits (512), Expect = 8e-54
 Identities = 134/434 (30%), Positives = 218/434 (50%), Gaps = 16/434 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    +GY + +  E AD+ ++NTC +     +K    +G
Sbjct: 6   KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLG 65

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R R      P+  I V GC AQ    E+   +  VD+V+G ++   +   ++  R EG  
Sbjct: 66  RLRPLKTAKPDLKIGVAGCVAQAEGEEILKRMPLVDLVVGPQSYHRLPDMLD--RTEGGA 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +V      +   F+ L   +      AFL +Q+GC++FCA+C++PYTRG+  S+   +++
Sbjct: 124 RVVDTDFPEEDKFDHLPERKATRGPAAFLTVQEGCDKFCAFCVVPYTRGAEVSRPFARLM 183

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E R L E G +EI L G +  ++  D      L  L+ E+ +IDG+ER+R  +  P   
Sbjct: 184 AEARGLVERGVREITLLGQNVNAWSSD---GRGLGGLIRELARIDGLERLRYTTSHPNDM 240

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            +D++    A  KL P+ HL +QSG D  LK MNR++TA+ Y  ++  +R    D+ +T+
Sbjct: 241 ADDLIEAHGAEPKLMPYLHLPVQSGSDRILKAMNRKHTAEHYLRLIERIRAARPDILLTS 300

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D IVGFPG            ++ +       FKYS R GT A   + ++ G   D R ++
Sbjct: 301 DFIVGFPGETEADFEATLDLIRAVGFGSAFSFKYSARPGTPAAE-KPELPGEVCDARLQR 359

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L  L    ++A     +G  + VL+E+   L  G   G + +   V+ +      G ++ 
Sbjct: 360 LQALVTEQQRAAQMAMVGREVGVLYEKAGRL-PGQMVGKSDHLHAVHVEDKAGRVGDLVR 418

Query: 418 VKI-----NSFEGE 426
           V+I     NS  GE
Sbjct: 419 VRITASAPNSLAGE 432


>MIAB_BURCM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  201 bits (512), Expect = 8e-54
 Identities = 140/446 (31%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   +++ R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDQRRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSTEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEEDFDKMMALVHEMSYDTSFSFIYSPRPGTPAANLHDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    +   +G+V  +L E          +G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISRSMVGKVERILVEGPSRKDPNELSGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE++L
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELLL 447


>MIAB_BRAJA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 465

 Score =  201 bits (512), Expect = 8e-54
 Identities = 133/444 (29%), Positives = 220/444 (49%), Gaps = 13/444 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      E AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDTLAPEGFVETASAEDADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E V          G ++   +   + +A +
Sbjct: 66  RLRVAKDEAARGGRAMQIAVAGCVAQAEGEEIVRRAPXXXXXXGPQSYHHLPELLKRAGN 125

Query: 114 EGKQ-QVKVGAVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
           EG+  + +  A  K       K +    +   AF+ +Q+GC++FC +C++PYTRG+  S+
Sbjct: 126 EGRAVETEFPAADKFGFLAQPKPDAIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEVSR 185

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT--LVDLLEEIEKIDGIERVRI 229
              +++D+++ LA++G +E+ L G +  +Y  D  +  +  L  LLE +  I GI R+R 
Sbjct: 186 PVARIVDDVKRLADNGVRELTLIGQNVNAYHGDGPDGKSWPLGRLLEHLAGIPGIARLRY 245

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P    + ++     L  L P  HL +QSG D  L  MNR++TA +Y  +++  R  
Sbjct: 246 STSHPRDVDDSLIAAHRDLAALMPFVHLPVQSGSDRILAAMNRKHTADDYRRVIDRFRAA 305

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
            +D++ ++D IVGFPG            + +I  +  + FKYS R GT A +M+  V   
Sbjct: 306 RQDIAFSSDFIVGFPGESEQDFLATLALVTQIGYAAAYSFKYSARPGTPAADMQETVSPA 365

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
           + D+R ++L EL    + AF +  IG  +DVLFE       G   G T      +  A  
Sbjct: 366 EMDQRLERLQELIDSQQSAFNKAAIGSTVDVLFERPAR-KDGQIVGRTAFLQPAHVMASP 424

Query: 410 NVSGKILNVKINSFEGEVAEGEIV 433
            + G+IL V+I+S E     GE+V
Sbjct: 425 GIIGQILPVRIDSLERYSFLGELV 448


>MIAB_BART1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  201 bits (512), Expect = 8e-54
 Identities = 136/445 (30%), Positives = 215/445 (48%), Gaps = 24/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ MT+    +GY        AD+ +VNTC +     +K    +G
Sbjct: 16  KVFIKTYGCQMNVYDSQRMTDSLSSQGYVTTQTPNDADLILVNTCHIREKAAEKLYSDLG 75

Query: 62  RARRQNPEAI------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDE 114
           R R    E        + V GC AQ   +E+      VD+V+G +    +   + KA+ +
Sbjct: 76  RLRVMRQERTPDKPLTVGVTGCVAQAEGSEILRRAPIVDLVIGPQMYHRLPELLEKAK-Q 134

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKT------RAFLKIQDGCNRFCAYCLIPYTRGSV 168
           GK+ ++    +++K      +  +N +        AFL +Q+GC++FC +C++PYTRG+ 
Sbjct: 135 GKKIIETDYAVEDKFAH---LPPHNKRAVRKRGVSAFLTVQEGCDKFCTFCVVPYTRGAE 191

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIER 226
            S+  +++ +E R L E G KEI L G +   + G   D K   L DLL  + K+DG++R
Sbjct: 192 ISRSVEQITEEARQLIEAGVKEITLLGQNVNGWHGQSADGKTWRLGDLLYHLAKLDGLKR 251

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L  L P+ HL +QSG D  LK MNR++ +  Y  ++  +
Sbjct: 252 LRYTTSHPRDMDDSLIAAHRDLDMLMPYLHLPVQSGSDRILKAMNRQHKSSYYLHLIEKI 311

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R    D++ + D IVGFPG            ++++  S  + FKYSPR GT    M+N V
Sbjct: 312 RAARPDIAFSGDFIVGFPGETDEDFEETIKLIQQVQYSSAYSFKYSPRPGTVGATMKNHV 371

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
           D + KD R              F    IG+  DVL E+     SG   G +   + V   
Sbjct: 372 DESVKDARXXXXXXXXXXXXNTFLRSKIGQKTDVLIEKPGR-HSGQMVGRSPWLLPVVVD 430

Query: 407 ADCN----VSGKILNVKINSFEGEV 427
            + +    V   I N   NSF GE+
Sbjct: 431 TESSTGSVVEIHIKNASSNSFVGEM 455


>MIAB_RHILW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 469

 Score =  201 bits (510), Expect = 1e-53
 Identities = 140/451 (31%), Positives = 221/451 (49%), Gaps = 24/451 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S  M++   R+GYE  +  E AD+ ++NTC +     +K    +G
Sbjct: 23  KVFIKTYGCQMNVYDSTRMSDALARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALG 82

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R           E +I V GC AQ    E+      VDVV+G +    +   + +A+ 
Sbjct: 83  RLRDMKKKKAADGREMMIGVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAK- 141

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRA-----FLKIQDGCNRFCAYCLIPYTRGSV 168
           EG++ V     +++K FE L I E + K RA     FL +Q+GC++FC +C++PYTRGS 
Sbjct: 142 EGQRVVDTDYAIEDK-FEHLPIAE-SRKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSE 199

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIER 226
            S+   ++++E   L E G +EI L G +  ++       E  +L DLL  + +I G+ R
Sbjct: 200 VSRPVAQIVEEAEKLVEGGVREITLLGQNVNAWHGAGPRGEAWSLGDLLYRLAEIPGLAR 259

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L+ L P+ HL +QSG D  LK MNRR+TA EY  ++  +
Sbjct: 260 LRYTTSHPRDMDDRLIDAHRDLRALMPYLHLPVQSGSDRILKAMNRRHTAAEYLSLIARI 319

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R    D++++ D I GFPG            ++ +  ++   FKYS R GT    +++QV
Sbjct: 320 RTVRPDIALSGDFITGFPGETDADFEDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQV 379

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAK 406
                                 FAE  IG+ ID+L E+   +   +  G +     VN  
Sbjct: 380 PEQIXXXXXXXXXXXXXXXXXEFAESCIGKEIDLLLEKPGRMPEQL-IGRSPWLQSVNVD 438

Query: 407 ADCNVSGKILNVKI-----NSFEGEVAEGEI 432
           A  +  G I+ V+I     NS   E AE  +
Sbjct: 439 AKASQIGDIIKVRITGTGNNSLFAERAEAAV 469


>MIAB_HAES2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  201 bits (510), Expect = 1e-53
 Identities = 144/444 (32%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLNTHGLELTDVPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++QNP  +I V GC A      + S    VD+V G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKQNPSLVIGVGGCVASQEGEHIRSRAPYVDIVFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 SAVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGGICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  L+    ++ 
Sbjct: 242 IEFTDDIIDVYADTPELVSFLHLPVQSGSDRVLNLMKRNHTALEYKSIIRKLKKVRPNIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETDQDFEDTMNLIAQVNFDMSFSFIYSARPGTPAADMPDDVTEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN +A  F+   +G    VL E   +      TG T     VN     N+ 
Sbjct: 362 LYLLQQ--RINNQAAQFSRAMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFAGTPNMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  GEV   E
Sbjct: 420 GKFVDIKITDVYTNSLRGEVVRTE 443


>MIAB_HAES1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  201 bits (510), Expect = 1e-53
 Identities = 144/444 (32%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLNTHGLELTDVPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++QNP  +I V GC A      + S    VD+V G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKQNPSLVIGVGGCVASQEGEHIRSRAPYVDIVFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 SAVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGGICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  L+    ++ 
Sbjct: 242 IEFTDDIIDVYADTPELVSFLHLPVQSGSDRVLNLMKRNHTALEYKSIIRKLKKVRPNIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETDQDFEDTMNLIAQVNFDMSFSFIYSARPGTPAADMPDDVTEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN +A  F+   +G    VL E   +      TG T     VN     N+ 
Sbjct: 362 LYLLQQ--RINNQAAQFSRAMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFAGTPNMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  GEV   E
Sbjct: 420 GKFVDIKITDVYTNSLRGEVVRTE 443


>MIAB_CORDI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 516

 Score =  201 bits (510), Expect = 1e-53
 Identities = 119/387 (30%), Positives = 194/387 (50%), Gaps = 12/387 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE ++      GY  V   E  D+ V NTC+V    DK+    +G+   A
Sbjct: 23  TFGCQMNVHDSERLSGLLEEAGYHAVADGEEPDLVVFNTCAVRENADKRLYGTLGQLRSA 82

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + +NP   IAV GC AQ    T V+    VD V G+ N G +   ++++    + +V++ 
Sbjct: 83  KEKNPRMQIAVGGCLAQKDKDTVVAKAPWVDAVFGTHNMGALPSLLSRSEHNKRAEVEIV 142

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 143 DSLEQ--FPSVLPAKRESAYAGWVSVSVGCNNTCTFCIVPSLRGKEVDRRPGDILAEVQA 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLDE------KVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  +YGV+  +      +     LL    KI+G+ER+R  S  P  
Sbjct: 201 LVDQGVSEVTLLGQNVNAYGVNFSDPDIQRDRFAFSKLLRACGKIEGLERLRFTSPHPAE 260

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +     +CP  H+ LQSG D  LK M R Y +K++  I+  +R KI   SIT
Sbjct: 261 FTHDVIDAMAETPNVCPQLHMPLQSGSDKVLKEMRRSYRSKKFLGILEEVRAKIPHASIT 320

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   +  + F+YSPR GT A +  +QV      +R +
Sbjct: 321 TDIIVGFPGETEEDFQETLNVVEKARFTSAYTFQYSPRPGTPAADYADQVPKEVVQDRYE 380

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFE 383
           +L+ L          K IG  +++L +
Sbjct: 381 RLLALQERISTEENAKLIGTEVELLVQ 407


>MIAB_ACTPJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  201 bits (510), Expect = 1e-53
 Identities = 143/444 (32%), Positives = 218/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ D  E ADV ++NTCS+     +K    +
Sbjct: 3   KLHITTWGCQMNEYDSSKMADLLNSTHGLELTDKPEEADVLLLNTCSIREKAQEKVFSQL 62

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   +  P+ II V GC A      +      VD+V G +    +   +NK R   +
Sbjct: 63  GRWKNWKKDKPDLIIGVGGCVASQEGEHIRDRAPFVDIVFGPQTLHRLPEMINKIRGGDR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 AIVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+RVR  +  P
Sbjct: 181 LFEIAQLAEQGVREVNLLGQNVNAYRGETFDGGICTFAELLRLVAAIDGIDRVRYTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR+   ++ 
Sbjct: 241 IEFTDDIIEVYRDTPELVSFLHLPIQSGADRVLTMMKRNHTALEYKAIIRKLREVRPNIQ 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++++    +  F YS R GT A ++ + +   +K  R
Sbjct: 301 ISSDFIVGFPGETAEDFEQTMKVIEQVNFDMSFSFIYSARPGTPAADLPDDISEEEKKAR 360

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
             +L +  RIN +A  F+   +G    VL E   +      TG T N   VN +   ++ 
Sbjct: 361 LARLQQ--RINHQAMQFSRAMLGTEQRVLVEGPSKKDIMELTGRTENNRIVNFQGTPDMI 418

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  GEV   E
Sbjct: 419 GKFVDIKITDVYTNSLRGEVVRTE 442


>MIAB_METEP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  200 bits (509), Expect = 2e-53
 Identities = 140/447 (31%), Positives = 213/447 (47%), Gaps = 23/447 (5%)

Query: 1   MKVAFA-TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           MK A+  + GC++N Y++  M +    EGY   D  E ADV V+NTC +     +K    
Sbjct: 1   MKKAYVKSYGCQMNAYDAGRMADVLAAEGYSATDTVEEADVVVLNTCHIREKAAEKVYSE 60

Query: 60  IGRAR-------RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKA 111
           +GR R           +  I V GC AQ    E+ S    VDVV+G ++   +   + ++
Sbjct: 61  LGRLRVLKGERAESGHDTRIVVAGCVAQAEGREILSRAPAVDVVVGPQSYHRLPDLLRQS 120

Query: 112 RDEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
           R+      +  A  K   F+ L     N     FL +Q+GC++FCA+C++PYTRG+  S+
Sbjct: 121 RETRVVDTEFPAEDK---FDHLPARR-NRGVTGFLTVQEGCDKFCAFCVVPYTRGAEVSR 176

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY---GVDLDEKVTLVDLLEEIEKIDGIERVR 228
               V+DE R L E G +EI L G +  +Y   G D     TL  L++ +  + G+ R+R
Sbjct: 177 SVAAVVDEARRLVEGGVREITLIGQNVNAYHGNGPD-GAPATLGHLMDALSAVPGLLRLR 235

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P  F +D++        + P+ HL +QSG D  L  MNRR+T   Y  ++  +R+
Sbjct: 236 YTTSHPNDFADDLIAAHATNPLVMPYLHLPVQSGSDRILHAMNRRHTGDAYRRLIERIRN 295

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D+++++D IVGFPG            +  I  S    FKYSPR GT A   E+ V  
Sbjct: 296 ARPDIALSSDFIVGFPGETDADFAETMRLVSDIGFSAAFSFKYSPRAGTPAAEREDAVPE 355

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
             K ER   L +L      A+    +G + ++L  E+     G   G T +   V   A 
Sbjct: 356 AVKTERLAALQDLLDRQRHAYNAASVGTLTEILV-EKTGRHPGQVAGKTPHLQAVQFDAP 414

Query: 409 CNVSGKILNVKI-----NSFEGEVAEG 430
            +  G ++ V+I     NS  GE  EG
Sbjct: 415 ASTIGTVVPVRITRAGSNSLFGETLEG 441


>MIAB_BURP8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  200 bits (509), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLGAAEGLVKTDTPEDADVILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP  +I V GC A Q   + V+    VD+V G +    +   +++ R  G+
Sbjct: 64  GRVRELKEANPNLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDQRRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L     +  + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 PQVDITFPEIEK-FDHLPPARIDGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG----VDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L EI  LA+ G +E+ L G +  +Y     +   E      L+E +  I GIER+R  + 
Sbjct: 182 LTEIAGLADQGVREVTLLGQNVNAYRGAMTLGATEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+++      K 
Sbjct: 302 LSLSTDMIVGFPGETEEDFDKMMQLVHDMSYDTSFSFIYSPRPGTPAANLQDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
            R + L      N +  ++  +G+V  +L E           G T N   VN     +  
Sbjct: 362 RRLQHLQATIEENVQRISQAMVGKVERILVERPARKDPNELAGRTENNRVVNFPAPVETH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKI         GE+V+
Sbjct: 422 ARLIGQMIDVKIVHAYPHSLRGELVM 447


>MIAB_BURCJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (509), Expect = 2e-53
 Identities = 140/446 (31%), Positives = 211/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL----DEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALAAGSSEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVNHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +    + K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMGYDTSFSFIYSPRPGTPAANLADDTPRDVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+V+
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVI 447


>MIAB_BURCH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (509), Expect = 2e-53
 Identities = 141/446 (31%), Positives = 210/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT----LVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L    T       L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSTDIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMGYDTSFSFIYSPRPGTPAANLADDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURCC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (509), Expect = 2e-53
 Identities = 141/446 (31%), Positives = 210/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT----LVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L    T       L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSTDIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMGYDTSFSFIYSPRPGTPAANLADDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURCA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (509), Expect = 2e-53
 Identities = 141/446 (31%), Positives = 210/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT----LVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L    T       L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALTAGSTDIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  +    +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMGYDTSFSFIYSPRPGTPAANLADDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E           G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BACHD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 538

 Score =  200 bits (509), Expect = 2e-53
 Identities = 135/442 (30%), Positives = 214/442 (48%), Gaps = 16/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K    T GC++N ++SE M       G+E  D    ADV ++NTC++    + K    IG
Sbjct: 96  KFLVRTYGCQMNIHDSENMAGMLKEMGFEATDETTDADVILINTCAIRENAENKVFGEIG 155

Query: 62  ---RARRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
              + +R+ PE +I V GC +Q   +    +   + +D++ G+ N   + + +  A   G
Sbjct: 156 NLKQLKREKPELVIGVCGCMSQEEGVVNRIMQKHQHIDMIFGTHNIHRLPHLLRNALF-G 214

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K+ +      +  + E++       KT+A++ I  GC++FC YC++PYTRG   S+ P+ 
Sbjct: 215 KEMIIEVWSKEGDIVENMP-RAREGKTQAWVNIMYGCDKFCTYCIVPYTRGKERSRRPED 273

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLE-EIEKIDGIERVRIGSIDP 234
           ++ E+R LA  G+KEI L G +  +Y                EI KID I RVR  +  P
Sbjct: 274 IIQEVRDLARQGYKEITLLGQNVNAYXXXXXXXXXXXXXXXXEIRKID-IPRVRFTTSHP 332

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F + ++  +     L  H HL +Q G    LK M R+YT ++Y ++   ++  I + S
Sbjct: 333 RDFDDHLIEVLAKGGNLVEHIHLPVQHGNSEILKLMARKYTREQYVELAQKIKRAIPNAS 392

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
            TTD+IVGFP             ++ I       + YSPR+GT A  M++ V    K ER
Sbjct: 393 FTTDLIVGFPNETDEQFEDTLSLVREIEFDSAFTYIYSPREGTPAAKMKDNVPMEVKRER 452

Query: 355 SKKLIELNRINEKAFAEK---YIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
              L  LN +     A+K   Y  +V++VL E E +    +  G TR    VN K   +V
Sbjct: 453 ---LARLNALVNDISAQKNLEYQDKVVEVLVEGESKKDPNILAGRTRTNRLVNFKGPKSV 509

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            G I+ VK+   +     GE+V
Sbjct: 510 IGDIVYVKVTEAKTWSLNGEMV 531


>MIAB_ANASP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  200 bits (509), Expect = 2e-53
 Identities = 129/437 (29%), Positives = 209/437 (47%), Gaps = 16/437 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       G++  +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 12  TFGCQMNKADSERMAGILEDMGFKFSEDPNNADLILYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P+  + V GC AQ      +  +  +D+V+G ++   +   +      G Q V   
Sbjct: 72  KHEQPDLTLVVAGCVAQQEGEALLRRVPELDLVMGPQHANRLKDLLESVF-AGNQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           AV    + ED+     ++   A++ +  GCN  C YC++P  RG   S+ P  V  E+  
Sbjct: 131 AV---HIMEDITQARRDSTVTAWVNVIYGCNERCTYCVVPNVRGVEQSRTPAAVRAEMEE 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV-------TLVDLLEEIEKIDGIERVRIGSIDPT 235
           L   G+KEI L G +  +YG DL           T  DLL  +  + G+ER+R  +  P 
Sbjct: 188 LGRQGYKEITLLGQNIDAYGRDLPGATPEGRHLHTFTDLLYYVHDVPGVERIRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I++ +R  + D SI
Sbjct: 248 YFTERLIKACAELPKVCEHFHIPFQSGDNQLLKAMARGYTQEKYRRIIDTIRRYMPDASI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            +  I   + +   YSPR GT A   ENQ+    K +R 
Sbjct: 308 SADAIVGFPGETEEQFENTLKLVDDIGFDQLNTAAYSPRPGTPAALWENQLSEEVKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L  +     +++Y+G + +VL EE+         G T        K D + + G+
Sbjct: 368 QRLNHLVNVKAAERSQRYMGRIEEVLVEEQNPKDQTQVMGRTGGNRLTFFKGDIHELKGQ 427

Query: 415 ILNVKINSFEGEVAEGE 431
           ++ VKIN        GE
Sbjct: 428 LVMVKINEVRAFSLTGE 444


>MIAB_SALPK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  200 bits (508), Expect = 2e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTSHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  200 bits (508), Expect = 2e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTSHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SACEN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 491

 Score =  200 bits (508), Expect = 2e-53
 Identities = 127/432 (29%), Positives = 208/432 (48%), Gaps = 17/432 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE +       GY     +   DV V NTC+V    D +    +G    A
Sbjct: 9   TYGCQMNVHDSERLAGMLEDAGYVRAGTDVDPDVVVFNTCAVRENADNRLYGNLGHLRPA 68

Query: 64  RRQNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + +NP   IAV GC AQ    E V     VDVV G+ N G +   + +AR   + +V++ 
Sbjct: 69  KDRNPGMQIAVGGCLAQKDRGEIVKRAPWVDVVFGTHNLGSLPTLLERARHNEEAEVEIL 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L   VF         +    ++ +  GCN  C +C++P  RG    + P ++L E+++
Sbjct: 129 ESLD--VFPSTLPARRESAYSGWVSVSVGCNNTCTFCIVPALRGKEKDRRPGEILSEVQA 186

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L   G  E+ L G +  +YGV+  ++     LL    +I+G+ERVR  S  P  FT+DV+
Sbjct: 187 LVSEGVLEVTLLGQNVNAYGVEFGDRFAFGKLLRSCGEIEGLERVRFTSPHPRDFTDDVI 246

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     +C   H+ LQSG D  LK+M R Y ++ Y DI+  +R+ + D +ITTD+IVG
Sbjct: 247 AAMAETPNVCHQLHMPLQSGSDRVLKQMRRSYRSQRYLDILRKVREAMPDAAITTDIIVG 306

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    +    F+YS R GT A  ME Q+      +R  +LIEL 
Sbjct: 307 FPGETEEDFEATMQVVREARFASAFTFQYSKRPGTPAAEMEGQLPKEVVQQRYDRLIELQ 366

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN-VKIN 421
                   ++ +G  +++L  E          G  R   + +  +     G++++   + 
Sbjct: 367 NQISWDVGKELVGRSVELLVAE----------GEGRKDTETHRLSGRARDGRLVHFTPVG 416

Query: 422 SFEGEVAEGEIV 433
           + +G+V  G++V
Sbjct: 417 AVDGQVRPGDVV 428


>MIAB_NEIM0 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  200 bits (508), Expect = 2e-53
 Identities = 143/441 (32%), Positives = 207/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+S+ M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    +NP  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYCGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLHDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  IG V   L E   +         T N   VN     N+  
Sbjct: 361 RLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQLQARTANNRVVNFTGTPNMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G+V E
Sbjct: 421 QMIDLEITEAYTFSLRGKVVE 441


>MIAB_LYSSC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  200 bits (508), Expect = 2e-53
 Identities = 126/421 (29%), Positives = 215/421 (51%), Gaps = 10/421 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N +++E M   F++ GY   +  E ADV ++NTC++    + K    +G   + 
Sbjct: 74  TYGCQMNEHDTEVMAGIFMQLGYTPTEIIEEADVVLLNTCAIRENAENKVFGELGFLLKY 133

Query: 64  RRQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
           +R+NPE +I V GC +Q   +    +     VD+V G+ N   +   + +A    +  V+
Sbjct: 134 KRKNPEMLIGVCGCMSQEESVVNKILRSYPHVDMVFGTHNIHRLPNILKEAYMSKEMVVE 193

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V +  +  V E+L  +   +  +A++ I  GC++FC YC++PYTRG   S+ P++++ E+
Sbjct: 194 VWSK-EGDVIENLPKKRLGS-IKAWVNIMYGCDKFCTYCIVPYTRGKERSRRPEEIIAEV 251

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDE-KVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           R LA  G++EI+L G +  +YG D ++ +  L DL++ + KID I R+R  +  P  F +
Sbjct: 252 RELAAAGYQEIMLLGQNVNAYGKDFEDIEYRLGDLMDALRKID-IPRIRFTTSHPRDFDD 310

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
            ++  +     L  H HL +QSG +  LK M R+YT + +  +V  ++  I +V++TTD+
Sbjct: 311 HLIEVLAKRGNLVEHIHLPVQSGSNDILKIMARKYTREHFLTLVEKIKAAIPEVTLTTDI 370

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVG+P              + +       + YSPR+GT A  M + V    K ER ++L 
Sbjct: 371 IVGYPNETEEQFEETLSLYREVGFEAAFTYIYSPREGTPAAKMVDNVPEEVKKERLQRLN 430

Query: 360 ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
           E+     +                   +    V  GYTR    VN K    V G+++ VK
Sbjct: 431 EVVGEYSRKAXXXXXXXXXXXXXXGTSKRRDDVLAGYTRKNRLVNFKGPAEVIGQLVKVK 490

Query: 420 I 420
           I
Sbjct: 491 I 491


>MIAB_BURVG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 139/446 (31%), Positives = 212/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P  +I V GC A Q   + VS    VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRELKEAKPGLLIGVGGCVASQEGASIVSRAPYVDLVFGPQTLHRLPQMIDARRASGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD----EKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y   L     +      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGALSAGSADIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    D
Sbjct: 242 HPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPD 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDMIVGFPGETEDDFDKMMALVHEMSYDTSFSFIYSPRPGTPAANLHDDTPREVKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC--- 409
           +R + L      N    ++  +G+V  +L E          +G T N   VN  A     
Sbjct: 362 KRLQHLQATIEENVARISQSMVGKVERILVEGPSRKDPNELSGRTENNRVVNFPAPLASH 421

Query: 410 -NVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE++L
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELLL 447


>MIAB_BURPS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURP6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURP0 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURMS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURMA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURM9 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BURM7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  200 bits (508), Expect = 2e-53
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++TD+IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BRUSU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMKDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BRUO2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMKDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLAVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BRUC2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMKDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BRUAB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMRDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BRUA2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMRDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BRUA1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  200 bits (508), Expect = 2e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMRDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_THELT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 436

 Score =  199 bits (507), Expect = 3e-53
 Identities = 124/400 (31%), Positives = 205/400 (51%), Gaps = 12/400 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+V F T GC++N  ++E M     + GYEVV+  E AD+ ++NTC V     +K    +
Sbjct: 1   MRVFFKTYGCQMNLNDTETMAGILSQHGYEVVNLPEEADIVILNTCVVRQKSQEKYHSAL 60

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           G+                GC + +   E+    G D V+GSR+ G+I   + KA     +
Sbjct: 61  GQFVXXXXXXXXXXXXXAGCGSNLEGEELIK-SGADFVIGSRSIGKIAEVLQKAA----R 115

Query: 118 QVKVGAVLKNKVFEDLKIEEYN-NKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             K+  +  +    D K      +K  A++ I  GCNRFC YC++PYTRG   S+    V
Sbjct: 116 GEKIVYLEDDICTVDSKTPRMRFSKHHAWITIIHGCNRFCTYCIVPYTRGREKSRPLPDV 175

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L E+  LA++G KEI   G +  +YG DL +   L  L+E+  K + I+R+   +  PT 
Sbjct: 176 LLEVEKLAKNGVKEITFLGQNVDAYGKDLKDGTNLASLIEQAGKFEQIKRIWFLTSYPTD 235

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
            T+ ++  +    K    FH+ +QSG +  L+ MNRRY   ++  +V  +R KI   SI+
Sbjct: 236 ITDKLIETVAEDPKAAKSFHIPVQSGSNRILRLMNRRYDRDQFLQLVEKIRSKIPHASIS 295

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAEN-MENQVDGNKKDERS 355
           +D+IVGFP             +++    + ++  YSPR+GT A    ++ V   +K +R 
Sbjct: 296 SDIIVGFPTETEYDYMQTMDLVRKARFERLNLAVYSPRQGTVASKYFKDDVPREEKVQRL 355

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTG 395
            KL+EL +   +    +Y+G+V++++ E + +   G+Y G
Sbjct: 356 NKLLELQKQINRELNMQYLGKVVEIIVEGKTK--EGLYYG 393


>MIAB_SALAR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (507), Expect = 3e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETSDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGSTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_PROMA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 466

 Score =  199 bits (507), Expect = 3e-53
 Identities = 130/431 (30%), Positives = 215/431 (49%), Gaps = 20/431 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY+       AD+ + NTC++ +  ++K    +GR    
Sbjct: 27  TFGCQMNKADSERMAGILQAMGYQKAKTELCADLVLYNTCTIRDNAEQKVYSYLGRQAIR 86

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++ +P   + V GC AQ    + +  +  +D+V+G ++   +   +N+  D G+Q V   
Sbjct: 87  KKSSPHLKLVVAGCVAQQEGESLLRRVPELDLVMGPQHANRLEDLLNQV-DNGQQVV--- 142

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  ++ + EDL     ++   A++ +  GCN  C YC++P  RG   S++PK +  EI  
Sbjct: 143 ATEEHLILEDLTAARRDSNICAWVNVIYGCNERCTYCVVPSVRGKEQSREPKAIKLEIED 202

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA+ GFKE+ L G +  +YG DL         + TL DLL  I  I+GI R+R  +  P 
Sbjct: 203 LAKKGFKEVTLLGQNIDAYGRDLPGISSSGRRENTLTDLLYFIHDINGINRIRFATSHPR 262

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FT  ++     L KLC HFH+  QSG +  LKRM R YT ++Y  I++ +R+ + + SI
Sbjct: 263 YFTTRLIEACAELPKLCEHFHIPFQSGDNEVLKRMGRGYTIEKYRRIIDKIRELMPNSSI 322

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++DVIV FPG            ++ I   + +   YS R  T A +   Q+  + K +R 
Sbjct: 323 SSDVIVAFPGEDESQFQNTLKIIREIGFDQVNTAAYSQRPNTPAASWAEQLPESVKIDRL 382

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFE-----EEVELGSGVYTGYTRNYIKVNAKADCN 410
           K+L  L     K    +Y  ++++VL E      + +L     T     + K+  K    
Sbjct: 383 KELNLLVEQTAKDKNTRYHNQIVEVLAEGINPKNQEQLMGRTRTNRLTFFSKIGPKKYSY 442

Query: 411 VSGKILNVKIN 421
             G ++ VKI+
Sbjct: 443 NPGDLVKVKIS 453


>MIAB_JANMA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  199 bits (507), Expect = 3e-53
 Identities = 137/443 (30%), Positives = 217/443 (48%), Gaps = 12/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     EG    D  E ADV ++NTCSV     +K    +
Sbjct: 4   KIYIKTFGCQMNEYDSDKMVDVLNASEGLIKTDTPEDADVILLNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP+ +I V GC A Q     V     VD+V G +    +   + + R  G+
Sbjct: 64  GRLRELKFNNPDLVIGVGGCVASQEGDAIVKRAPYVDLVFGPQTLHRLPEMLKQRRSTGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ +   +    T AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 124 SQVDISFPEIEK-FDHMPPAKVEGAT-AFVSIMEGCSKYCSYCVVPYTRGEEVSRRFEDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL--DEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  L   G KEI L G +  +Y  ++   E      L+E I +++GIER+R  +  P
Sbjct: 182 LAEVAGLEAQGVKEITLLGQNVNAYRGEMADGEIADFALLIEYIAELEGIERIRFVTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+ ++     + KL  H +L  Q G D  L  M R YT+ EY+ I+  LR+   ++S
Sbjct: 242 KEFTQRLIDAYAKVPKLVNHLYLPAQHGSDRILAAMKRGYTSLEYKSILRRLREVRPNIS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    +  F +SPR GT A N+E+      K +R
Sbjct: 302 ISSDFIVGFPGETDADFEAMMKLINDIGYDNSFSFIFSPRPGTPAANLEDDTPHEVKLQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA---DCNV 411
            ++L  +   N + ++++ +G V  +L E   +       G T N   VN  A      +
Sbjct: 362 LQRLQAVIDQNTRRYSDEMVGTVQRILVEGPSKKDPDELQGRTENNRVVNFAAGEHGARL 421

Query: 412 SGKILNVKINSFEGEVAEGEIVL 434
            G++++V I         GEI++
Sbjct: 422 IGQMVDVNIVQSFAYTLRGEIIV 444


>MIAB_GLOVI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  199 bits (507), Expect = 3e-53
 Identities = 124/423 (29%), Positives = 214/423 (50%), Gaps = 15/423 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG---RA 63
           T GC++N  +SE M       GY +VD ++ AD+ + NTC++ +  ++K    +G   R 
Sbjct: 16  TFGCQMNKADSERMAGALTHLGYRIVDESDTADLVLFNTCTIRDNAEQKVYSYLGQQARR 75

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++++P   + + GC AQ    ++   +  +D+V+G ++   +   + +   EG+Q V   
Sbjct: 76  KQRDPHITLVLAGCVAQQEGEKLLRRVPELDLVMGPQHVNRLSDLLERVA-EGEQVVATE 134

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +   ++ ED+     ++   A+  I  GCN  C YC++P  RG   S+ P+ +  EI  
Sbjct: 135 PI---EILEDITKPRRDSAVTAWANIIYGCNEGCTYCIVPSVRGREQSRTPEAIKAEICE 191

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L   G+KE+ L G +  +YG D+     L  LL  I    GIER+R  +  P +F+++++
Sbjct: 192 LGASGYKEVTLLGQNIDAYGRDIG--TNLASLLRFIHNAPGIERLRFATSHPRYFSDELI 249

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                L K+C HFH+  QSG +  L+RM R YT ++Y  I+  +R  + D +I+ D+IVG
Sbjct: 250 ATCAELPKVCEHFHIPFQSGDNEVLRRMARGYTHEKYRAIIEKIRAILPDAAISADLIVG 309

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            +  +     +   YSPR GT A     Q+D   K +R ++   L 
Sbjct: 310 FPGETEAQFENSLRLVDELEFDALNTAAYSPRPGTPAARWPGQLDDEVKQDRLQRTNRL- 368

Query: 363 RINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTR-NYIKVNAKADCNVSGKILNVK 419
            + +KAF  +++Y+G    VL EE          G TR N +   A     + G++++V+
Sbjct: 369 -VAQKAFERSQRYLGRTEQVLVEETNPRDRSQVVGRTRTNRLVFFAGELAKLRGQLVDVQ 427

Query: 420 INS 422
           I +
Sbjct: 428 ITA 430


>MIAB_CYAP7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  199 bits (507), Expect = 3e-53
 Identities = 130/439 (29%), Positives = 212/439 (48%), Gaps = 16/439 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY+  D    AD+ + NTC++ +  ++K    +GR    
Sbjct: 12  TFGCQMNKADSERMAGILEDIGYQWSDDPNEADLVLYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P+  + V GC AQ    ++   +  +D+V+G ++   +   + +    G Q V   
Sbjct: 72  KHEKPDLTLIVAGCVAQQEGEKLLRRVPELDLVMGPQHANRLQDLLQEVL-AGNQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +    + ED+      +   A++ +  GCN  C YC++P  RG   S+ P+ +  E+  
Sbjct: 131 PI---HIVEDITKPRRESTVTAWVNVIYGCNERCTYCVVPNVRGVEQSRTPQAIRAEMVE 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           L + G+KEI L G +  +YG DL         + TL DLL  +  + GIER+R  +  P 
Sbjct: 188 LGQQGYKEITLLGQNIDAYGRDLPGVTESGRHQHTLTDLLYYVNDVPGIERIRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG +  LK M R YT + Y  I++ +R+ + D SI
Sbjct: 248 YFTERLIVACKELPKVCEHFHIPFQSGDNDLLKAMKRGYTHERYRQIIDKIREYMPDASI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            ++ I   + +   YSPR GT A   +NQ+    K +R 
Sbjct: 308 SADAIVGFPGETEAQFENTLKLVEDIGFDQLNTAAYSPRPGTPAALWDNQLSEEVKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-VSGK 414
           ++L  L  I     +++Y+G + +VL E+          G TR         D N + G+
Sbjct: 368 QRLNHLVAIKAAERSQRYLGRIEEVLVEDVNPKDLTQVMGRTRGNRLTFFTGDINQLKGQ 427

Query: 415 ILNVKINSFEGEVAEGEIV 433
           ++ VKI         GE V
Sbjct: 428 LVEVKITDVRAFSLTGEPV 446


>MIAB_CORGL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 522

 Score =  199 bits (507), Expect = 3e-53
 Identities = 130/438 (29%), Positives = 211/438 (48%), Gaps = 23/438 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N ++SE ++      GY     +   D+ V NTC+V    D +    +G  R  
Sbjct: 30  TYGCQMNVHDSERLSGLLEEAGYVAAPEDTTPDLVVFNTCAVRENADMRLYGTLGNLRSV 89

Query: 65  -RQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
             +NP   IAV GC AQ    T V     VDVV G+ N G +   + +A    + +V++ 
Sbjct: 90  KEKNPGMQIAVGGCLAQKDKDTVVKKAPWVDVVFGTHNIGSLPTLLQRAEHNAQAEVEIV 149

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 150 DSLEQ--FPSVLSAKRESAYAGWVSVSVGCNNTCTFCIVPSLRGKEQDRRPGDILAEVQA 207

Query: 183 LAEHGFKEIILSGIHTASYGVDL------DEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  +YGV+        ++     LL    +I+G+ERVR  S  P  
Sbjct: 208 LVDQGVTEVTLLGQNVNAYGVNFVDPELERDRSAFSKLLRACGEIEGLERVRFTSPHPAE 267

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +     +CP  H+ LQSG D  LK M R Y +K++  I++ +R KI   SIT
Sbjct: 268 FTSDVIDAMAETPNICPQLHMPLQSGSDKVLKEMRRSYRSKKFLSILDEVRAKIPHASIT 327

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +K+   +  + F+YSPR GT A   ENQ+      ER +
Sbjct: 328 TDIIVGFPGETEEDFQATLDVVKKARFTSAYTFQYSPRPGTPAAEYENQLPKEVVQERYE 387

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           +L+            K IG  +++L    V+ G G     T+   +++ +A     G+++
Sbjct: 388 RLMXXXXXXXXXXXXKLIGTTVELL----VQAGGGRKNDATK---RMSGRAR---DGRLV 437

Query: 417 N-VKINSFEGEVAEGEIV 433
           +       +GE+  G+ V
Sbjct: 438 HFAPEGDIDGEIRPGDFV 455


>MIAB_CHRVO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  199 bits (507), Expect = 3e-53
 Identities = 140/442 (31%), Positives = 212/442 (47%), Gaps = 14/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 3   KVYIKTFGCQMNEYDSDKMADVLGSAEGMVKTDNPEEADVILFNTCSVREKAQEKVFSDL 62

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP+ II V GC A Q     V     VDVV G +    +   +   +  G+
Sbjct: 63  GRIRPLKEANPDLIIGVGGCVASQEGDAIVKRAPFVDVVFGPQTLHRLPDLIESRKQSGR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ +   + +    AF+ I +GC+++C++C++PYTRG   S+  + V
Sbjct: 123 SQVDISFPEIEK-FDHIPPAKVDGGA-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G KEI L G +  +Y G+  D ++     LLE + ++ G+ER+R  +  P
Sbjct: 181 LTEIAGLAAQGVKEITLLGQNVNAYRGLMSDGEIADFALLLEYVHEVPGVERIRFTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F++ ++     L KL  H HL +QSG D  L  M R YT  EY+ I+  LR    D+ 
Sbjct: 241 REFSQRIIDCYAKLPKLVSHLHLPVQSGSDRVLMAMKRGYTGLEYKSIIRKLRAIRPDLC 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            ++      + +F YSPR GT A N+ +     +K  R
Sbjct: 301 LSSDFIIGFPGETEADFEQTLKLVRDCEFDFSFVFIYSPRPGTPAANLPDDTPHAEKVRR 360

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L E+      A  +  +G V  VL E   +  + +    T N   VN      + G+
Sbjct: 361 LEALNEVIEAKGYAINQSMVGTVQRVLVENVSKKDATMLAARTANNRVVNFAGHPRLLGR 420

Query: 415 ILNVKI-----NSFEGEVAEGE 431
           ++ VKI     +S  GE    E
Sbjct: 421 MIEVKITAAFPHSLAGEALTSE 442


>MIAB_BRUSI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  199 bits (507), Expect = 3e-53
 Identities = 131/435 (30%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMKDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI R+
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIARL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRLGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_SALTY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALTI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALSV RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALPB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALNS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALHS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALG2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETNDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALEP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETNDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALDC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALCH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SALA4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 141/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWRLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKNIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_NEIG2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  199 bits (506), Expect = 4e-53
 Identities = 142/441 (32%), Positives = 207/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+SE M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSEKMLSVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    +NP  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLPDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  IG V   L E   +         T N   VN     ++  
Sbjct: 361 RLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQLQARTANNRVVNFTGTPDMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G++ E
Sbjct: 421 QMIDLEITEAYTFSLRGKIVE 441


>MIAB_HAEIN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 142/444 (31%), Positives = 220/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++ NP  +I V GC A      +      VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +Q+G D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRAHTALEYKSIIRKLRAVRPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V  ++K +R
Sbjct: 302 ISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSARPGTPAADMPDDVTEDEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A  F+ + +G    VL E   +      TG T     VN +    + 
Sbjct: 362 LYVLQE--RINQQAAQFSRRMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFQGSPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++VKI     NS  GEV   E
Sbjct: 420 GKFVDVKITDVYTNSLRGEVVRTE 443


>MIAB_HAEIG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (506), Expect = 4e-53
 Identities = 142/444 (31%), Positives = 220/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++ NP  +I V GC A      +      VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +Q+G D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRAHTALEYKSIIRKLRAVRPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V  ++K +R
Sbjct: 302 ISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSARPGTPAADMPDDVTEDEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A  F+ + +G    VL E   +      TG T     VN +    + 
Sbjct: 362 LYVLQE--RINQQAAQFSRRMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFQGSPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++VKI     NS  GEV   E
Sbjct: 420 GKFVDVKITDVYTNSLRGEVVRTE 443


>MIAB_CORJK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  199 bits (506), Expect = 4e-53
 Identities = 121/389 (31%), Positives = 196/389 (50%), Gaps = 12/389 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N ++SE ++      GY         DV V NTC+V    DK+    +G+ +  
Sbjct: 23  TFGCQMNVHDSERLSGLLEDSGYVPASEGVTPDVVVFNTCAVRENADKRLYGTLGQMKAI 82

Query: 66  --QNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
             ++P   IAV GC AQ    T V     VDVV G+ N G +   + ++    K +V++ 
Sbjct: 83  KDEHPGMQIAVGGCMAQKDKQTVVDKAPWVDVVFGTHNLGSLPTLLERSAHNHKAEVEIF 142

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P ++L E+++
Sbjct: 143 DALEE--FPSVLPAKRESAYAGWVSVSVGCNNTCTFCIVPSLRGKEQDRRPGEILAEVKA 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVD------LLEEIEKIDGIERVRIGSIDPTF 236
           L E G  E+ L G +  +YGV+  ++    D      LL    +I+G+ER+R  S  P  
Sbjct: 201 LVEQGVSEVTLLGQNVNAYGVNFADETLERDRTAFSKLLRACGEIEGLERLRFTSPHPAE 260

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  LK M R Y +K++  I++ +R++I   +IT
Sbjct: 261 FTDDVIDAMAETPAVCPQLHMPLQSGSDKVLKDMKRSYRSKKFLAILDKVRERIPHAAIT 320

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   S    F+YSPR GT A  MENQV      +R +
Sbjct: 321 TDIIVGFPGETEEDFQATLDVVEKARFSSAFTFQYSPRPGTPAAEMENQVPKAVVQDRYE 380

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEE 385
           +L+ L     +    K IG   ++L + +
Sbjct: 381 RLLALQERISEEENRKLIGTTQELLVQAD 409


>MIAB_CORGB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 526

 Score =  199 bits (506), Expect = 4e-53
 Identities = 130/438 (29%), Positives = 211/438 (48%), Gaps = 23/438 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N ++SE ++      GY     +   D+ V NTC+V    D +    +G  R  
Sbjct: 34  TYGCQMNVHDSERLSGLLEEAGYVAAPEDATPDLVVFNTCAVRENADMRLYGTLGNLRSV 93

Query: 65  -RQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
             +NP   IAV GC AQ    T V     VDVV G+ N G +   + +A    + +V++ 
Sbjct: 94  KEKNPGMQIAVGGCLAQKDKDTVVKKAPWVDVVFGTHNIGSLPTLLQRAEHNAQAEVEIV 153

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 154 DSLEQ--FPSVLPAKRESAYAGWVSVSVGCNNTCTFCIVPSLRGKEQDRRPGDILAEVQA 211

Query: 183 LAEHGFKEIILSGIHTASYGVDL------DEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  +YGV+        ++     LL    +I+G+ERVR  S  P  
Sbjct: 212 LVDQGVTEVTLLGQNVNAYGVNFVDPELERDRSAFSKLLRACGEIEGLERVRFTSPHPAE 271

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +     +CP  H+ LQSG D  LK M R Y +K++  I++ +R KI   SIT
Sbjct: 272 FTSDVIDAMAETPNICPQLHMPLQSGSDKVLKEMRRSYRSKKFLSILDEVRAKIPHASIT 331

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +K+   +  + F+YSPR GT A   ENQ+      ER +
Sbjct: 332 TDIIVGFPGETEEDFQATLDVVKKARFTSAYTFQYSPRPGTPAAEYENQLPKEVVQERYE 391

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           +L+            K IG  +++L    V+ G G     T+   +++ +A     G+++
Sbjct: 392 RLMXXXXXXXXXXXXKLIGTTVELL----VQAGGGRKNDATK---RMSGRAR---DGRLV 441

Query: 417 N-VKINSFEGEVAEGEIV 433
           +       +GE+  G+ V
Sbjct: 442 HFAPEGDIDGEIRPGDFV 459


>MIAB_BORA1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  199 bits (506), Expect = 4e-53
 Identities = 137/443 (30%), Positives = 215/443 (48%), Gaps = 15/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +    + G E+ D  E ADV + NTCSV     +K    +
Sbjct: 28  KIYIRTFGCQMNEYDSDKMVDVLREDQGLEMTDNPEEADVILFNTCSVREKAQEKVFSDL 87

Query: 61  GRA---RRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++ NP  +I V GC A Q     V     VDVV G +    +   + + RDEG 
Sbjct: 88  GRVQHLKKLNPNLVIGVGGCVASQEGAAIVKRAPYVDVVFGPQTLHRLPELIRRRRDEGV 147

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+++        T AF+ I +GC+++C++C++PYTRG   S+  + V
Sbjct: 148 SQVDISFPEIEK-FDNMPPSRVEGAT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPFEDV 205

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LA+ G +E+ L G +  +Y   ++    + D   LLE + +I GIER+R  +  
Sbjct: 206 LTEVADLADQGVREVTLLGQNVNAYRGRIEGSDEIADFAMLLEYVHEIPGIERIRYTTSH 265

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P   T+ +V     L KL    HL +Q+G D  L  M R YTA E++ +V  LR    ++
Sbjct: 266 PKEMTQRMVEAYARLPKLVSFLHLPVQAGSDRVLAAMKRGYTALEFKSVVRKLRAARPNL 325

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++++D IVGFPG            +  +    +  F YS R GT A ++++    + K +
Sbjct: 326 TLSSDFIVGFPGETEEDFQKTMKLIADVGFDTSFSFVYSRRPGTPAADLQDDTPQDVKLK 385

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R ++L  L      A A+  +G    +L E           G T N   VN +    + G
Sbjct: 386 RLQQLQALINEQAAAIAQSMVGTRQRLLVEGPSRRDPNELMGRTENNRIVNFEGPSRLIG 445

Query: 414 KILNVKI-----NSFEGEVAEGE 431
            +++V I     NS  G VA  E
Sbjct: 446 NMVDVIITHAFTNSLRGRVAGTE 468


>MIAB_RHOS4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 436

 Score =  199 bits (505), Expect = 5e-53
 Identities = 133/434 (30%), Positives = 216/434 (49%), Gaps = 16/434 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    +GY + +  E AD+ ++NTC +     +K    +G
Sbjct: 6   KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLG 65

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R R      P+  I V GC AQ    E+   +  VD+V+G ++   +   +   R EG  
Sbjct: 66  RLRPLKTAKPDLKIGVAGCVAQAEGEEILKRMPLVDLVVGPQSYHRLPDMLE--RTEGGA 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +V      +   F+ L   +      AFL +Q+GC++FCA+C++PYTRG+  S+   +++
Sbjct: 124 RVVDTDFPEEDKFDHLPERKATRGPAAFLTVQEGCDKFCAFCVVPYTRGAEVSRPFARLM 183

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E R L E G +EI L G +  ++  D      L  L+ E+ +IDG+ER+R  +  P   
Sbjct: 184 AEARGLVERGVREITLLGQNVNAWSND---GRGLGGLIRELARIDGLERLRYTTSHPNDM 240

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            +D++    A  KL P+ HL +QSG D  LK MNR++TA+ Y  ++  +R    D+ +T+
Sbjct: 241 ADDLIEAHGAEPKLMPYLHLPVQSGSDRILKAMNRKHTAEHYLRLIERIRAARPDILLTS 300

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D IVGFPG            ++ +       FKYS R GT A   + ++     D R ++
Sbjct: 301 DFIVGFPGETEADFEATLDLIRAVGFGSAFSFKYSARPGTPAAE-KPELPAEVCDARLQR 359

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L  L    ++A     +G  + VL+E+   L  G   G + +   V+ +      G ++ 
Sbjct: 360 LQALVTEQQRAAQMAMVGREVGVLYEKAGRL-PGQMVGKSDHLHAVHVEDKAGQVGDLVR 418

Query: 418 VKI-----NSFEGE 426
           V+I     NS  GE
Sbjct: 419 VRITASAPNSLAGE 432


>MIAB_ORITB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  199 bits (505), Expect = 5e-53
 Identities = 136/444 (30%), Positives = 227/444 (51%), Gaps = 25/444 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+S  M +    +GY +V     A V ++NTC +     +K    +GR ++ 
Sbjct: 9   TYGCQMNVYDSNRMVDLLETQGYNIVANMADASVIILNTCHIREKASEKMYSELGRIKKL 68

Query: 67  NP--------EAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
                     +A I V GC  Q    E+   E  V++++G ++   +   + K  D G +
Sbjct: 69  QQSRLKAGKSKAKIIVAGCVGQAEGEEIFIREPAVNIIVGPQSYYNLPTMLEKL-DSGTE 127

Query: 118 QVKVG-----AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              +      A   NK+ E LK    +      + +Q+GC++FC +C++PYTRG+  S+ 
Sbjct: 128 NHLIDLDFVEAAKFNKLPEVLK----SPTVSGLVSVQEGCDKFCTFCVVPYTRGAEFSRP 183

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEK-VTLVDLLEEIEKIDGIERVRIG 230
            ++V  E+ ++A+ G KE++L G + ++Y G D + K  +L DL++ + KID I+R+R  
Sbjct: 184 LEQVYREVLNIAQQGAKEVVLVGQNVSAYHGKDENGKECSLADLIKYVAKIDKIKRIRYI 243

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+ ++      +KL P  HL +QSG +  LK MNRR+T + Y +I+  LR+  
Sbjct: 244 TSHPNDMTDQLLSLHATEEKLMPFLHLPVQSGSNKILKLMNRRHTRERYLEIIQQLRELR 303

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ I++D+IVGFPG             K     + + FKYS R GT A  ++ Q+    
Sbjct: 304 PDIVISSDIIVGFPGEDDEDFEATLSLAKEAKFGQCYSFKYSQRPGTPAA-VKQQISEEV 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K  R   L     + +    +K IG+V+ VLF+ + +    +   T Y ++   +N K D
Sbjct: 363 KQHRLSILQAQLMLQQLECNQKLIGKVVPVLFDRDGKYDGQIIGKTPYMQSVCIMNEK-D 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEI 432
            N+ GKI+NVKI S       GE+
Sbjct: 422 NNLYGKIVNVKILSASASSLFGEV 445


>MIAB_ECO81 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  199 bits (505), Expect = 5e-53
 Identities = 140/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_CLAMS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 530

 Score =  199 bits (505), Expect = 5e-53
 Identities = 132/431 (30%), Positives = 209/431 (48%), Gaps = 17/431 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE +T      GY   +  E AD+ V+NTC+V    D K    +G     
Sbjct: 25  TYGCQMNVHDSERLTGSLEAAGYVSAEGAE-ADIVVINTCAVRENADNKLYGNLGHLAGV 83

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R++    IAV GC AQ    T +     VDVV G+ N G +   + +AR  G+ Q+++ 
Sbjct: 84  KRRHEGMQIAVGGCLAQKDRATVLEKAPWVDVVFGTHNMGALPTLLERARHNGEAQLEIL 143

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F      + +     ++ I  GCN  C +C++P  RG    + P  +L EI++
Sbjct: 144 ESLET--FPSTLPTKRDEIASGWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIQA 201

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL     I+G+ER+R  S  P  FT+DV+
Sbjct: 202 LVDDGAVEVTLLGQNVNSYGVEFGDRQAFGKLLRAAGAIEGLERIRFTSPHPAAFTDDVI 261

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  LK M R Y ++ +  I++ +R ++ D +ITTD+IVG
Sbjct: 262 DAMAETPAVMPQLHMPLQSGSDRILKAMRRSYRSERFLGILDRVRTRVPDAAITTDIIVG 321

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    S    F+YS R GT A  ME QV  +   ER  +L  L 
Sbjct: 322 FPGETEEDFQETLRVVEAARFSSAFTFQYSIRPGTPAATMEEQVPADVVKERYGRLTALQ 381

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKINS 422
                   ++ +G  ++VL    V    G   G TR   +V  +A     G+++++ +  
Sbjct: 382 ERISHEENQRVVGRTVEVL----VSAHEGRKDGDTR---RVTGRAQ---DGRLVHLDVPE 431

Query: 423 FEGEVAEGEIV 433
              E   G+ V
Sbjct: 432 GSAEPRPGDAV 442


>MIAB_STAES RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  198 bits (504), Expect = 6e-53
 Identities = 126/422 (29%), Positives = 210/422 (49%), Gaps = 10/422 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVV-DFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR- 64
           T GC++N +++E M       GY    D NE ADV ++NTC++    + K    IG  + 
Sbjct: 74  TYGCQMNAHDTEVMAGILNALGYSATSDINE-ADVILINTCAIRENAENKVFSEIGNLKH 132

Query: 65  --RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             ++ P+ +I V GC +Q   +    +   + VD+V G+ N   +   + +A       V
Sbjct: 133 LKKERPDCLIGVCGCMSQEESVVNKILKSYQNVDMVFGTHNIHHLPEILEEAYLSKAMVV 192

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           +V +  +  + E+L  +  +   +A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 193 EVWSK-EGDIIENLP-KVRDGHIKAWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           +R LA  G++EI L G +  SYG                     I RVR  +  P  FT+
Sbjct: 251 VRELAREGYQEITLLGQNVNSYGKXXXXXXXXXXXXXXXXSKIDIPRVRFTTSHPWDFTD 310

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
            ++  I     + PH HL +QSG +  LK M R+YT + Y D+V+ +++ I +V++TTD+
Sbjct: 311 RMIEVIAKGGNIVPHIHLPVQSGNNQVLKIMGRKYTRESYLDLVSRIKEAIPNVALTTDI 370

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVG+P                +     + + YS R GT A  M++ V    K ER ++L 
Sbjct: 371 IVGYPNETEEQFEETLSLYDDVQFEHAYTYLYSQRDGTPAAKMKDNVPLEVKKERLQRLN 430

Query: 360 ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
           +   I  +    +Y G+++ VL E   +    V  GYT     VN K      GK+++VK
Sbjct: 431 KKVGIYSQQAMSQYEGKIVTVLCEGSSKKDENVLAGYTDKNKLVNFKGPRESIGKLVDVK 490

Query: 420 IN 421
           I+
Sbjct: 491 ID 492


>MIAB_STAEQ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 514

 Score =  198 bits (504), Expect = 6e-53
 Identities = 126/422 (29%), Positives = 210/422 (49%), Gaps = 10/422 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVV-DFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR- 64
           T GC++N +++E M       GY    D NE ADV ++NTC++    + K    IG  + 
Sbjct: 74  TYGCQMNAHDTEVMAGILNALGYSATSDINE-ADVILINTCAIRENAENKVFSEIGNLKH 132

Query: 65  --RQNPEAIIAVVGCYAQ---IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
             ++ P+ +I V GC +Q   +    +   + VD+V G+ N   +   + +A       V
Sbjct: 133 LKKERPDCLIGVCGCMSQEESVVNKILKSYQNVDMVFGTHNIHHLPEILEEAYLSKAMVV 192

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           +V +  +  + E+L  +  +   +A++ I  GC++FC YC++P+TRG   S+ P+ ++DE
Sbjct: 193 EVWSK-EGDIIENLP-KVRDGHIKAWVNIMYGCDKFCTYCIVPFTRGKERSRRPEDIIDE 250

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           +R LA  G++EI L G +  SYG                     I RVR  +  P  FT+
Sbjct: 251 VRELAREGYQEITLLGQNVNSYGKXXXXXXXXXXXXXXXXSKIDIPRVRFTTSHPWDFTD 310

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
            ++  I     + PH HL +QSG +  LK M R+YT + Y D+V+ +++ I +V++TTD+
Sbjct: 311 RMIEVIAKGGNIVPHIHLPVQSGNNQVLKIMGRKYTRESYLDLVSRIKEAIPNVALTTDI 370

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVG+P                +     + + YS R GT A  M++ V    K ER ++L 
Sbjct: 371 IVGYPNETEEQFEETLSLYDDVQFEHAYTYLYSQRDGTPAAKMKDNVPLEVKKERLQRLN 430

Query: 360 ELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
           +   I  +    +Y G+++ VL E   +    V  GYT     VN K      GK+++VK
Sbjct: 431 KKVGIYSQQAMSQYEGKIVTVLCEGSSKKDENVLAGYTDKNKLVNFKGPRESIGKLVDVK 490

Query: 420 IN 421
           I+
Sbjct: 491 ID 492


>MIAB_NITHX RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 473

 Score =  198 bits (504), Expect = 6e-53
 Identities = 129/436 (29%), Positives = 215/436 (49%), Gaps = 15/436 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      E AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDTLAAEGFVETASAEEADLVILNTCHIREKASEKVYSELG 65

Query: 62  RAR-------RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R       R   E  + V GC AQ    E+      VDVV+G ++   +   + +A+ 
Sbjct: 66  RLRAAKDQAARDGREMSVVVAGCVAQAEGDEIIRRAPVVDVVVGPQSYHHLPQLLARAKA 125

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVCS 170
           +G+  ++    +++K     +      + R   AF+ +Q+GC++FC +C++PYTRG+  S
Sbjct: 126 DGRA-LETEFPVEDKFGFLPQPSRQAIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEVS 184

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERVR 228
           +   K++++++ LA++G +EI L G +  +Y  D  +        LL  +  I GI R+R
Sbjct: 185 RPVAKIVEDVQRLADNGVREITLIGQNVNAYHGDGPDGRPWPFGKLLHRLADIPGIVRLR 244

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    + ++     L  L P  HL +QSG D  L+ MNRR+TA +Y  +V+  R 
Sbjct: 245 YSTSHPRDVEDSLIEAHRDLGALMPFVHLPVQSGSDRILEAMNRRHTADDYRRVVDRFRH 304

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
             +D++ ++D IVGFPG            + +I  +  + FKYSPR GT A  M+  V  
Sbjct: 305 VRQDIAFSSDFIVGFPGETEQDFTATLALVTQIGYAGAYSFKYSPRPGTPAAEMKETVST 364

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
              DER  +L  L    + AF    +G  +DVLFE       G   G T      +  A 
Sbjct: 365 ADMDERLVRLQNLIDSQQSAFNRAAVGTTVDVLFERAAR-NPGQIVGRTAYLQPAHVVAS 423

Query: 409 CNVSGKILNVKINSFE 424
            ++ G+IL V + S E
Sbjct: 424 ADIIGQILPVTVASLE 439


>MIAB_NEIMF RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  198 bits (504), Expect = 6e-53
 Identities = 142/441 (32%), Positives = 207/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+S+ M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    +NP  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLHDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  IG V   L E   +         T N   VN     ++  
Sbjct: 361 RLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQLQARTANNRVVNFTGTPDMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G+V E
Sbjct: 421 QMIDLEITEAYTFSLRGKVVE 441


>MIAB_NEIG1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  198 bits (504), Expect = 6e-53
 Identities = 142/441 (32%), Positives = 207/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+SE M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSEKMLSVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    +NP  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLPDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  IG V   L E   +         T N   VN     ++  
Sbjct: 361 RLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQLQARTVNNRVVNFTGTPDMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G++ E
Sbjct: 421 QMIDLEITEAYTFSLRGKIVE 441


>MIAB_BARBK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  198 bits (504), Expect = 6e-53
 Identities = 138/444 (31%), Positives = 214/444 (48%), Gaps = 20/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    +GY        AD+ +VNTC +     +K    +G
Sbjct: 16  KVFIKTYGCQMNVYDSQRMNDSLSAQGYVTTQTPNDADLILVNTCHIREKAAEKLYSDLG 75

Query: 62  RARRQNPEA------IIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDE 114
           R R    +       +I V GC AQ    E+      VD+V+G +    +   + +A+ +
Sbjct: 76  RLRMMRQKRTSEKPLMIGVTGCVAQAEGDEILRRSPTVDLVVGPQMYHRLPELLQQAQ-Q 134

Query: 115 GKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCS 170
           GK+ V+    +++K F  L    K         AFL +Q+GC++FC +C++PYTRG+  S
Sbjct: 135 GKKIVETNYAVEDK-FNHLPPHNKRAVQKRGVSAFLTVQEGCDKFCTFCVVPYTRGAEIS 193

Query: 171 KDPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVR 228
           +  +++ DE R L E   KEI L G +   + G   D K   L DLL  + K+DG++R+R
Sbjct: 194 RSVEQITDEARQLIEADVKEITLLGQNVNGWHGQSTDGKTWRLGDLLYHLAKLDGLKRLR 253

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    E ++     L  L P+ HL +QSG D  LK MNR++ A +Y +++  +R 
Sbjct: 254 YTTSHPRDMDESLIAAHRNLDILMPYLHLPVQSGSDRILKAMNRQHKAIDYLNLIEKIRT 313

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D++ + D IVGFPG            ++++  S  + FKYSPR GT    M+NQVD 
Sbjct: 314 ARPDIAFSGDFIVGFPGETDDDFEETIKLIEQVGYSSAYSFKYSPRPGTLGATMKNQVDE 373

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKV----N 404
             K+                F    IG+  DVL E++     G   G +   + V     
Sbjct: 374 KVKNXXXXXXXXXXXXXXHRFLRSKIGQTTDVLIEKDGR-HPGQIVGRSPWLLPVVVDTQ 432

Query: 405 AKADCNVSGKILNVKINSFEGEVA 428
           A     ++ +I N   NSF GE A
Sbjct: 433 APIGTVMAIQITNASSNSFVGEKA 456


>MIAB_ARTAT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 515

 Score =  198 bits (504), Expect = 6e-53
 Identities = 128/380 (33%), Positives = 195/380 (51%), Gaps = 9/380 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N ++SE M       GY   D  E+ADV V NTC+V    D K    +G+ R+ 
Sbjct: 31  TFGCQMNVHDSERMAGLLEEAGYVPAD-GEVADVVVFNTCAVRENADNKLYGNLGQLRQV 89

Query: 66  --QNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
              NP   IAV GC AQ    T V     VD V G+ N G +   +N+AR   + Q+++ 
Sbjct: 90  KEANPGMQIAVGGCLAQKDRETIVKKAPWVDAVFGTHNVGALPALLNRARHNNEAQLEIL 149

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L   VF      + ++    ++ I  GCN  C +C++P  RG    + P ++L EI++
Sbjct: 150 ESLD--VFPSTLPTKRDSVYAGWVSISVGCNNTCTFCIVPSLRGKEKDRRPGEILAEIQA 207

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL    +I+G+ERVR  S  P  FT+DV+
Sbjct: 208 LVDDGAVEVTLLGQNVNSYGVEFGDRQAFSKLLRACGEIEGLERVRFTSPHPAAFTDDVI 267

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +       P  H+ LQSG D  LK M R Y + ++  I++ +RD+I   +ITTD+IVG
Sbjct: 268 DAMAETHNAMPQLHMPLQSGSDKVLKDMRRSYRSSKFLGILDKVRDRIPHAAITTDIIVG 327

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL- 361
           FPG            +++   +    F+YS R GT A ++  Q+      ER ++L  L 
Sbjct: 328 FPGETEEDFQATLDVVEKSRFASAFTFQYSKRPGTPAADLPEQLPKAVVQERYERLTALQ 387

Query: 362 NRINEKAFAEKYIGEVIDVL 381
           +RI  +  A K +G  ++VL
Sbjct: 388 DRIAAEENA-KQLGRKVEVL 406


>MIAB_PROM0 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  198 bits (503), Expect = 8e-53
 Identities = 132/444 (29%), Positives = 215/444 (48%), Gaps = 20/444 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M     + GY   D    AD+ + NTC++ +  ++K    +GR    
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYTRADNELNADLVLYNTCTIRDNAEQKVYSFLGRQAKR 84

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + + P   + V GC AQ    + +  +  +D+V+G ++   +   + K  D G Q V   
Sbjct: 85  KHKTPRLKLVVAGCLAQQEGESLLRRVPELDLVMGPQHVNNLENLLGKV-DLGNQVV--- 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +  + ED+      +    ++ I  GCN  C+YC++P  RG   S+ P  +  EI+ 
Sbjct: 141 ATEETFISEDITSARRESSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPNAIKSEIQK 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA+  FKEI L G +  +YG DL        ++ TL DLL  I  + GI R+R  +  P 
Sbjct: 201 LADDNFKEITLLGQNIDAYGRDLPGTTKEGRKENTLTDLLYYIHDVKGIRRIRFATSHPR 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F++ +++    L K+C HFH+  QSG D  LK+M+R Y+ K+Y++I+  +R  + D SI
Sbjct: 261 YFSKRLIQACYELDKVCEHFHIPFQSGNDEILKQMSRGYSIKKYKNIIENIRSLMPDASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  I   + +   YS R  T A    NQ+    K  R 
Sbjct: 321 TADAIVAFPGETEKQYQDTLKLISEIGFDQVNTAAYSARPNTPAAVWTNQLSEEVKKARL 380

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           +++ +L     ++  ++YI  +  VL E      S    G TR     ++++    + N 
Sbjct: 381 QEINDLVEKTARSRNQRYIDNIESVLIEGLNPKNSSQIMGRTRTNRLTFVEIPKNINFNF 440

Query: 412 S-GKILNVKINSFEGEVAEGEIVL 434
           S G  +NV+IN        GE+ L
Sbjct: 441 SLGDEINVRINEARPFSLTGELSL 464


>MIAB_NOSP7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  198 bits (503), Expect = 8e-53
 Identities = 129/440 (29%), Positives = 212/440 (48%), Gaps = 35/440 (7%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR-ARR 65
           T GC++N  +SE M       G+E  +    ADV + NTC++ +  ++K    +GR A+R
Sbjct: 12  TFGCQMNKADSERMAGVLEDMGFEWSEDPNNADVILYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 66  QN--PEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P+  + V GC AQ      +  +  +D+V+G ++   +   +    D G Q V   
Sbjct: 72  KHDQPDLTLIVAGCVAQQEGEALLRRVPELDLVMGPQHANRLKDLLESVFD-GNQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           +V    + ED+     ++K  A++ +  GCN  C YC++P  RG   S+ P  +  E+  
Sbjct: 131 SV---HIIEDITQPRRDSKVTAWVNVIYGCNERCTYCVVPNVRGIEQSRTPSAIRAEMEE 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV-------TLVDLLEEIEKIDGIERVRIGSIDPT 235
           L   G+KEI L G +  +YG DL              DLL  +  + GIER+R  +  P 
Sbjct: 188 LGRQGYKEITLLGQNIDAYGRDLPGTTPEGRHLHNFTDLLYYVHDVPGIERLRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I++ +R  + D SI
Sbjct: 248 YFTERLIKACAELPKVCKHFHIPFQSGDNELLKAMARGYTHEKYRRIIDTIRRYMPDASI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            ++ I     +   YSPR GT A   +NQ+    K +R 
Sbjct: 308 SADAIVGFPGETEAQFENTLKLVEDIGFDMLNTAAYSPRPGTPAALWDNQLSEEVKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++L  L  +     +++Y G + +VL E++                  N K    V G+ 
Sbjct: 368 QRLNHLGNLKVAERSQRYFGRIEEVLVEDQ------------------NPKDQTQVMGRT 409

Query: 416 LNVKINSFEGEVAE--GEIV 433
              ++  F G++ E  G++V
Sbjct: 410 DGNRLTFFSGDIKELKGQLV 429


>MIAB_MESSB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  198 bits (503), Expect = 8e-53
 Identities = 134/438 (30%), Positives = 217/438 (49%), Gaps = 17/438 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  E AD+ ++NTC +     +K    +G
Sbjct: 26  KVFVKTYGCQMNVYDSQRMADALAAEGYRATDVIEDADLVLLNTCHIREKAAEKVYSELG 85

Query: 62  RAR-------RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R       +Q  E ++ V GC AQ    E+      VD+V+G +    +   V +AR 
Sbjct: 86  RIRVLKEERAKQGRETVVGVAGCVAQAEGREILRRAPAVDLVIGPQTYHRLPSVVTRAR- 144

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEY----NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K F+ L   E     +    AFL +Q+GC++FC +C++PYTRG+  
Sbjct: 145 AGEKIVETEYAVEDK-FDHLPAPERTAVRSRGVTAFLTVQEGCDKFCTFCVVPYTRGAEV 203

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHT-ASYGVDLDEKVT-LVDLLEEIEKIDGIERV 227
           S+   +++ E   LAE G +E+ L G +  A +G   D +   L  LL  + +I G++R+
Sbjct: 204 SRPVAQIVAEAERLAEAGVRELTLLGQNVNAWHGEGPDGREWGLGRLLFRLAEIPGLDRL 263

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    E+++     L KL P+ HL +Q+G D  LK MNR++TA +Y  ++  +R
Sbjct: 264 RYTTSHPRDMDEELIAAHRDLIKLMPYLHLPVQAGSDRILKAMNRKHTAADYLRLIERIR 323

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
               D++++ D IVGFPG            ++ +  ++   FKYSPR GT   +M +QV 
Sbjct: 324 AARPDIAMSGDFIVGFPGETDRDFEDTMRIVRDVNYAQAFSFKYSPRPGTPGADMHDQVP 383

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KD                F E  +G  ID+L E+     +G   G +     V  + 
Sbjct: 384 DAVKDXXXXXXXXXXXXXXXXFGESLVGTEIDLLLEKPGR-QAGQLVGRSPWLQPVIVEE 442

Query: 408 DCNVSGKILNVKINSFEG 425
           +    G I+ V+I S  G
Sbjct: 443 NAGQIGDIVRVRITSSGG 460


>MIAB_HAEIE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  198 bits (503), Expect = 8e-53
 Identities = 142/444 (31%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++ NP  +I V GC A      +      VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT D++       +L    HL +Q+G D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTNDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRGHTALEYKSIIRKLRAVRPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V  ++K +R
Sbjct: 302 ISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSARPGTPAADMPDDVTEDEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A  F+ + +G    VL E   +      TG T     VN +    + 
Sbjct: 362 LYVLQE--RINQQAAQFSRRMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFQGSPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++VKI     NS  GEV   E
Sbjct: 420 GKFVDVKITDVYTNSLRGEVVRTE 443


>MIAB_HAEI8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  198 bits (503), Expect = 8e-53
 Identities = 142/444 (31%), Positives = 219/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  +   G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++ NP  +I V GC A      +      VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT D++       +L    HL +Q+G D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTNDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRGHTALEYKSIIRKLRAVRPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V  ++K +R
Sbjct: 302 ISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSARPGTPAADMPDDVTEDEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A  F+ + +G    VL E   +      TG T     VN +    + 
Sbjct: 362 LYVLQE--RINQQAAQFSRRMLGTEQRVLVEGPSKKDIMELTGRTETNRIVNFQGSPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++VKI     NS  GEV   E
Sbjct: 420 GKFVDVKITDVYTNSLRGEVVRTE 443


>MIAB_BURP1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  198 bits (503), Expect = 8e-53
 Identities = 137/446 (30%), Positives = 213/446 (47%), Gaps = 15/446 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EG E  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q   + V+    VD+V G +    +   ++  R+ G+
Sbjct: 64  GRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 AQVDITFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY----GVDLDEKVTLVDLLEEIEKIDGIERVRIGSI 232
           L E+  LA+ G +E+ L G +  +Y         E      L+E +  I GIER+R  + 
Sbjct: 182 LTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFATLIEYVADIPGIERIRYTTS 241

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P  FT+ ++     + KL  H HL +Q G D  L  M R YT  EY+ ++  LR    +
Sbjct: 242 HPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSVIRKLRAIRPN 301

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
           +S++T++IVGFPG            +  ++   +  F YSPR GT A N+ +      K 
Sbjct: 302 LSLSTNIIVGFPGETDADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPRELKL 361

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN----AKAD 408
           +R + L      N    ++  +G+V  +L E           G T N   VN    + A 
Sbjct: 362 KRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPSAAH 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEIVL 434
             + G++++VKIN        GE+VL
Sbjct: 422 PRLIGQMIDVKINHAYPHSLRGELVL 447


>MIAB_BRUME RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  198 bits (503), Expect = 8e-53
 Identities = 130/435 (29%), Positives = 220/435 (50%), Gaps = 17/435 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    EGY   D  + AD+ ++NTC +     +K    +G
Sbjct: 24  KVFVKTYGCQMNVYDSQRMADSLAAEGYVATDTPDDADLVLLNTCHIREKASEKLYSALG 83

Query: 62  RARRQNP-------EAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R+          E  I V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 84  RLRKMKDARAADGKELTIGVAGCVAQAEGQEILRRAPNVDLVIGPQTYHRLPNALARVRG 143

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K FE L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 144 -GEKVVETDYAIEDK-FEHLPAPRREETRKRGVSAFLTVQEGCDKFCTFCVVPYTRGSEV 201

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+  K+++ E   LA+ G +E+ L G +  ++  + ++  +  L +LL  + +I GI  +
Sbjct: 202 SRSVKQIVAEAERLADSGVRELTLLGQNVNAWHGEGEDGREWGLGELLFRLARIPGIAHL 261

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L++L P+ HL +QSG D  LK MNRR+ A EY  ++  +R
Sbjct: 262 RYTTSHPRDMDDSLIAAHRDLRQLMPYLHLPVQSGSDRILKAMNRRHKADEYLRLIERIR 321

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           +   D++++ D IVGFPG            ++ +  ++ + FKYSPR GT   ++++ V+
Sbjct: 322 NVRPDMALSGDFIVGFPGETDQDFEDTMQLVRDVNYAQAYSFKYSPRPGTPGADLDDHVE 381

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
              KDE              AF +  IG  +DVL E+     +G   G +   + V    
Sbjct: 382 EAVKDEXXXXXXXXXXXXXYAFQDSMIGRKMDVLLEKPGR-EAGQMVGRSPWLLPVIIDD 440

Query: 408 DCNVSGKILNVKINS 422
           + +  G I++VKI S
Sbjct: 441 NKDRVGDIIHVKIVS 455


>MIAB_BARHE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 458

 Score =  198 bits (503), Expect = 8e-53
 Identities = 135/445 (30%), Positives = 216/445 (48%), Gaps = 24/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ MT+    +GY        AD+ +VNTC +     +K    +G
Sbjct: 16  KVFIKTYGCQMNVYDSQRMTDSLSSKGYVATQTPNDADLILVNTCHIREKAAEKLYSDLG 75

Query: 62  RARRQNPEA------IIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDE 114
           R R    E       ++ V GC AQ   +E+      VD+V+G +    +   + + + +
Sbjct: 76  RLRVMRQERTPDKPLMVGVTGCVAQAEGSEILRRAPIVDLVIGPQMYHRLPDLLEQTK-Q 134

Query: 115 GKQQVKVGAVLKNKVFEDLKIEEYNNKT------RAFLKIQDGCNRFCAYCLIPYTRGSV 168
           GK+ V     +++K      +  +N +        AFL +Q+GC++FC +C++PYTRG+ 
Sbjct: 135 GKKIVATEYAVEDKFAH---LPPHNKRAVRKRGVSAFLTVQEGCDKFCTFCVVPYTRGAE 191

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIER 226
            S+  +++ +E R L E G KEI L G +   + G +++ K   L DLL  + K+DG++R
Sbjct: 192 ISRSVEQITEEARQLIEAGVKEITLLGQNVNGWHGQNVNGKTWRLGDLLYHLAKLDGLKR 251

Query: 227 VRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLL 286
           +R  +  P    + ++     L  L P+ HL +QSG D  LK MNR++ +  Y  ++  +
Sbjct: 252 LRYTTSHPRDMDDSLIAAHRDLDILMPYLHLPVQSGSDRILKAMNRQHKSIHYLQLIEKI 311

Query: 287 RDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQV 346
           R+   D++ + D IVGFPG            +K++  S  + FKYSPR GT    M+N V
Sbjct: 312 RNARPDIAFSGDFIVGFPGETDEDFEETIKLIKQVEYSSAYSFKYSPRPGTVGATMKNHV 371

Query: 347 DGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKV--- 403
           +   KD R             AF    IG+  DVL  E+    SG   G +   + V   
Sbjct: 372 EEAVKDARXXXXXXXXXXXXNAFLRSKIGQTTDVLI-EKAGRHSGQMVGRSPWLLPVVVD 430

Query: 404 -NAKADCNVSGKILNVKINSFEGEV 427
             A     +   I N   NSF GE+
Sbjct: 431 TQASTGTVIPIHIKNTSSNSFVGEM 455


>MIAB_SHISS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (502), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGSTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SHIBS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (502), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGSTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_RICTY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  197 bits (502), Expect = 1e-52
 Identities = 135/445 (30%), Positives = 231/445 (51%), Gaps = 23/445 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  + +     GYE  +  + AD+ ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKIQDLLYPFGYESTEDIKEADIIILNTCHIREKAAEKTYSELG 63

Query: 62  RARR-QNPE-------AIIAVVGCYAQIAPTEV--SGIEGVDVVLGSRNKGEIVYYVNKA 111
           R ++ QN         AII V GC AQ A  EV  +    VD+V+G ++   +   ++K 
Sbjct: 64  RIKKLQNTRKQEGLNPAIIVVAGCVAQ-AEGEVIFTRTPYVDIVVGPQSYYNLPELISKV 122

Query: 112 RDEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
               K  + +  V + K F++L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S+
Sbjct: 123 VRHEKHLIDLDFVEEAK-FDNLPEQLYTQGASSFISVQEGCDKFCTFCVVPYTRGAEFSR 181

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRI 229
             ++V  E   +  +  KEIIL G +  +Y G    +K+ TL DLL+ + +I  +ER+R 
Sbjct: 182 SVEQVYRESLKVVSNDTKEIILLGQNVNAYHGKGPKDKIFTLADLLKHLAQIPNLERLRY 241

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P   T+D+++      KL P  HL +QSG +  LK MNR++    Y +I+N LR+ 
Sbjct: 242 MTSHPIDMTDDLIKLHGTEPKLMPFLHLPVQSGSNKILKAMNRKHDRDYYFNIINRLREA 301

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             D+ +++D IVGFPG            ++R+   + + FKYSPR GT      +Q+  +
Sbjct: 302 RSDIVLSSDFIVGFPGETEKDFEDTLDLVQRVKYGQCYSFKYSPRPGTPGAIRTDQIPEH 361

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKA 407
            K +R   L +     + AF E  +G  + VLF+ + +    +   T Y ++    N   
Sbjct: 362 IKSKRLTILQKELATQQLAFNESCVGSTMKVLFDRDGKFEDQIIGKTPYMQSVYIHNPNK 421

Query: 408 DCNVSGKILNV-----KINSFEGEV 427
             ++ GKI++V      +NS  GE+
Sbjct: 422 --SLLGKIVDVIITKAALNSLTGEI 444


>MIAB_NEIMB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  197 bits (502), Expect = 1e-52
 Identities = 141/441 (31%), Positives = 207/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+S+ M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    +NP  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLPDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  +G V   L E   +         T N   VN     ++  
Sbjct: 361 RLEALNEVIEAETARINQTMVGTVQRCLVEGISKKDPDQLQARTANNRVVNFTGTPDMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G+V E
Sbjct: 421 QMIDLEITEAYTFSLRGKVVE 441


>MIAB_HAEDU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  197 bits (502), Expect = 1e-52
 Identities = 141/444 (31%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ D  E AD+ ++NTCS+     +K    +
Sbjct: 3   KLHITTWGCQMNEYDSSKMADLLNSTHGLELTDKPEEADILLLNTCSIREKAQEKVFSQL 62

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   +  P+ II V GC A      +      VD+V G +    +   +N+ R   +
Sbjct: 63  GRWKNWKKDKPDLIIGVGGCVASQEGEHIRERAPFVDIVFGPQTLHRLPEMINQIRSGDR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L   +    T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 AVVDISFPEIEK-FDRLPEPKAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 181 LFEIAQLAEQGVREVNLLGQNVNAYRGETFDGGICTFAELLRLVAAIDGIDRLRYTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    ++ 
Sbjct: 241 IEFTDDIIEVYRDTPELVSFLHLPIQSGADRVLTMMKRNHTALEYKAIIRKLRAVRPNIQ 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++++    +  F YS R GT A ++ + V  N+K +R
Sbjct: 301 ISSDFIVGFPGETAEDFEQTMKIIEQVNFDMSFSFIYSARPGTPASDLPDDVSENEKKDR 360

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN +A  F+   +G    +L E   +      TG T     VN     N+ 
Sbjct: 361 LAHLQQ--RINHQAMQFSRLMLGTEQRILVEGPSKKDIMELTGRTETNRVVNFIGTPNMI 418

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  GEV   E
Sbjct: 419 GKFVDIKITDVYSNSLRGEVIRTE 442


>MIAB_CITK8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (502), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGDHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGADRVLNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTQDFEQTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G V  +L E          +G T N   VN +    + 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTVQRILVEGTSRKSIMELSGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYTNSLRGKVVRTE 443


>MIAB_SHIFL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SHIF8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_SHIDS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_RHOPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 463

 Score =  197 bits (501), Expect = 1e-52
 Identities = 131/448 (29%), Positives = 219/448 (48%), Gaps = 23/448 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E+      VDVV+G ++   +   + KA  
Sbjct: 66  RLRVARDEAANHGRRMQIAVAGCVAQAEGAEIIRRAPVVDVVVGPQSYHNLPQLLAKAEQ 125

Query: 114 EGKQ-------QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRG 166
            G+        + K G VL     + ++    +    AF+ +Q+GC++FC +C++PYTRG
Sbjct: 126 HGRALETEFPIEDKFG-VLPQPAPDAIRARGIS----AFVTVQEGCDKFCTFCVVPYTRG 180

Query: 167 SVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKV--TLVDLLEEIEKIDGI 224
           +  S+    ++++++ LAE+G +E+ L G +  +Y  D  +++  +L  L+  + +I GI
Sbjct: 181 AEMSRPVAAIVEDVKRLAENGVREVTLIGQNVNAYHGDGPDRLAWSLGRLVRRLAEIPGI 240

Query: 225 ERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVN 284
            R+R  +  P    +D++     L  L P  HL +QSG D  L  MNR++TA +Y  +++
Sbjct: 241 VRLRYSTSHPNDVNDDLLAAHRDLPALMPFVHLPVQSGSDRILAAMNRKHTADDYRRVID 300

Query: 285 LLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMEN 344
             R   E ++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M  
Sbjct: 301 RFRLASEAIAFSSDFIVGFPGETERDFSATLALVAQIGYAGAYSFKYSPRPGTPAADMAE 360

Query: 345 QVDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN 404
            V     DER             AF +  IG  ++VLF E      G   G T      +
Sbjct: 361 MVPAAVMDERXXXXXXXXXXXXSAFNKAAIGRTVEVLF-ERAGRKPGQIVGRTAYLQPAH 419

Query: 405 AKADCNVSGKILNVKINSFEGEVAEGEI 432
             A  ++ GK+L V+++S E     GE+
Sbjct: 420 VMAPDSIIGKVLPVRVDSLERYSLLGEL 447


>MIAB_NITMU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 142/442 (32%), Positives = 208/442 (47%), Gaps = 12/442 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFV-REGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     +  E  D    ADV + NTCSV     +K    +
Sbjct: 4   KLYIKTFGCQMNEYDSKKMADVLRDAQHMEKTDDPAAADVILFNTCSVREKAQEKVFHDL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R     NP+ +I V GC A     E V     VD+V G +    +   ++  +  G+
Sbjct: 64  GRVRHLKAANPDLLIGVGGCVASQEGAEIVKRAPYVDLVFGPQTLHRLPQMISTRQITGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 PQVDISFPEIEK-FDHLPPARTEGVT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPLDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG--VDLDEKVTLVD---LLEEIEKIDGIERVRIGS 231
           L EI  L   G KE+ L G +  +Y   +   E+  L D   LLE + +I GIER+R  +
Sbjct: 182 LTEIAGLTNLGVKEVTLLGQNVNAYRGRMQYAEEGELADFALLLEYLHEIPGIERIRYTT 241

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  FT  ++    A  KL  H HL +QSG D  L  M R YT+ EY+ I+  LR    
Sbjct: 242 SHPREFTPRLIEAYKASPKLVSHVHLPVQSGSDRILAAMKRGYTSLEYKSIIRRLRAARP 301

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+SIT+D IVGFPG            ++ +    +  F YS R GT A  +E+      K
Sbjct: 302 DISITSDFIVGFPGETEADFEATMKLIEAVNFDGSFSFIYSSRPGTPAAGLEDTTPHQVK 361

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ER ++L E   +  +A + + +G    VL E       G  +G T N   VN      +
Sbjct: 362 LERLQRLQEKVELQAQAISVRMVGTTQRVLVEGLSRKDPGELSGRTDNNRVVNFPGSPEM 421

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            GK   +KI +       GE V
Sbjct: 422 IGKFAELKITAALSHTLRGENV 443


>MIAB_KLEP3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 136/444 (30%), Positives = 218/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R    
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGDHIRQRAHYVDIIFGPQTLHRLPEMINAVRGNRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L     +  T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRADGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPCDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR+   D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLREARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   ++D++
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVP--EEDKK 359

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            +  I   RIN++A A   + +G V  +L E          +G T N   VN +   ++ 
Sbjct: 360 QRLYILQERINQQAMAWSRRMLGTVQRILVEGTSRKSLMELSGRTENNRVVNFEGTPDMV 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G++   E
Sbjct: 420 GKFVDVEIVDVYTNSLRGKIVRTE 443


>MIAB_ESCF3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOUT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOSM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOSE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOLU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOLI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOLC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOL6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOL5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOK1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECOHS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECODH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO8A RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO7I RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO5E RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO57 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO55 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO45 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_ECO24 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  197 bits (501), Expect = 1e-52
 Identities = 139/444 (31%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_POLNS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  197 bits (500), Expect = 2e-52
 Identities = 133/443 (30%), Positives = 217/443 (48%), Gaps = 13/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EG  + D  E ADV ++NTCS+    + K    +
Sbjct: 3   KLYIKTFGCQMNEYDSGKMADLLHADEGMVMTDRPEDADVVLLNTCSIREKAEDKVFSDL 62

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R   +  P  +I V GC A Q     VS    VDVV G +    +   + K R+ G 
Sbjct: 63  GRLRELKKTKPNLLIGVGGCVASQEGQQIVSHAPYVDVVFGPQTLHRLSDLIAKRRETGL 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L       +  A++ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 123 FQVDISFPEIEK-FDHLPASR-QTRGSAYVSIMEGCSKYCSYCVVPYTRGEEVSRSFDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LA  G KEI+L G +  +Y   + ++  + D   L+E I +I G+ER+R  +  
Sbjct: 181 LTEVAGLASKGVKEIVLLGQNVNAYLGKMGDRQEIADFALLIEYIVEIPGVERIRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     + KL  H HL +Q G DA L  M R YTA E++ I+  +R    D+
Sbjct: 241 PKEFTQRLIDVYTKVPKLVSHLHLPVQHGSDAMLSAMKRGYTALEFKSIIRKMRAVRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++++D IVGFPG            ++ +    +  F +SPR GT A N+ +      K +
Sbjct: 301 TLSSDFIVGFPGETEADFEKLLKMVEELNFDNSFCFIFSPRPGTPAANLHDDTPYEVKLK 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRN---YIKVNAKADCN 410
           R + L+ L        ++K +G +  VL E   + G  +      N   +    A+   N
Sbjct: 361 RLQTLLALVESQANQISQKMLGNIERVLIEGLAKDGINLQGRAENNRVIHFTAPAQNIEN 420

Query: 411 VSGKILNVKINSFEGEVAEGEIV 433
           + G++++++I         G++V
Sbjct: 421 LIGQMVDIRITEVLNYTLRGKLV 443


>MIAB_PELCD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 438

 Score =  197 bits (500), Expect = 2e-52
 Identities = 124/429 (28%), Positives = 211/429 (49%), Gaps = 9/429 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N  +SE +       GY  VD  E A++ ++NTCS+    ++K    +GR    
Sbjct: 8   TFGCQMNVVDSEQIVGLVQSLGYSSVDSPEQANLIILNTCSIRARAERKVYGHLGRFKPL 67

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +++ PE IIAV GC AQ     +   +  +D+V G+ N   +   V  A     + V+V 
Sbjct: 68  KQRRPELIIAVCGCVAQQEGQRMLEKVPYLDIVCGTHNIHRLADMVRDAELHRARHVEVD 127

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +  +K          + +   F+ +  GC+ FC+YC++P+ RG   S+           
Sbjct: 128 FLEADKRRRLFPERAPSAEVSRFVTVIQGCDNFCSYCIVPHVRGREVSRPSAXXXXXXXX 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
               G +EI L G +  SYG   D++++   LL ++ ++DG+ER+R  +  P   +++++
Sbjct: 188 XXXQGAREITLIGQNVNSYGCKEDDEISFASLLRKVAEVDGLERIRFMTSHPKDLSDELI 247

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                L KLC H HL +Q+G DA LK M R YT  +Y   +  LR    ++ +T+DVIVG
Sbjct: 248 DCFADLDKLCKHIHLPVQAGGDAVLKAMRRGYTRDQYLGRIERLRRVCPEIRMTSDVIVG 307

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            L+R   ++ + F +S R GT A ++ + +    K +   +++ L 
Sbjct: 308 FPGETESEFEQTMDLLERARFTEIYSFIFSARPGTSAADLPDDIPKEVKQQWFDRMLALQ 367

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI-- 420
               + + +  IG+V+ VL E     G+G   G T     VN   + ++ G+I+ V++  
Sbjct: 368 EEITRQYHQMDIGQVLPVLVEGSSRQGNGQLFGRTTWNRIVNFDGNPDLVGRIVPVRLTV 427

Query: 421 ---NSFEGE 426
              NS  GE
Sbjct: 428 AYRNSHLGE 436


>MIAB_PROM2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  196 bits (499), Expect = 2e-52
 Identities = 134/431 (31%), Positives = 208/431 (48%), Gaps = 20/431 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR-ARR 65
           T GC++N  +SE M     + GY   D    AD+ + NTC++ +  ++K    +GR A+R
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYTRADDELKADLVLYNTCTIRDNAEQKVYSFLGRQAKR 84

Query: 66  QN--PEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P   + V GC AQ    + +  +  +D+V+G ++   +   + K  D G Q   V 
Sbjct: 85  KHKIPSLKLVVAGCLAQQEGESLLRRVPELDLVMGPQHVNNLENLLGKV-DLGNQ---VA 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +  + ED+      +    ++ I  GCN  C+YC++P  RG   S+ P  +  EI+ 
Sbjct: 141 ATEETFISEDITNARRESSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPDAIKSEIQK 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA   FKEI L G +  +YG DL        ++ TL DLL  I  ++GI R+R  +  P 
Sbjct: 201 LANDNFKEITLLGQNIDAYGRDLPGTTKEGRKENTLTDLLYYIHDVEGIRRIRFATSHPR 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F+  +++    L K+C HFH+  QSG +  LK M R YT  +Y+ I+  +R  + + SI
Sbjct: 261 YFSRRLIQACYELDKVCEHFHIPFQSGNNEILKLMARGYTIDKYKRIIENIRSLMPNASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  I   +     YSPR  T A    NQ+    K ER 
Sbjct: 321 TADAIVAFPGESEEQYRDTLKLISDIGFDQVMTAAYSPRPNTPAALWHNQISEEVKKERL 380

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           K++ EL     K   E+Y+  +  VL E      S    G TR     ++++      N 
Sbjct: 381 KEINELVETTSKQRNERYLDSIESVLIEGFNPKNSSQIMGRTRTNRLTFVEIPKNIKFNF 440

Query: 412 S-GKILNVKIN 421
           S G  ++VKIN
Sbjct: 441 SLGDEIDVKIN 451


>MIAB_PROAC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 494

 Score =  196 bits (499), Expect = 2e-52
 Identities = 141/445 (31%), Positives = 214/445 (48%), Gaps = 22/445 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEV---VDFNEMADVYVVNTCSVTNMGDKKSRQIIGR- 62
           T GC++N ++SE +       GY      D    ADV V NTC+V    D +    +G  
Sbjct: 18  TYGCQMNVHDSERIAGLLEEAGYVPDPRTDTLAPADVVVFNTCAVRENADNRLYGTLGHM 77

Query: 63  --ARRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQV 119
              +  +P   +AV GC AQ    T V+    VDVV G+ N G +   + +AR     QV
Sbjct: 78  AAVKSAHPGMQLAVGGCMAQKDKDTVVARAPWVDVVFGTHNVGSLPVLLKRARHNATAQV 137

Query: 120 KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
           ++   L    F        ++   A++ I  GCN  C +C++P  RG    + P ++L E
Sbjct: 138 EIEESLVT--FPSNLPARRDSAYSAWVSISVGCNNTCTFCIVPQLRGKETDRRPGEILSE 195

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTE 239
           IR+L   G +EI L G +  SYGV   ++     LL     IDG+ERVR  S  P  FT+
Sbjct: 196 IRALVNEGVQEITLLGQNVNSYGVQFGDRGAFAKLLRACGNIDGLERVRFTSPHPAAFTD 255

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           DV+  +     + P  H+ LQSG D  L+RM R Y + ++  I++ +R+ I   +ITTD+
Sbjct: 256 DVIEAMAETPNVMPSLHMPLQSGSDEVLRRMRRSYRSTKFLGILDRVREAIPHAAITTDI 315

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           IVGFPG            ++    S    F+YS R  T A  M++QV      ER ++L+
Sbjct: 316 IVGFPGETDKDFAETMRIVEESRFSAAFTFQYSIRPNTPAGVMKDQVPKPVVQERYEQLV 375

Query: 360 ELNRINEKAFAEK--YIGEVIDVLF---EEEVELGSGVYTGYTRN----YIKVNAKADCN 410
           EL  +++ A+ E    +G  ++V+F   E   +  +   TG  R+    ++ +N   D  
Sbjct: 376 EL--VDDIAWQENKAQVGRAVEVMFAQGEGRKDEATHRVTGRARDNRLVHVSLNPGDDVP 433

Query: 411 VSGKILNVKINSFEGE--VAEGEIV 433
             G I  V I S      VA+G +V
Sbjct: 434 RPGDIGEVVITSGHPHHLVADGGLV 458


>MIAB_HERAR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  196 bits (499), Expect = 2e-52
 Identities = 136/443 (30%), Positives = 215/443 (48%), Gaps = 12/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     +G    D  E ADV ++NTCSV     +K    +
Sbjct: 4   KIYIKTFGCQMNEYDSDKMADVLNASDGLIKTDKAEDADVILLNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQN---PEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A Q     +     VD+V G +    +   + + R  G+
Sbjct: 64  GRLRELKLLKPDLMIGVGGCVASQEGDAIIKRAPYVDLVFGPQTLHRLPEMLKQRRSTGR 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ +   +    T AF+ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 124 SQVDISFPEIEK-FDHMPPAKVEGAT-AFVSIMEGCSKYCSYCVVPYTRGEEVSRRFDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDL--DEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  L   G KEI L G +  +Y  ++   E      L+E I +++GIER+R  +  P
Sbjct: 182 LTEVAGLEAQGVKEITLLGQNVNAYRGEMADGEIADFALLIEYIAEMEGIERIRYVTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+ ++     + KL  H +L  Q G D  L  M R YT+ EY+ I+  LR    ++S
Sbjct: 242 KEFTQRLIDTYAKVPKLVDHLYLPAQHGSDRILAAMKRGYTSLEYKSILRRLRAVRPNIS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    +  F +SPR GT A N+ +      K +R
Sbjct: 302 ISSDFIVGFPGETDEDFEAMMKLIDDIGYDNSFSFIFSPRPGTPAANLADDTPHEVKLKR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS-- 412
            ++L  +   N + ++++ +G V  +L E   +  +    G T N   VN  A  N +  
Sbjct: 362 LQRLQAVIDQNTRRYSDEMVGSVQRILVEGPSKKDADELQGRTENNRVVNFSAGPNAAHL 421

Query: 413 -GKILNVKINSFEGEVAEGEIVL 434
            G+++NV I         GEIV+
Sbjct: 422 IGQMVNVNITQSHAYTLRGEIVV 444


>MIAB_DELAS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  196 bits (499), Expect = 2e-52
 Identities = 134/439 (30%), Positives = 210/439 (47%), Gaps = 8/439 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +GYE  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVFIKTFGCQMNEYDSDKMADVLGAAQGYESTDDPEQADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPEAI-IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +      + I V GC A     E+      VDVV G +    +   +N    + K Q
Sbjct: 64  GRYKHLKERGVLIGVGGCVASQEGEEIIKRAPYVDVVFGPQTLHRLPELLNARAAKHKPQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGSS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDVLI 181

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y   + +   + D   LLE + +I GIER+R  +  P 
Sbjct: 182 EVAGLADQGVKEVTLLGQNVNAYLGKMGDTAEIADFALLLEYVSEIPGIERIRYTTSHPN 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT  ++     L KL  H HL +Q G D  L  M R YTA EY+  +  LR    ++++
Sbjct: 242 EFTPRLIEAYARLPKLVSHLHLPVQHGSDKILMAMKRGYTAMEYKSTIRKLRAIRPEMAM 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            +  +    +  F +SPR GT A N+ +      K  R 
Sbjct: 302 SSDFIVGFPGETEEDFQKMMKLIHDVRFDNSFSFIFSPRPGTPAANLHDDTPHEVKLRRL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++L  +   N K  +++ +G V  +L E   +       G T     VN   +  + G++
Sbjct: 362 QELQAVINNNIKDISDERVGTVQRLLVEGLSKRDGSELMGRTECNRVVNFPGNERLIGQM 421

Query: 416 LNVKINSFEGEVAEGEIVL 434
           ++VKI         GE+V+
Sbjct: 422 IDVKITEARTFTLRGEVVV 440


>MIAB_ACISJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  196 bits (499), Expect = 2e-52
 Identities = 135/439 (30%), Positives = 209/439 (47%), Gaps = 8/439 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +GYE  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVFIKTFGCQMNEYDSDKMADVLGAAQGYEPTDDPEQADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPEAI-IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +    + + I V GC A     E+      VDVV G +    +   +N    + + Q
Sbjct: 64  GRVKHLKDKGVLIGVGGCVASQEGEEIIKRAPFVDVVFGPQTLHRLPELLNARAAKARPQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGAS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDVLV 181

Query: 179 EIRSLAEHGFKEIILSGIHTASY-GV--DLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y G   D  EK     LLE + +I GIER+R  +  P 
Sbjct: 182 EVAGLADQGVKEVTLLGQNVNAYLGAMGDTAEKADFALLLEYVAEIPGIERIRFTTSHPN 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT  ++     + KL  H HL +Q G D  L  M R YTA EY+  +  LR    D+++
Sbjct: 242 EFTPRLIEAYAKIPKLVSHLHLPVQHGSDRILMAMKRGYTAMEYKSTIRKLRAIRPDMAM 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            +  +    +  F +SPR GT A N+ +      K  R 
Sbjct: 302 SSDFIVGFPGETEEDFQKMMKLIDDVRFDNSFSFIFSPRPGTPAANLHDDTPHEVKLRRL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++L  +   N    +++ +G V  +L E   +       G T     VN      + G++
Sbjct: 362 QELQAVINRNILEISQERVGTVQRLLVEGVSKRDGSELMGRTECNRVVNFPGHERLIGQM 421

Query: 416 LNVKINSFEGEVAEGEIVL 434
           ++VKI         GE+V+
Sbjct: 422 IDVKITEARTYTLRGEVVM 440


>MIAB_SULDN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 435

 Score =  196 bits (498), Expect = 3e-52
 Identities = 140/442 (31%), Positives = 211/442 (47%), Gaps = 23/442 (5%)

Query: 2   KVAFATLGCRVNTYESEAM-TEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   TLGC +N+ +SE M  E   +EGYE  +    AD+ ++NTCSV      K    +
Sbjct: 6   KLFIETLGCAMNSRDSEHMIAELSEKEGYETTNDLSSADLIIINTCSVREKPVAKLFSEL 65

Query: 61  GRARRQNPE-AIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G   ++  E A I V GC A     E+      V  VLG+RN  +I   ++K R     +
Sbjct: 66  GVFNKRKKEGAKIGVCGCTASHLGEEIIKRAPYVSFVLGARNVSKISEVLHKER---AVE 122

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           + +        F D +   Y    +A++ I  GC++ C YC++P TRG   S   + +L 
Sbjct: 123 IDINYDESEFAFNDFRTSPY----KAYINISIGCDKSCTYCIVPKTRGEEISIPTELILR 178

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLD---EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E +   + G KEI L G +  +YG       EKV+  +LL  + KID +ER+R  S  P 
Sbjct: 179 EAQKAVKGGAKEIFLLGQNVNNYGRRFSGEHEKVSFSELLRRLSKIDALERIRFTSPHPF 238

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              ++ +    +  K+C   H+ LQSG    LK M R YT + + + V  LR    DVSI
Sbjct: 239 HMDDEFIEEFSSNPKICKSMHMPLQSGSSKVLKDMKRGYTKEWFLNRVQKLRAMSPDVSI 298

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IV FPG            ++ +   +   FKYSPR  T AE+  N VD   +D  S
Sbjct: 299 STDIIVAFPGESDEDFEETLSIMREVKFDQIFSFKYSPRPETEAEHFTNIVD---EDVAS 355

Query: 356 KKLIELNRINEKAFAEK---YIGEVIDVLFEEEVELGSGVY-TGYTRNYIKVNAKADCNV 411
            +L  L  +      EK   ++G++  V FE   +L    Y +G + N + +  K    +
Sbjct: 356 SRLTTLQNLAVNILDEKNKTHLGKIYRVYFE---DLNQDYYASGRSDNNLLIKVKGSDEL 412

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            G+  +VKI      +  GEIV
Sbjct: 413 LGEFRDVKITDIGRTILSGEIV 434


>MIAB_POLSQ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 448

 Score =  196 bits (498), Expect = 3e-52
 Identities = 133/443 (30%), Positives = 215/443 (48%), Gaps = 13/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EG  + D  E ADV ++NTCS+    + K    +
Sbjct: 3   KLYIKTFGCQMNEYDSGKMADLLHADEGMVMTDTPEDADVVLLNTCSIREKAEDKVFSDL 62

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R   +  P  +I V GC A Q     VS    VDVV G +    +   + + R  G 
Sbjct: 63  GRLRELKKTKPHMLIGVGGCVASQEGRQIVSRAPYVDVVFGPQTLHRLSDLIAQRRKTGL 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L       +  A++ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 123 SQVDISFPEIEK-FDHLPASR-QTRGSAYVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LA  G KEI+L G +  +Y   + +   + D   L+E I +I G+ER+R  +  
Sbjct: 181 LTEVAGLASKGVKEIVLLGQNVNAYLGKMGDAEEIADFALLIEYIAEIPGVERIRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     + KL  H HL +Q G D+ L  M R YTA EY+ I+  +R    D+
Sbjct: 241 PKEFTQRLIDVYAKVPKLVSHLHLPVQHGSDSILSAMKRGYTALEYKSIIRKMRAVRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++++D IVGFPG            ++ +    +  F +SPR GT A N+ +      K +
Sbjct: 301 TLSSDFIVGFPGETDADFEKLLKMVQELDFDNSFCFIFSPRPGTPAANLSDDTPYEVKLK 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS- 412
           R + L+ L        ++K +G+   VL E   + G  +      N +   +  D N+  
Sbjct: 361 RLQTLLALIEGQSNQISQKMLGKTERVLIEGLAKDGVNLQGRAENNRVIHFSPPDQNIDG 420

Query: 413 --GKILNVKINSFEGEVAEGEIV 433
             G++++++I         GE+V
Sbjct: 421 LIGEMVDIRITEVLNYTLRGELV 443


>MIAB_JANSC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 462

 Score =  196 bits (498), Expect = 3e-52
 Identities = 129/437 (29%), Positives = 212/437 (48%), Gaps = 8/437 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    EGYE V+  E AD+ ++NTC +     +K    +G
Sbjct: 29  KLFVKTYGCQMNVYDSERMAEALGGEGYEQVNTPEGADMILLNTCHIREKAAEKMYSELG 88

Query: 62  RARR---QNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R R     NP+  I V GC AQ    E+   +  VD+V+G +    +   + +A + G++
Sbjct: 89  RLRPLRDANPDLKIGVAGCVAQAEGEEIMRRQPLVDLVVGPQTYHRLPKMM-EAVNAGEK 147

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            +      ++K     K       T AFL +Q+GC++FCA+C++PYTRG+  S+  ++++
Sbjct: 148 ALDTDFPEEDKFLNLPKARATRGPT-AFLTVQEGCDKFCAFCVVPYTRGAEVSRSAERLM 206

Query: 178 DEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
            E R L + G +EI L G +  +Y G        L  L+ E+ KIDG++R+R  +  P  
Sbjct: 207 AEARDLVDRGVREITLLGQNVNAYHGAGDGGTWGLARLIREMAKIDGLDRIRFTTSHPND 266

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
             +D++       +L P+ HL +Q+G D  LK MNR++TA +Y  +++ +RD   D+ ++
Sbjct: 267 MEDDLIAAHGDCPELMPYLHLPVQAGSDKILKAMNRKHTAADYIRLIDRIRDARPDLHLS 326

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
            D IVGFPG            ++ +     + FKYS R GT A     QV   +  +   
Sbjct: 327 GDFIVGFPGETEEDFQATLDLVETVGYGTAYSFKYSARPGTPAAERTGQVSEAEASDXXX 386

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
                         +  +G  + VLFE+      G   G +     V+      + G+I 
Sbjct: 387 XXXXXXXXXXXXXXDAMVGRRVKVLFEKPGR-NPGQMIGKSEYLHSVHVDGPDTLRGQIA 445

Query: 417 NVKINSFEGEVAEGEIV 433
            V+I   +     G +V
Sbjct: 446 EVEIAESKTNSLTGRLV 462


>MIAB_RICPR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  196 bits (497), Expect = 4e-52
 Identities = 133/444 (29%), Positives = 228/444 (51%), Gaps = 21/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  + +     GYE  +  + AD+ ++NTC +     +K+   +G
Sbjct: 4   KLYIKTYGCQMNVYDSVKIQDLLYPFGYESTEDIKEADIIILNTCHIREKAAEKTYSELG 63

Query: 62  RARR-QNPE-------AIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKAR 112
           R ++ QN         AII V GC AQ    E+ S    VD+V+G ++   +   ++K  
Sbjct: 64  RIKKLQNTRKQEGLNPAIIVVAGCVAQAEGEEIFSRTPYVDIVVGPQSYYNLPELISKVV 123

Query: 113 DEGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              KQ + +  V + K F++L  + Y     +F+ +Q+GC++FC +C++PYTRG+  S+ 
Sbjct: 124 RHEKQLIDLDFVEEAK-FDNLPEQLYPQGASSFISVQEGCDKFCTFCVVPYTRGAEFSRS 182

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
            ++V  E      +  KEIIL G +  +Y G    +K+ TL DLL+ + +I  + R+R  
Sbjct: 183 VEQVYRESLKAVSNDAKEIILLGQNVNAYHGKGPKDKIFTLADLLKCLAQIPNLARLRYM 242

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+D+++      KL P  HL +QSG +  LK MNR++    Y +I+N LR+  
Sbjct: 243 TSHPIDMTDDLIKLHGTEPKLMPFLHLPVQSGSNKILKAMNRKHDRDYYFNIINRLREAR 302

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ +++D IVGFPG            + R+   + + FKYSPR GT      +Q+  + 
Sbjct: 303 SDIVLSSDFIVGFPGETEQDFEDTLDLVHRVKYGQCYSFKYSPRPGTPGAIRTDQIPEHI 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K +R   L +     + AF +  +G  + VLF+ + +    +   T Y ++    N    
Sbjct: 363 KSKRLTILQQELATQQLAFNQSCVGSTMRVLFDRDGKFEDQIIGKTPYMQSVYIHNPNK- 421

Query: 409 CNVSGKILNV-----KINSFEGEV 427
            ++ GKI++V      +NS  GE+
Sbjct: 422 -SLLGKIVDVIITKAALNSLTGEI 444


>MIAB_NEIMA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  196 bits (497), Expect = 4e-52
 Identities = 140/441 (31%), Positives = 206/441 (46%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           KV   T GC++N Y+S+ M      E  G E V   + AD+ + NTCSV     +K    
Sbjct: 3   KVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSD 62

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  II V GC A Q     +     VDVV G +    +   +      G
Sbjct: 63  LGRVRPLKEKKPGLIIGVAGCVASQEGENIIKRAPYVDVVFGPQTLHRLPKMIVDKETSG 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
             QV +      K F+ L          AF+ I +GC+++C++C++PYTRG   S+    
Sbjct: 123 LSQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCSFCVVPYTRGEEFSRPLND 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSID 233
           VL EI +LA+ G KEI L G +  +Y  ++D  E      LL  + +I GIER+R  +  
Sbjct: 181 VLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLLRIVHEIPGIERMRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT+ ++     L KL  H HL +QSG D  L  M R YTA EY+ I+  LR    D+
Sbjct: 241 PREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDL 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
            +++D IVGFPG            +K IA   + +F YSPR GT A N+ +     +K  
Sbjct: 301 CLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLHDDTPHEEKVR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R + L E+         +  IG V   L E   +         T N   VN     ++  
Sbjct: 361 RLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQLQARTANNRVVNFTGTPDMIN 420

Query: 414 KILNVKIN-----SFEGEVAE 429
           ++++++I      S  G++ E
Sbjct: 421 QMIDLEITEAYTFSLRGKIVE 441


>MIAB_MYCA9 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 507

 Score =  196 bits (497), Expect = 4e-52
 Identities = 126/401 (31%), Positives = 193/401 (48%), Gaps = 16/401 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N ++SE ++      GY        AD+ + NTC+V    D K    I      
Sbjct: 19  TYGCQMNVHDSERVSGLLDAAGYVKAPEGTDADIVIFNTCAVRENADNKLYGNISHLAPR 78

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +  NP   IAV GC AQ      ++    VDVV G+ N G +   + +AR   + QV++ 
Sbjct: 79  KAANPNMQIAVGGCLAQKDREGMLAKAPWVDVVFGTHNIGSLPALLERARHNNEAQVEIV 138

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L++  F         +   A++ I  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 139 EALEH--FPSALPATRESAYAAWVSISVGCNNTCTFCIVPSLRGKEIDRRPGDILGEVQA 196

Query: 183 LAEHGFKEIILSGIHTASYGVDLDE------KVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  +YGV+  +      +    +LL    +IDG+ERVR  S  P  
Sbjct: 197 LVDQGVLEVTLLGQNVNAYGVNFADPEIPRDRGAFAELLRACGRIDGLERVRFTSPHPAE 256

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  LK M R Y ++ +  I++ +R  + D +IT
Sbjct: 257 FTDDVIEAMAQTPNVCPQLHMPLQSGSDRILKAMRRSYRSERFLSIIDKVRSAMPDAAIT 316

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            ++R   S    F+YS R GT A  + +Q+      ER  
Sbjct: 317 TDIIVGFPGETEEDFQQTLEVVRRARFSSAFTFQYSIRPGTPAAKLPDQLPKAVVQERYD 376

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYT 397
           +LI L         +K IG +I+VL    +  G G   G T
Sbjct: 377 RLIALQESVTLEENQKQIGRMIEVL----IATGEGRKDGET 413


>MIAB_KOCRD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 513

 Score =  196 bits (497), Expect = 4e-52
 Identities = 125/379 (32%), Positives = 185/379 (48%), Gaps = 7/379 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           TLGC++N ++SE +T      GY V       D+ V NTC+V    D K    +G+    
Sbjct: 33  TLGCQMNAHDSERITGLLENAGY-VPAVGREPDLVVFNTCAVRENADNKLYGQLGQLAPV 91

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R+N    IAV GC AQ    T V     VDVV G+ N G +   + +AR   + QV++ 
Sbjct: 92  KRRNDRLQIAVGGCLAQKDRSTIVEKAPWVDVVFGTHNIGSLPVLLERARHNQQAQVEIL 151

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F      +       ++ I  GCN  C +C++P  RG    + P  +L E+R+
Sbjct: 152 ESLET--FPSALPTKREQAYAGWVSISVGCNNTCTFCIVPQLRGKEKDRRPGDILAEVRA 209

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL    +I+G+ER+R  S  P  FT+DV+
Sbjct: 210 LVDSGAVEVTLLGQNVNSYGVEFGDRGAFAKLLRACGEIEGLERIRFTSPHPAAFTDDVI 269

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  LKRM R Y +  +  I++ +RD+I D +ITTD+IVG
Sbjct: 270 DAMAETPNVMPQLHMPLQSGSDRILKRMRRSYRSTRFLGILDRVRDRIPDAAITTDIIVG 329

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            +     S    F+YS R GT A  M +QV      ER ++L  L 
Sbjct: 330 FPGETEQDFQDTLDVVAASEFSSAFTFQYSIRPGTPAGEMADQVPAAVVQERFERLTALQ 389

Query: 363 RINEKAFAEKYIGEVIDVL 381
                    + +G   +VL
Sbjct: 390 DGISARLNRQLVGTRAEVL 408


>MIAB_KLEP7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  196 bits (497), Expect = 4e-52
 Identities = 136/444 (30%), Positives = 216/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTEVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R    
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGDHIRQRAHYVDIIFGPQTLHRLPEMINSVRGNRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPCDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR+   D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRVLNLMGRTHTALEYKAIIRKLREARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   + D++
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVP--EADKK 359

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            +  I   RIN++A A   + +G V  +L E          +G T N   VN +   ++ 
Sbjct: 360 QRLYILQERINQQAMAWSRRMLGTVQRILVEGTSRKNIMELSGRTENNRVVNFEGTPDLV 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G++   E
Sbjct: 420 GKFVDVEIVDVYTNSLRGKIVRTE 443


>MIAB_ENT38 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  196 bits (497), Expect = 4e-52
 Identities = 138/444 (31%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLNATHGYELTELAEEADVLLLNTCSIREKAQEKVFHLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +++NP+ II V GC A Q      +    VD+V G +    +   +N  R +  
Sbjct: 64  GRWKLLKKKNPDLIIGVGGCVASQEGKLIRTRSPYVDIVFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V V      K   D   E   +   AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDVSFPEIEKF--DRLPEPRADGPSAFVSIMEGCNKYCTYCVVPYTRGEEVSRPCDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  LA  G +E+ L G +  ++ G + D  + T  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEVAQLAAQGVREVNLLGQNVNAWRGENYDGSIGTFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +Q G D  L  M R +T  EY+ I+  LR+   D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQCGSDRVLNLMGRTHTVLEYKAIIRKLREARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    +  F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTDDFERTMKLIGEINFDVSFSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEK--AFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++  A++ + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQVTAWSRRMLGTTQRILVEGTSRKSVMQLSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++++I     NS  G+V   E
Sbjct: 420 GKFVDIEILEVLTNSMRGKVVRTE 443


>MIAB_ANAMM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 455

 Score =  196 bits (497), Expect = 4e-52
 Identities = 124/379 (32%), Positives = 197/379 (51%), Gaps = 10/379 (2%)

Query: 9   GCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQN 67
           GC++N Y+S  M E  +R  G+  V   E AD+ +VNTC V     +K    +GR R   
Sbjct: 11  GCQMNVYDS-LMVEDILRPLGFAAVQRPEDADIIMVNTCHVREKAAEKLYSALGRMRMLR 69

Query: 68  PE-AIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ-VKVGAV 124
            E A+I V GC AQ     V      VDVV+G ++   +   + KA  + KQ  V+  A+
Sbjct: 70  KEGALIVVAGCVAQAEGEAVFERAPFVDVVVGPQSIHTLPELIMKATRDAKQMNVEFPAI 129

Query: 125 LKNKVFE-DLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
            K  V   DL +   +    AF+ +Q+GC++FC +C++PYTRG   S+  + VL E+R L
Sbjct: 130 SKFDVISTDLLV---SRGVSAFVSVQEGCDKFCTFCVVPYTRGPEYSRSVEDVLAEVRKL 186

Query: 184 AEHGFKEIILSGIHTASY-GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           A+ G KE++L G +  +Y G     +  L  L+ ++ +++GIER+R  +  P      + 
Sbjct: 187 ADGGTKEVVLLGQNVNAYHGTYKGNEWDLGRLIRKVAEVEGIERIRYTTSHPRDMHSSLY 246

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                  KL P  HL +QSG D+ L++MNR+++ +EY DI++ L++   D+++++D IVG
Sbjct: 247 DAHKHEPKLLPCVHLPVQSGSDSVLRKMNRKHSVQEYMDIIDTLKEARSDIALSSDFIVG 306

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++ +  + ++ FKYSPR GT      NQV   +K           
Sbjct: 307 FPGETEEDFEATMDLVRHVGFATSYSFKYSPRPGTPGAEYTNQVPEEEKSSXXXXXXXXX 366

Query: 363 RINEKAFAEKYIGEVIDVL 381
                 F +  IG+ + VL
Sbjct: 367 XXXXXXFTKSMIGKTVSVL 385


>MIAB_SHIB3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  195 bits (496), Expect = 5e-52
 Identities = 138/444 (31%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +       Y++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDATHSYQLTDVAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N  R +  
Sbjct: 64  GRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRGDRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  ++ G + D    +  DLL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAWRGENYDGSTGSFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITDVYPNSLRGKVVRTE 443


>MIAB_AGRT5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 455

 Score =  195 bits (496), Expect = 5e-52
 Identities = 133/446 (29%), Positives = 220/446 (49%), Gaps = 22/446 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S  M++   ++GY   +    AD+ ++NTC +     +K    +G
Sbjct: 11  KVFIKTYGCQMNVYDSVRMSDALAKDGYVQTEDMGEADLVLLNTCHIREKAAEKVYSALG 70

Query: 62  RAR-------RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R        Q  E +I V GC AQ    E+      VDVV+G +    +   + + R 
Sbjct: 71  RLRDMKKSREEQGREFMIGVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPDALKRVR- 129

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEY----NNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ ++    +++K FE L + E     +    AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 130 RGERVIETEYAVEDK-FEHLPVAEKATLRSRGVTAFLTVQEGCDKFCTFCVVPYTRGSEV 188

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVD--LDEKVTLVDLLEEIEKIDGIERV 227
           S+  ++++DE   L + G +EI L G +  ++  +    EK  L +LL  + +I G+ R+
Sbjct: 189 SRPVRQIVDEAMKLVDAGVREITLLGQNVNAWQGEGPKGEKWGLAELLYRLAEIPGLARL 248

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L+ L P+ HL +QSG D  LK MNRR+T +EY  ++  +R
Sbjct: 249 RYTTSHPRDMDDRLIGAHRDLRILMPYLHLPVQSGSDRILKAMNRRHTGEEYIQLIEKIR 308

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
               D++++ D IVGFPG            ++ +  ++   FKYS R GT   ++ +QV 
Sbjct: 309 SARPDIAMSGDFIVGFPGETDRDFEDTMAMVETVKYAQAFSFKYSTRPGTPGADLTDQVA 368

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
            +                   FAE  +G+ +DVL E+   +   +  G +     VN  A
Sbjct: 369 EDVXXXXXXXXXXXXXXXXXXFAESLVGKTMDVLLEKPGRMPEQL-IGRSPWLQSVNLDA 427

Query: 408 DCNVSGKILNVKI-----NSFEGEVA 428
                G I+NV+I     NS   EVA
Sbjct: 428 KTLKIGDIVNVRITATGPNSLFAEVA 453


>MIAB_YERPN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  195 bits (495), Expect = 7e-52
 Identities = 134/428 (31%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ N V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPNNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_YERPE RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  195 bits (495), Expect = 7e-52
 Identities = 134/428 (31%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ N V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPNNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_YERPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  195 bits (495), Expect = 7e-52
 Identities = 134/428 (31%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ N V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPNNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_RHOPT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 463

 Score =  195 bits (495), Expect = 7e-52
 Identities = 131/448 (29%), Positives = 217/448 (48%), Gaps = 23/448 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E+      VDVV+G ++   +   + KA  
Sbjct: 66  RLRVARDEAANHGRRMQIAVAGCVAQAEGEEIIRRAPVVDVVVGPQSYHNLPQLLAKAEQ 125

Query: 114 EGKQ-------QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRG 166
            G+        + K G VL     + ++    +    AF+ +Q+GC++FC +C++PYTRG
Sbjct: 126 HGRALETEFPIEDKFG-VLPQPAPDAIRARGIS----AFVTVQEGCDKFCTFCVVPYTRG 180

Query: 167 SVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGI 224
           +  S+    ++++++ LAE+G +E+ L G +  +Y  D  +    +L  L+  + +I GI
Sbjct: 181 AEMSRPVVAIVEDVKRLAENGVREVTLIGQNVNAYHGDGPDGRAWSLGRLVRRLAEIPGI 240

Query: 225 ERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVN 284
            R+R  +  P    +D++     L  L P  HL +QSG D  L  MNR++TA +Y  +++
Sbjct: 241 VRLRYSTSHPNDVDDDLLAAHRDLPALMPFVHLPVQSGSDRILAAMNRKHTADDYRRVID 300

Query: 285 LLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMEN 344
             R   E ++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M  
Sbjct: 301 RFRSASETIAFSSDFIVGFPGETERDFSATLALVAQIGYAGAYSFKYSPRPGTPAADMVE 360

Query: 345 QVDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN 404
            V     DER             AF +  IG  ++VLF E      G   G T      +
Sbjct: 361 MVPAAVMDERXXXXXXXXXXXXSAFNKAAIGRTVEVLF-ERAGRKPGQIVGRTAYLQPAH 419

Query: 405 AKADCNVSGKILNVKINSFEGEVAEGEI 432
             A  ++ GK+L V+++S E     GE+
Sbjct: 420 VMAPDSIIGKVLPVRVDSLERYSLLGEL 447


>MIAB_PROM5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  195 bits (495), Expect = 7e-52
 Identities = 130/442 (29%), Positives = 212/442 (47%), Gaps = 20/442 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE M     + GY        AD+ + NTC++ +   +K    +GR  ++
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYSRAIDELKADLVLYNTCTIRDSAQQKVYSFLGRQIKR 84

Query: 67  N---PEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
               P+  + V GC AQ    + +  +  +D+++G ++   +   + +  D G Q V   
Sbjct: 85  KHSLPKLKLVVAGCLAQQEGESLLRRVPELDLIMGPQHVNNLENLLERV-DSGNQVV--- 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +  + ED+     ++    ++ I  GCN  C+YC++P  RG   S+ PK +  EI++
Sbjct: 141 ATEETFISEDITNARRDSTICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPKAIKSEIQT 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA++ +KEI L G +  +YG DL        ++ TL DLL  I  +DGI R+R  +  P 
Sbjct: 201 LAQNNYKEITLLGQNIDAYGRDLPVTTKEGRKENTLTDLLYFIHDVDGIRRIRFSTSHPK 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F++ +++    L K+C HFH+  QSG D  L+ M R YT  +Y+ I+  +R  + + SI
Sbjct: 261 YFSKRLIKACYELDKVCEHFHIPFQSGNDEILRLMARGYTIDKYKKIIENIRSLMPNASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  +   +     YSPR  T A    NQ+    K ER 
Sbjct: 321 TADAIVAFPGETEKQYQDTLRLISDVGFDQVMTAAYSPRPNTPAAIWNNQIAEEVKKERL 380

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           K++ EL     +   ++Y+     VL E      S    G TR     ++++    + N 
Sbjct: 381 KEINELVEATSRKRNQRYLNNTESVLIEGLNPKNSMQMMGRTRTNRLTFVEIPENIEFNY 440

Query: 412 S-GKILNVKINSFEGEVAEGEI 432
           S G  LNVKI         G+I
Sbjct: 441 SFGDELNVKITEARSFSLSGQI 462


>MIAB_BIFAA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  195 bits (495), Expect = 7e-52
 Identities = 123/370 (33%), Positives = 188/370 (50%), Gaps = 12/370 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY----EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG- 61
           TLGC++N ++SE +      +GY    E    N   D+ V+NTC+V     ++    IG 
Sbjct: 31  TLGCQMNVHDSERIAGVLEADGYVPATEEQYLNHDIDLIVMNTCAVRENAAERMYGTIGL 90

Query: 62  --RARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
               +R+ P   IAV GC AQ+   +++     VD V G++N G +   +++AR EG  Q
Sbjct: 91  WAELKRERPNLQIAVGGCMAQLDREKIAKKAPWVDAVFGTKNIGSLPQLLDQARIEGHAQ 150

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           VKV   L    F      +  +K  +++ I  GCN  C +C++P TRG    + P  +L 
Sbjct: 151 VKVQEELN--YFPSQLPTDRASKVSSWVAISVGCNNTCTFCIVPTTRGKEHDRRPGDILA 208

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           EIR   + G KE+ L G +  S+G  + ++     LL    +IDG+ERVR  S  P  FT
Sbjct: 209 EIRQCVDEGAKEVTLLGQNVNSFGYGIGDRFAFSKLLRACGEIDGLERVRFTSPHPAAFT 268

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           +DV+  +     +    H  LQSG D  L+ M R Y + ++ DI+  +R+ + D  I+TD
Sbjct: 269 DDVIAAMAETPNVMHQLHFPLQSGSDRILRAMRRSYRSAKFLDILRKIREAMPDAQISTD 328

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVGFPG            ++    +    F YSPR GT A  ME QV  +   +R ++L
Sbjct: 329 IIVGFPGETEEDFQETLRVVEEARFASAFTFIYSPRPGTPAAEME-QVPHDVVQDRFERL 387

Query: 359 IEL-NRINEK 367
           + L  RI E+
Sbjct: 388 VALQERITEE 397


>MIAB_TROWT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 470

 Score =  194 bits (494), Expect = 9e-52
 Identities = 121/385 (31%), Positives = 200/385 (51%), Gaps = 7/385 (1%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M     T GC++N ++SE +      EGY V   ++ ADV V+NTC+V    D +    +
Sbjct: 1   MTYTVRTYGCQMNVHDSERIAGVLEDEGY-VKSGSDDADVVVLNTCAVRENADNRFYGNL 59

Query: 61  GRA-RRQNPEAI--IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+  +++N   I  IAV GC AQ    ++      VDVV G+ N G +   + ++R    
Sbjct: 60  GQLLQKKNNGRIRQIAVGGCLAQKDRHKIFEKAPWVDVVFGTHNLGSLPALLRRSRHNKT 119

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            ++++   L+      L +   +N + A++ I  GCN  C +C++P  RG    + P  +
Sbjct: 120 AEIEIKDFLETFP-SSLPVRRESNYS-AWVSISVGCNNTCTFCIVPSLRGKERDRRPGDI 177

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L EI +L   G  E+ L G +  +YGV+  ++     LL +   I+G+ER++  S  P  
Sbjct: 178 LAEISALVSEGVLEVTLLGQNVNTYGVEFGDRSAFASLLRKAGAIEGLERLKFTSPHPAA 237

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +   + + P  H+ LQSG D  L+ M R Y A ++  I++  R+KI +++IT
Sbjct: 238 FTSDVIDAMHDTQAVLPQLHMPLQSGSDRILRAMRRSYRAGKFLKIISEARNKIPNIAIT 297

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +  +  +    F+YSPR GT A +M NQ+ G+   ER +
Sbjct: 298 TDIIVGFPGETEEDFQDTLNLVAEVRFASAFTFQYSPRPGTPAASMPNQIPGDIVQERYE 357

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +L++L          K IG+ +++L
Sbjct: 358 RLLDLQNRIALEENRKLIGKEVELL 382


>MIAB_THIDA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  194 bits (494), Expect = 9e-52
 Identities = 137/439 (31%), Positives = 204/439 (46%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     EG       E ADV + NTCSV     +K    +
Sbjct: 3   KIYIKTFGCQMNEYDSDKMADVLNAAEGLTPTSTPEDADVILFNTCSVREKAQEKVFHDL 62

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R   + NP  II V GC A Q     V+    VDVV G +    +   + + R+ G+
Sbjct: 63  GRVRHLKQANPNLIIGVGGCVASQEGAAIVARAPFVDVVFGPQTLHRLPELIAQRRETGR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L          AF+ I +GC+++C +C++PYTRG   S+    V
Sbjct: 123 AQVDISFPEIEK-FDHLPPARVEGGA-AFVSIMEGCSKYCTFCVVPYTRGEEVSRPFDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT--LVDLLEEIEKIDGIERVRIGSIDP 234
           + E+ +LA  G KEI L G +  +Y   LDE  T     LLE + +I G+ER+R  +  P
Sbjct: 181 IAEVANLAARGVKEITLLGQNVNAYQGALDEGGTADFAFLLEMVHEIPGVERIRYTTSHP 240

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
              T+ ++     L KL  H HL +QSG D  L  M R +T  E++ IV  LR++  D+ 
Sbjct: 241 REMTQRLIECYGKLPKLVSHLHLPVQSGSDRILAAMKRGHTVLEFKSIVRKLREQRSDLC 300

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D IVGFPG            ++ +    +  F YS R GT A +  + V    K +R
Sbjct: 301 LSSDFIVGFPGETGADFEATMKLVEELNFDASFSFIYSKRPGTPAADYADDVSAELKTQR 360

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L        +      +G V  VL E +    +    G T N   VN      + G+
Sbjct: 361 LMRLQARIEAQAQGVNRSMVGSVQRVLVEGQARKNANELAGRTGNNRIVNFAGPSRLLGQ 420

Query: 415 ILNVKINSFEGEVAEGEIV 433
            ++V I         GE V
Sbjct: 421 FVDVTITQALPHSLRGEAV 439


>MIAB_PASMU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  194 bits (493), Expect = 1e-51
 Identities = 140/444 (31%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLNSTHGLELTEIPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++  P  +I V GC A      + +    VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKELKKHKPGLVIGVGGCVASQEGEHIRTRAPYVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L        T AF+ I +GCN++C++C++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D+ + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGATHDDGICTFAELLRLVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    ++ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRVLSMMKRNHTALEYKSIIRKLRAVRPEIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            + ++    +  F YS R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFIYSARPGTPAADMPDDVTEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN +A  F+   +G    VL E   +      TG T     VN     ++ 
Sbjct: 362 LYVLQQ--RINNQAAQFSRAMLGTEQRVLVEGPSKKDLMELTGRTETNRIVNFVGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  GEV   E
Sbjct: 420 GKFVDIKITDVFTNSLRGEVVRTE 443


>MIAB_ORITI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  194 bits (493), Expect = 1e-51
 Identities = 134/444 (30%), Positives = 226/444 (50%), Gaps = 25/444 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+S  M +    +GY +V     A V ++NTC +     +K    +GR ++ 
Sbjct: 9   TYGCQMNVYDSNRMVDLLETQGYNIVANMADASVIILNTCHIREKASEKMYSELGRIKKL 68

Query: 67  NP--------EAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
                     +A I V GC  Q    E+   E  V++++G ++   +   + K  D G +
Sbjct: 69  QQSRLKAGKSKAKIIVAGCVGQAEGEEIFIREPAVNIIVGPQSYYNLPTMLEKL-DSGTE 127

Query: 118 QVKVG-----AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
              +      A   NK+ E LK    +      + +Q+GC++FC +C++PYTRG+  S+ 
Sbjct: 128 NHLIDLDFVEAAKFNKLPEVLK----SPTVSGLVSVQEGCDKFCTFCVVPYTRGAEFSRP 183

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEK-VTLVDLLEEIEKIDGIERVRIG 230
            ++V  E+ ++A+ G KE++L G + ++Y G D + K  +L DL++ + KID I+R+R  
Sbjct: 184 LEQVYREVLNIAQQGAKEVVLVGQNVSAYHGKDENGKECSLADLIKYVAKIDKIKRIRYI 243

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+ ++      +KL P  HL +QSG +  LK MNRR++ + Y +I+  LR+  
Sbjct: 244 TSHPNDMTDQLLSLHATEEKLMPFLHLPVQSGSNKILKLMNRRHSRERYLEIIQQLRELR 303

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+ I++D+IVGFPG             K     + + FKYS R GT A  ++ Q+    
Sbjct: 304 PDIVISSDIIVGFPGEDDEDFEATLSLAKEARFGQCYSFKYSQRPGTPAA-VKQQISEEV 362

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKAD 408
           K  R   L       +    +K IG+V+ VLF+ + +    +   T Y ++   +N K D
Sbjct: 363 KQHRLSILQAQLMQQQLECNQKLIGKVVPVLFDRDGKYDGQIIGKTPYMQSVCIMNEK-D 421

Query: 409 CNVSGKILNVKINSFEGEVAEGEI 432
            N+ GKI+NVKI +       GE+
Sbjct: 422 NNLYGKIVNVKILTASASSLFGEV 445


>MIAB_NOCSJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 496

 Score =  194 bits (493), Expect = 1e-51
 Identities = 121/384 (31%), Positives = 191/384 (49%), Gaps = 10/384 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE +T      GY      + ADV V NTC+V    D K    +G     
Sbjct: 16  TYGCQMNVHDSERLTGLLEDAGYVAAPDGQQADVVVFNTCAVRENADNKLYGNLGHLAPV 75

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +   P   IAV GC AQ    T  +    VDVV G+ N G +   + +AR + + QV++ 
Sbjct: 76  KAATPGMQIAVGGCLAQKDRDTITTRAPWVDVVFGTHNIGSLPALLERARVQDEAQVEIL 135

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+  VF         +   A++ +  GCN  C +C++P  RG    + P ++L E+ +
Sbjct: 136 ESLE--VFPSTLPTRRESAYAAWVSVSVGCNNTCTFCIVPSLRGKEKDRRPGEILAEVEA 193

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L   G  EI L G +  +YGV+  ++     LL    ++DG+ERVR  S  P  FT+DV+
Sbjct: 194 LVADGVSEITLLGQNVNAYGVEFGDRQAFSKLLRACGEVDGLERVRFTSPHPAEFTDDVI 253

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  L+ M R Y  +++  I+  +R  + D +ITTD+IVG
Sbjct: 254 AAMAETPNVMPQLHMPLQSGSDKVLRDMRRSYRQRKFLGILERVRAAMPDAAITTDIIVG 313

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    S    F+YS R GT A  + +QV      +R ++L+ L 
Sbjct: 314 FPGETEEDFLQTMHVVRAARFSGAFTFQYSKRPGTPAATLPDQVPPEVVKDRYERLVAL- 372

Query: 363 RINEKAFAE--KYIGEVIDVLFEE 384
            +NE A+ E  + +G  ++++  E
Sbjct: 373 -VNEIAWEENKRLVGRRVELMVAE 395


>MIAB_ENTS8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  194 bits (493), Expect = 1e-51
 Identities = 136/444 (30%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G+ + D  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLETTHGFTLTDVAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +      VD++ G +    +   +N+ +    
Sbjct: 64  GRWKTLKEKNPDVIIGVGGCVASQEGDHIRDRARYVDIIFGPQTLHRLPEMINQVKGTRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C YC++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LA  G +E+ L G +  ++ G + D    T  DLL  +  IDGI+R+R  +  P
Sbjct: 182 VLEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGTFADLLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIEVYRDTPELVSFLHLPVQSGSDRVLNMMGRTHTALEYKAIIRKLRAARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    ++ F +S R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLIAEVNFDMSYSFIFSARPGTPAADMVDDVPEEEKKQR 361

Query: 355 SKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RIN++A A   + +G    +L E          +G T N   VN +   ++ 
Sbjct: 362 LYILQE--RINQQAMAWSRRMLGTTQRILVEGTSRKSIMELSGRTENNRVVNFEGSPDMV 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 420 GKFVDVEITEVFPNSLRGKVIRTE 443


>MIAB_YERPY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  194 bits (492), Expect = 2e-51
 Identities = 132/428 (30%), Positives = 211/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  ++   
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQETNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_TROW8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 470

 Score =  194 bits (492), Expect = 2e-51
 Identities = 121/385 (31%), Positives = 199/385 (51%), Gaps = 7/385 (1%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M     T GC++N ++SE +      EGY V   ++ ADV V+NTC+V    D +    +
Sbjct: 1   MTYTVRTYGCQMNVHDSERIAGVLEDEGY-VKSGSDDADVVVLNTCAVRENADNRFYGNL 59

Query: 61  GRA-RRQNPEAI--IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+  +++N   I  IAV GC AQ    ++      VDVV G+ N G +   + ++R    
Sbjct: 60  GQLLQKKNNGRIRQIAVGGCLAQKDRHKIFEKAPWVDVVFGTHNLGSLPALLRRSRHNKT 119

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            ++++   L+      L +   +N + A++ I  GCN  C +C++P  RG    + P  +
Sbjct: 120 AEIEIKDFLETFP-SSLPVRRESNYS-AWVSISVGCNNTCTFCIVPSLRGKERDRRPGDI 177

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L EI +L   G  E+ L G +  +YGV+  ++     LL +   I+G+ER++  S  P  
Sbjct: 178 LAEISALVSEGVLEVTLLGQNVNTYGVEFGDRSAFASLLRKAGAIEGLERLKFTSPHPAA 237

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT DV+  +   + + P  H+ LQSG D  L+ M R Y A ++  I++  R+KI +++IT
Sbjct: 238 FTSDVIDAMHDTQAVLPQLHMPLQSGSDRILRAMRRSYRAGKFLKIISEARNKIPNIAIT 297

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +  +  +    F+YSPR GT A +M NQ+ G+   ER  
Sbjct: 298 TDIIVGFPGETEEDFQDTLNLVAEVRFASAFTFQYSPRPGTPAASMPNQIPGDIVQERYD 357

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +L++L          K IG+ +++L
Sbjct: 358 RLLDLQNRIALEENRKLIGKEVELL 382


>MIAB_DESVV RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  194 bits (492), Expect = 2e-51
 Identities = 123/383 (32%), Positives = 198/383 (51%), Gaps = 8/383 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N  +S+ +    +  G+    F E A + +VNTCSV +  ++K   ++GR R+ 
Sbjct: 10  TFGCQMNVNDSDWLARALMERGFSPAPFGE-ARLTIVNTCSVRDKPEQKVYSLLGRIRQA 68

Query: 66  --QNPEAIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
             + P+A +AV GC AQ I     S    V +V G+         +++  +E   ++ + 
Sbjct: 69  TGKKPDAFVAVGGCVAQQIGSGFFSRFPQVRLVFGTDGLAMAPQALDRLVEEPDLKLSLL 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
              ++    D  + +       F+ I  GC+ FCAYC++PYTRG   S+    +LDE R+
Sbjct: 129 DFSEDYPERDAVLGQGAVPASVFVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRA 188

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           L + G +EI L G +  S+G D   +  T   LL ++  + G+ER+R  +  P     +V
Sbjct: 189 LLDRGAREITLLGQNVNSFGQDSHGDGTTFAQLLHKVAALPGLERLRFVTPHPKDIAPEV 248

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           V     L  LCP  HL LQ+G D  LK M RRY    Y  IV+ LR    D+ +++D+IV
Sbjct: 249 VEAFGTLPNLCPRLHLPLQAGSDRILKLMGRRYDMARYLRIVDDLRAARPDIVLSSDIIV 308

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            L+ +  + ++ F YS R GTRAE + +++    K ER ++L  L
Sbjct: 309 GFPGETEEDFMETMGALETVGYAASYSFCYSDRPGTRAEMLPDKLSREVKLERLERLQTL 368

Query: 362 -NRINEKAFAEKYIGEVIDVLFE 383
            NR+ E+   +  +G+ ++VL E
Sbjct: 369 QNRLTERCL-QDMVGKKVEVLLE 390


>MIAB_MYCGI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  193 bits (491), Expect = 2e-51
 Identities = 132/438 (30%), Positives = 203/438 (46%), Gaps = 22/438 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE ++    + GY+       AD+ V NTC+V    D K   +   +   
Sbjct: 27  TYGCQMNVHDSERLSGLLEQAGYQRAGAGVDADIVVFNTCAVRENADNKLYGNLSHLAPR 86

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++ +P+  IAV GC AQ     V      VDVV G+ N G +   +++AR     QV++ 
Sbjct: 87  KQADPQMQIAVGGCLAQKDRDAVLRKAPWVDVVFGTHNIGSLPTLLDRARHNRVAQVEIA 146

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  VL E+++
Sbjct: 147 ESLRE--FPSALPASRESAYAAWVSISVGCNNTCTFCIVPSLRGKEVDRRPGDVLAEVQA 204

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVD------LLEEIEKIDGIERVRIGSIDPTF 236
           L + G  EI L G +  +YGV   +     D      LL    +IDG+ERVR  S  P  
Sbjct: 205 LVDQGVLEITLLGQNVNAYGVSFADPTEARDRGAFAKLLRACGRIDGLERVRFTSPHPAE 264

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  L+ M R Y A  Y  I++ +R  I   +IT
Sbjct: 265 FTDDVIEAMAQTSNVCPTLHMPLQSGSDRILRAMRRSYRADRYLGIIDRVRTAIPHAAIT 324

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            ++    S    F+YS R GT A  +E Q+      ER +
Sbjct: 325 TDLIVGFPGETEEDFQATLDVVEAARFSSAFTFQYSKRPGTPAAELEGQIPKAVVSERYQ 384

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
           +LIEL            IG  +++L          V TG  R        +     G+++
Sbjct: 385 RLIELQERISWEENRAQIGREVELL----------VATGEGRKDAATARMSGRARDGRLV 434

Query: 417 NVKINSFEGEVAEGEIVL 434
           +    +   ++  G+IV+
Sbjct: 435 HFAPGALGADIRPGDIVV 452


>MIAB_DESVH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  193 bits (491), Expect = 2e-51
 Identities = 123/383 (32%), Positives = 197/383 (51%), Gaps = 8/383 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR- 65
           T GC++N  +S+ +    +  G+    F E A + +VNTCSV +  ++K   ++GR R+ 
Sbjct: 10  TFGCQMNVNDSDWLARALMERGFSPAPFGE-ARLTIVNTCSVRDKPEQKVYSLLGRIRQA 68

Query: 66  --QNPEAIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
             + P+A +AV GC AQ I     S    V +V G+         +++  +E   ++ + 
Sbjct: 69  TSKKPDAFVAVGGCVAQQIGSGFFSRFPQVRLVFGTDGLAMAPQALDRLVEEPDLKLSLL 128

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
              ++    D  + +       F+ I  GC+ FCAYC++PYTRG   S+    +LDE R+
Sbjct: 129 DFSEDYPERDAVLGQGAVPASVFVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRA 188

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           L + G +EI L G +  S+G D   +  T   LL ++  + G+ER+R  +  P     +V
Sbjct: 189 LLDRGAREITLLGQNVNSFGQDSHGDGTTFAQLLHKVAALPGLERLRFVTPHPKDIAPEV 248

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           V     L  LCP  HL LQ+G D  LK M RRY    Y  IV+ LR    D+ +++D+IV
Sbjct: 249 VEAFGTLPNLCPRLHLPLQAGSDRILKLMGRRYDMARYLRIVDDLRAARPDIVLSSDIIV 308

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            L+ +  + ++ F YS R GTRAE + +++    K ER ++L  L
Sbjct: 309 GFPGETEEDFMETMDALETVGYAASYSFCYSDRPGTRAEMLPDKLSREVKLERLERLQTL 368

Query: 362 -NRINEKAFAEKYIGEVIDVLFE 383
            NR+ E+   +  +G  ++VL E
Sbjct: 369 QNRLTERCL-QDMVGRKVEVLLE 390


>MIAB_YERPP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  193 bits (490), Expect = 3e-51
 Identities = 133/428 (31%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_YERPG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  193 bits (490), Expect = 3e-51
 Identities = 133/428 (31%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_WOLPP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 440

 Score =  193 bits (490), Expect = 3e-51
 Identities = 127/385 (32%), Positives = 199/385 (51%), Gaps = 7/385 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR--AR 64
           T GC++N Y+S  M       G+ VV   E AD+ ++NTC +     +K    +GR  + 
Sbjct: 8   TYGCQMNVYDSILMENIVKPLGFNVVSDAEQADLVILNTCHIREKAAEKLYSELGRIHSS 67

Query: 65  RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGA 123
           ++N E  I V GC AQ    EV      VD+V+G ++   +   + KA    K  V    
Sbjct: 68  QKNKEMTIVVAGCVAQAEGEEVFRRAPFVDIVVGPQSIPALPELIVKA-SRSKGHVINTD 126

Query: 124 VLKNKVFEDLKIEEYNNK--TRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
             +   F+ L  E Y N   + AFL IQ+GC++FC +C++PYTRG+  S+   ++  E  
Sbjct: 127 FPEVAKFDKLPDECYGNSQGSSAFLAIQEGCDKFCTFCVVPYTRGAEYSRPVNEIFREAL 186

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           +L ++G KEI L G +  +Y  + + +V  L  L+  I KI+ +ER+R  +  P    E 
Sbjct: 187 NLVKNGAKEITLLGQNVNAYHGECEGEVWDLGKLISHIAKIEKLERIRYTTSHPRDMHES 246

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +        KL P  HL +QSG +  L  MNR++TA+EY  I++ LR    ++  ++D I
Sbjct: 247 LYLVHAEESKLMPFVHLPVQSGSNKILHAMNRKHTAEEYLGIIDRLRKLKPEIEFSSDFI 306

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++++  ++ + FKYSPR GT     ++QV    K ER  +L E
Sbjct: 307 VGFPGETEKDFEETMKLVEKVKYAQAYSFKYSPRPGTPGAERKDQVPEEVKTERLLRLQE 366

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEE 385
           L    +  F +  IG+ I VLF ++
Sbjct: 367 LISKQQLEFNQSMIGKTIPVLFSDK 391


>MIAB1_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB 1;       
           EC=2.-.-.-;AltName: Full=tRNA-i(6)A37
           methylthiotransferase 1;
          Length = 529

 Score =  193 bits (490), Expect = 3e-51
 Identities = 133/444 (29%), Positives = 207/444 (46%), Gaps = 29/444 (6%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           TLGC +N ++SE M       GY   D    AD+ V NTC+V    D K   S   +   
Sbjct: 31  TLGCLMNAHDSERMAGLLEDAGYIKADPGAPADLVVFNTCAVRENADNKLYGSLAHLAPI 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +   P   IAV GC AQ     V      VDVV G+ N G +   + ++R     QV++ 
Sbjct: 91  KASRPGMQIAVGGCLAQKDRHIVLDRAPWVDVVFGTHNIGSLPVLLERSRHNQDAQVEIL 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F        ++   A++ I  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 151 ESLRT--FPSALPAARDSAYAAWVSISVGCNNSCTFCIVPSLRGKEADRRPGDILAEVQA 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLDE-------------KVTLVDLLEEIEKIDGIERVRI 229
           L E G  E+ L G +  SYGV+  +             +     LL    +I+G+ER+R 
Sbjct: 209 LVEQGVLEVTLLGQNVNSYGVNFADPDPSTGEEPLPRDRGAFAQLLRACGRIEGLERIRF 268

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            S  P  FT+DV+  +     +CPH H+ LQSG D  LK M R Y    Y  I++ +R  
Sbjct: 269 TSPHPAEFTDDVILAMAETPAVCPHLHMPLQSGSDQILKAMRRSYRRDRYLGIIDKVRAA 328

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
           I   +ITTD+IVGFPG            +++   +    F+YSPR GT A +M +Q+  N
Sbjct: 329 IPHAAITTDIIVGFPGETEHDFEQTLDVVQKARFTSAFTFQYSPRPGTPAADMPDQIPKN 388

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
              +R ++L+ L            +G   ++L    V  G G     T    +++ +A  
Sbjct: 389 VVQQRFERLVALQERISLESNRSLVGTRQELL----VVAGEGRKNATT---ARISGRAR- 440

Query: 410 NVSGKILNVKINSFEGEVAEGEIV 433
              G++++ + +S +G V  G++V
Sbjct: 441 --DGRLVHFRPDSADGSVRPGDLV 462


>Y416_RICPR RecName: Full=Putative methylthiotransferase RP416;     
              EC=2.-.-.-;
          Length = 421

 Score =  192 bits (489), Expect = 4e-51
 Identities = 121/406 (29%), Positives = 198/406 (48%), Gaps = 26/406 (6%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           ++    T GCR+N YESE + +     G +        +V + NTC+VT           
Sbjct: 10  LRQEIVTFGCRLNIYESEIIRKNLELSGLD--------NVAIFNTCAVTKSXXXXXXXXX 61

Query: 61  GRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
                 NP+  I V GC AQ  P     +  VD V+G+  K    YY         Q++ 
Sbjct: 62  XXXXXNNPDLKIIVTGCSAQANPKMYGNMSEVDKVIGNEEKLLSHYY-----QITDQKIS 116

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           V  ++  K      +  ++ K+RAF+++Q+GC+  C +C+IPY RG   S     ++ ++
Sbjct: 117 VNDIMSVKETACHLVSSFDGKSRAFIQVQNGCDHNCTFCIIPYVRGKSRSIPIGTIVAQV 176

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEK-IDGIERVRIGSIDPTFFTE 239
           + L   GFKE++++G+   +YG DL    T   +++ + K +  ++R+R+ SID     +
Sbjct: 177 KHLVLKGFKEVVITGVDVTAYGSDLPGSPTFAQMIKRVLKLVPELKRMRLSSIDIAEIDD 236

Query: 240 DVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDV 299
           ++   I   +++ PHFH+S+QSG D  LKRM RR+      +    LR    +VS   D+
Sbjct: 237 ELFELIAYSERIMPHFHISVQSGDDMILKRMKRRHNRASVIEFCQKLRAIRPEVSFGADI 296

Query: 300 IVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLI 359
           I GFP             +    L   H+F YS R+GT A  M  QV  N + ER+K L 
Sbjct: 297 IAGFPTETNEMFENTRKLILEAELQYLHVFPYSEREGTPAARMP-QVPQNIRKERAKILR 355

Query: 360 E--LNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKV 403
           +   N++NE  F +++IG+ +++L E            +T N+I V
Sbjct: 356 QDGFNQLNE--FFKRHIGQKVELLIENN-------NIAHTENFIPV 392


>MIAB_YERPS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (489), Expect = 4e-51
 Identities = 132/428 (30%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_YERPB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (489), Expect = 4e-51
 Identities = 132/428 (30%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_YERP3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (489), Expect = 4e-51
 Identities = 132/428 (30%), Positives = 210/428 (49%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++    E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTTIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NP+ II V GC A     ++      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPQLIIGVGGCVASQEGEQLRQRAPCVDVIFGPQTLHRLPEMINHVQGTNS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  I    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIVGFPGETQQDFEQTMKLVADIHFDTSYSFIYSPRPGTPAADLPDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI+++A   + K +G V  VL E           G T N   VN +   ++ 
Sbjct: 362 LHILQQ--RISQQAMEISRKMVGTVQRVLVEGTSRKNVMELAGRTENNRVVNFEGSPDMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_SPHAL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  192 bits (489), Expect = 4e-51
 Identities = 127/420 (30%), Positives = 212/420 (50%), Gaps = 7/420 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           + GC++N Y+ E M E    EGY          + V+NTC +     +K    IGR +R 
Sbjct: 13  SFGCQMNVYDGERMAEMLGAEGYVPXXXXXXXXLVVLNTCHIREKAAEKVYSDIGRLKRD 72

Query: 67  NPEA-IIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAV 124
           +     IAV GC AQ    E++     VDVV+G +    +   + +A + G++ + +   
Sbjct: 73  DGSTPTIAVAGCVAQAEGAEIARRAPSVDVVVGPQAYHRLPELIARA-ERGEKAIDLDMP 131

Query: 125 LKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLA 184
            ++K F  L     N +  AFL +Q+GC++FC YC++PYTRG+  S+    ++ E R+L 
Sbjct: 132 AESK-FGALPKRSGNQRPTAFLTVQEGCDKFCTYCVVPYTRGAEISRPFADLIAEARALV 190

Query: 185 EHGFKEIILSGIHTASY-GVDLDEKVTLVD-LLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
             G +EI L G +  ++ G D   +   +D L+ E+ K DG+ER+R  +  P   T+ ++
Sbjct: 191 AGGVREITLLGQNVNAWIGEDAKGRAIGLDGLIRELAKEDGLERIRYTTSHPNDMTDGLI 250

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                + KL P  HL +Q+G D  L  MNR ++ + Y  ++  +R+   D++I+ D IVG
Sbjct: 251 VAHGEVDKLMPFLHLPVQAGSDRILAAMNRSHSVESYLKVIERVREARPDIAISGDFIVG 310

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    +  + FKYS R GT A  M++Q+D    +ER ++L  L 
Sbjct: 311 FPGESEADFAATLDIVRATRYAMAYSFKYSRRPGTPAATMDDQIDEAVMNERLQRLQALL 370

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKINS 422
              ++AF E  +G    +L E + +   G   G +     V+  A     G +++V+I S
Sbjct: 371 NEQQQAFNEATVGRTTRLLLERKGK-REGQLIGKSPWLQSVHVTAPGLAIGDMIDVRITS 429


>MIAB_ACTSZ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (489), Expect = 4e-51
 Identities = 141/444 (31%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  + +  +   G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSAKIADLLLSTHGLELTEEAEQADVLLLNTCSIREKAQEKVFSQL 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +    + P  II V GC A      +      VD++ G +    +   +N+ R  GK
Sbjct: 64  GRWKTWKNEKPGLIIGVGGCVASQEGEHIRERAPFVDIIFGPQTLHRLPEMINQIRG-GK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V   +  + + F+ L   +    T AF+ I +GCN++C YC++PYTRG   S+    V
Sbjct: 123 SSVVDVSFPEIEKFDCLPEPKAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  LA+ G +EI L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEVAQLADQGVREINLLGQNVNAYRGPTHDGGICTFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYADTPELVSFLHLPVQSGADRILTMMKRGHTALEYKSIIRKLRKVRPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +    +  F YS R GT A +M + V   +K +R
Sbjct: 302 ISSDFIVGFPGETNEEFEQTMNLIADVNFDMSFSFVYSARPGTPAADMPDDVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN +A  F+   +G    VL E   +      TG T N   VN K   ++ 
Sbjct: 362 LYLLQQ--RINNQAAKFSRAMLGTEQRVLVEGPSKKDIMELTGRTENNRIVNFKGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++++I     NS  G+V   E
Sbjct: 420 GKFVDIQITDVFTNSLRGDVIRTE 443


>RIMO_DESHY RecName: Full=Ribosomal protein S12
           methylthiotransferase rimO;         Short=S12
           methylthiotransferase;         Short=S12 MTTase;
          Length = 445

 Score =  192 bits (488), Expect = 5e-51
 Identities = 115/389 (29%), Positives = 201/389 (51%), Gaps = 10/389 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KVA  TLGC  N  +SE MT   + + Y++V+  E AD+ ++NTC+       +S  +I 
Sbjct: 7   KVAVVTLGCPKNQVDSEIMTGHMMTK-YQIVNEPEQADIIIINTCTFIESAKAESIDMIL 65

Query: 62  RARRQNPEA---IIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           +  +   E     +   GC AQ    E+ + I  +D ++G+ N  EI+  + +A     +
Sbjct: 66  QMSQYKEEGQCQTLVATGCLAQRYGDELLAEIPELDGIMGTGNVAEILETLEEAEKSKVR 125

Query: 118 QV--KVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           ++  +  A + ++    +++     K  A++K+ +GC+ +C YC+IP+ RG   S+  + 
Sbjct: 126 RISAEAPAFIYDETMPRVRLSP---KQYAYVKVAEGCDNYCTYCIIPHVRGHFRSRTQES 182

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           +L E+ ++A  G KE++L    T  YG D   +  L  L++EI +I+GIE +R+    P 
Sbjct: 183 ILREVEAMASEGVKEVLLIAQDTTRYGKDRYGEYRLPSLIKEIARIEGIEWIRLMYCYPE 242

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT++++  +    K+C +  L LQ   D  L  MNRR T +E E +++ LR +I D+ +
Sbjct: 243 LFTDELITVMKETPKVCRYLDLPLQHAHDKVLAEMNRRGTIREAEGLIHKLRQEIPDIRL 302

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
            T +I GFPG             K+I   +   F YS  + T A   E+QV    + +R 
Sbjct: 303 RTTMITGFPGETEEEFQAVVEFAKKIRFDRLGAFAYSQEESTPAAQREDQVPEEIRQQRR 362

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEE 384
            +L+EL         ++++G+ + VL EE
Sbjct: 363 DQLMELQHDIAYEQQQRWVGQTLKVLIEE 391


>MIAB_STRCO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 505

 Score =  192 bits (488), Expect = 5e-51
 Identities = 125/386 (32%), Positives = 185/386 (47%), Gaps = 12/386 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY----EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           T GC++N ++SE ++      GY    E  D +  ADV V NTC+V    D K    +G 
Sbjct: 20  TYGCQMNVHDSERLSGLLEDAGYVRAPEGADGD--ADVVVFNTCAVRENADNKLYGNLGH 77

Query: 63  A---RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
               +   P   IAV GC AQ    T V     VDVV G+ N G++   + +AR + + Q
Sbjct: 78  LAPKKASRPGMQIAVGGCLAQKDRDTIVKRAPWVDVVFGTHNIGKLPVLLERARVQEEAQ 137

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V++   L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L 
Sbjct: 138 VEIAESLE--AFPSTLPTRRESAYAAWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILA 195

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           E+ +L   G  EI L G +  +YG D+ ++     LL     IDG+ERVR  S  P  FT
Sbjct: 196 EVEALVAEGVSEITLLGQNVNAYGSDIGDREAFSKLLRACGNIDGLERVRFTSPHPRDFT 255

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           +DV+  +       P  H+ LQSG D  LK M R Y  + Y  I+  +R  I   +ITTD
Sbjct: 256 DDVIAAMAETPNAMPQLHMPLQSGSDPVLKAMRRSYRQERYLGIIEKVRAAIPHAAITTD 315

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVGFPG            ++    ++   F+YS R GT A  MENQ+      ER ++L
Sbjct: 316 IIVGFPGETEEDFEQTLHVVREARFAQAFTFQYSKRPGTPAAEMENQIPKAVVQERYERL 375

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEE 384
           + L         +K +G  ++++  E
Sbjct: 376 VALQEEISWDENKKQVGRTLELMVAE 401


>MIAB_RHILO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  192 bits (488), Expect = 5e-51
 Identities = 121/397 (30%), Positives = 197/397 (49%), Gaps = 16/397 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           KV   T GC++N Y+S+ M +    +GY   D  + AD+ ++NTC +     +K    +G
Sbjct: 8   KVFIKTYGCQMNVYDSQRMGDALAADGYTATDAIDEADLVLLNTCHIREKAAEKVYSELG 67

Query: 62  RARRQNPEAIIA-------VVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    E  IA       V GC AQ    E+      VD+V+G +    +   + + R 
Sbjct: 68  RIRDMKAERAIAGRELLIGVAGCVAQAEGAEIIRRSPAVDLVIGPQTYHRLPDVLARVRG 127

Query: 114 EGKQQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
            G++ V+    +++K F+ L    + E       AFL +Q+GC++FC +C++PYTRGS  
Sbjct: 128 -GEKIVETDYAIEDK-FDHLPQPKRAEVIKRGVTAFLTVQEGCDKFCTFCVVPYTRGSEV 185

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERV 227
           S+   +++ E   LAE G +E+ L G +  ++    +  E+  L  LL  + +I G+ R+
Sbjct: 186 SRPVAQIVAEAERLAEAGVREVTLLGQNVNAWHGQGENGEEWGLGRLLFRLAEIPGLARL 245

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    ++++     L  L P+ HL +QSG D  LK MNRR+TA++Y  +++ +R
Sbjct: 246 RYTTSHPRDMDDELISAHRDLPSLMPYLHLPVQSGSDRILKAMNRRHTARDYLALLDRIR 305

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
               D++++ D IVGFPG            ++++  +    FKYSPR GT    M + V 
Sbjct: 306 AARPDIALSGDFIVGFPGETEADFEATMELVRQVNYASAFSFKYSPRPGTPGAEMPDHVP 365

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEE 384
              KDER              F    +G  ID L E+
Sbjct: 366 ETLKDERXXXXXXXXXXXXXGFGSSLVGSTIDTLIEK 402


>MIAB_PSEA6 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 477

 Score =  192 bits (488), Expect = 5e-51
 Identities = 138/444 (31%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +      GY+V D  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLFIKTWGCQMNEYDSQKMADLLDSTHGYQVADTAEEADIILLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++  PE II V GC A Q           VD+V G +    +   +N+ +    
Sbjct: 64  GRWKNLKQDKPELIIGVGGCVASQEGQVIRQRAPFVDLVFGPQTLHRLPEMINQIKGGSS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L   +    T AF+ I +GC+++C +C++PYTRG   S+    V
Sbjct: 124 SVIDISFPEIEK-FDRLPEPKAEGPT-AFVSIMEGCSKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  LAE G +E+ L G +  ++ G   D  + T  +LLE +  IDGI+R+R  +  P
Sbjct: 182 LLEVAQLAEQGVREVNLLGQNVNAFRGPHHDGAICTFAELLEMVASIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++     + +L  H HL +QSG D  L  M R +TA EY+  +  LR    ++S
Sbjct: 242 VEFTDDIIDAYATIPELVDHLHLPVQSGSDRVLNLMKRGHTAIEYKSKIRKLRKIRPNLS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            ++ +    +  F YS R GT A ++ + V    K ER
Sbjct: 302 MSSDFIIGFPGETDDDFEATMDLIQAMDFDLSFSFIYSARPGTPAADLPDDVSETTKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            + L   NRI ++A   A   I     VL E   +      +G T N   VN +   ++ 
Sbjct: 362 LQLL--QNRITQQALRIARNMIDSEQRVLVEGPSKKNPMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++VKI     NS  G+V   E
Sbjct: 420 GGFVDVKITDVFANSLRGDVLRKE 443


>MIAB_NITSB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 433

 Score =  192 bits (488), Expect = 5e-51
 Identities = 140/437 (32%), Positives = 207/437 (47%), Gaps = 23/437 (5%)

Query: 7   TLGCRVNTYESE-AMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR 65
           TLGC +N  +SE  + E   +E YE+    + AD+ ++NTCSV      K    IG   +
Sbjct: 9   TLGCAMNVRDSEHIIAELTQKEDYELTQNLQEADLILINTCSVREKPVHKLFSEIGYFNK 68

Query: 66  QNPE-AIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGA 123
           +  E A I V GC A     E+      V  VLG+RN       V+K RD  KQ+  V  
Sbjct: 69  KKKEGAKIGVCGCTASHLGEEIIKKAPYVSFVLGARN-------VSKIRDVIKQEKAVEV 121

Query: 124 VL----KNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
            +        F D +   Y    +AF+ I  GC++ C +C++P TRG   S  P+ +L E
Sbjct: 122 DIDYDESTYAFSDFRTSPY----KAFINISIGCDKKCTFCIVPNTRGEEISIPPELILQE 177

Query: 180 IRSLAEHGFKEIILSGIHTASYG---VDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           +R   + G KEI L G +  +YG    D   KV   DLL  + +IDG+ R+R  S  P  
Sbjct: 178 VRRAVDTGAKEIFLLGQNVNNYGRSFSDKARKVDFTDLLRMVSEIDGVRRIRFTSPHPLH 237

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
             +  ++      K+C   H+ LQSG    L+ M R YT + + D    LR+ + +V I+
Sbjct: 238 MDDKFLQEFATNPKICKSMHMPLQSGSTKVLRDMKRGYTKEWFLDRAMKLREMVPEVHIS 297

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            ++++   +   FKYSPR  T A++ ENQ+       R  
Sbjct: 298 TDIIVGFPGESEEDFADTIDVVQKVRFEQIFSFKYSPRPLTPAKDYENQIPDEVASRRLS 357

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
            L +L+     + +E+   +V +V FEE      G   G T N   V  K    + G+  
Sbjct: 358 YLQDLHLQMLDSISEQEKDKVYEVYFEELKP--GGYVAGRTDNNWIVKVKGSEELLGEFK 415

Query: 417 NVKINSFEGEVAEGEIV 433
           +V+I        EGE+V
Sbjct: 416 SVRITKPGRLSLEGELV 432


>MIAB_LEPBL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  192 bits (488), Expect = 5e-51
 Identities = 125/442 (28%), Positives = 214/442 (48%), Gaps = 15/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  ++       Y      E +D+  +NTC++      K     Q
Sbjct: 12  KVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKIYNRLQ 71

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NPE +I V+GC AQ    ++   E  +D+V+G  N   +   + + R  G+ 
Sbjct: 72  SLGYLKKRNPELVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRS-GEH 130

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +  + K + +++++    N   +AF+ I  GCN FC +C++PYTRG   S+DPK ++
Sbjct: 131 SISLTRLSKIETYDEIEPRVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSRDPKSIV 189

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            EI+ L E G +++ L G +  SY    ++      L++ +     IER+R  S  P  F
Sbjct: 190 REIQDLTEKGIRQVTLLGQNVNSYK---EQGTDFAGLIQMLLDETTIERIRFTSPHPKDF 246

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
              ++R +    + CP+ HL LQ+G    L+ M R Y+ +E+ D+V  +R+ + DV ITT
Sbjct: 247 PVRLLRLMAQNPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVREIRNIVPDVGITT 306

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGNKKDERSK 356
           D+IVGFP             ++ +      +FKYS R+GT A + + + V    K  R  
Sbjct: 307 DIIVGFPNETEEEFEDTLAVVREVQFDMAFMFKYSEREGTMARKKLPDNVSEETKSARLT 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFE-----EEVELGSGVYTGYTRNYIKVNAKADCNV 411
           KL++L            IG V  +L E      E +L      G    +     ++   +
Sbjct: 367 KLVDLQTSISHEQNRARIGRVYSILIENTSRKSEKQLCGRTPCGRMTVFPLPEGRSASEM 426

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            G  ++V+I S      +G I+
Sbjct: 427 IGSTVSVRIESATSATLKGGIL 448


>MIAB_LEPBJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  192 bits (488), Expect = 5e-51
 Identities = 125/442 (28%), Positives = 214/442 (48%), Gaps = 15/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  ++       Y      E +D+  +NTC++      K     Q
Sbjct: 12  KVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKIYNRLQ 71

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NPE +I V+GC AQ    ++   E  +D+V+G  N   +   + + R  G+ 
Sbjct: 72  SLGYLKKRNPELVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRS-GEH 130

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +  + K + +++++    N   +AF+ I  GCN FC +C++PYTRG   S+DPK ++
Sbjct: 131 SISLTRLSKIETYDEIEPRVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSRDPKSIV 189

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            EI+ L E G +++ L G +  SY    ++      L++ +     IER+R  S  P  F
Sbjct: 190 REIQDLTEKGIRQVTLLGQNVNSYK---EQGTDFAGLIQMLLDETTIERIRFTSPHPKDF 246

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
              ++R +    + CP+ HL LQ+G    L+ M R Y+ +E+ D+V  +R+ + DV ITT
Sbjct: 247 PVRLLRLMAQNPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVREIRNIVPDVGITT 306

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRA-ENMENQVDGNKKDERSK 356
           D+IVGFP             ++ +      +FKYS R+GT A + + + V    K  R  
Sbjct: 307 DIIVGFPNETEEEFEDTLAVVREVQFDMAFMFKYSEREGTMARKKLPDNVSEETKSARLT 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFE-----EEVELGSGVYTGYTRNYIKVNAKADCNV 411
           KL++L            IG V  +L E      E +L      G    +     ++   +
Sbjct: 367 KLVDLQTSISHEQNRARIGRVYSILIENTSRKSEKQLCGRTPCGRMTVFPLPEGRSASEM 426

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            G  ++V+I S      +G I+
Sbjct: 427 IGSTVSVRIESATSATLKGGIL 448


>MIAB_XANCP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 485

 Score =  192 bits (487), Expect = 6e-51
 Identities = 136/445 (30%), Positives = 207/445 (46%), Gaps = 14/445 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EG E+ D  E ADV +VNTCS+     +K    +
Sbjct: 38  KLYIKTHGCQMNEYDSAKMADVLAASEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQL 97

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +      II V GC A Q     V     VD+V G +    +   +   R+ GK
Sbjct: 98  GRWKALKAGGKPVIIGVGGCVASQEGEAIVKRAPYVDLVFGPQTLHRLPELIRARRESGK 157

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K   D   E   +   AF+ I +GC+++C++C++PYTRG   S+  + V
Sbjct: 158 SQVDISFPEIEKF--DRLPEPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPFEDV 215

Query: 177 LDEIRSLAEHGFKEIILSG----IHTASYGVDLDEKVTLVDL---LEEIEKIDGIERVRI 229
           L E+  LA  G +EI L G     +  +YG D  E     DL   +  I +IDGI R+R 
Sbjct: 216 LVEVAQLAAQGVREINLLGQNVNAYRGAYGADAGEPAQYADLGLLIRTIAQIDGIGRIRF 275

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P  F++ +V     + +L  + HL +Q+G D  L  M R YTA E++  +  LR  
Sbjct: 276 TTSHPLEFSDSLVDAYRDVPQLANYLHLPVQAGSDRILSAMKRGYTALEFKSKIRKLRAV 335

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             D+SI++D IVGFPG            ++ +   ++  F YS R GT A ++E+     
Sbjct: 336 RPDISISSDFIVGFPGETDADFDKTMKLIEDVGFDQSFSFIYSRRPGTPASDLEDDTPDA 395

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            K  R  +L      +    +++ +G V  VL E      +   TG T N   VN   + 
Sbjct: 396 VKQARLARLQAHINAHAAGISQRMVGSVQRVLVEGPSRRDANELTGKTENMRPVNFPGNP 455

Query: 410 NVSGKILNVKINSFEGEVAEGEIVL 434
            + G+ ++V I         G I L
Sbjct: 456 RLVGQFVDVLITEALSNSLRGRIQL 480


>MIAB_XANCB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 485

 Score =  192 bits (487), Expect = 6e-51
 Identities = 136/445 (30%), Positives = 207/445 (46%), Gaps = 14/445 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EG E+ D  E ADV +VNTCS+     +K    +
Sbjct: 38  KLYIKTHGCQMNEYDSAKMADVLAASEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQL 97

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +      II V GC A Q     V     VD+V G +    +   +   R+ GK
Sbjct: 98  GRWKALKAGGKPVIIGVGGCVASQEGEAIVKRAPYVDLVFGPQTLHRLPELIRARRESGK 157

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K   D   E   +   AF+ I +GC+++C++C++PYTRG   S+  + V
Sbjct: 158 SQVDISFPEIEKF--DRLPEPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPFEDV 215

Query: 177 LDEIRSLAEHGFKEIILSG----IHTASYGVDLDEKVTLVDL---LEEIEKIDGIERVRI 229
           L E+  LA  G +EI L G     +  +YG D  E     DL   +  I +IDGI R+R 
Sbjct: 216 LVEVAQLAAQGVREINLLGQNVNAYRGAYGADAGEPAQYADLGLLIRTIAQIDGIGRIRF 275

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P  F++ +V     + +L  + HL +Q+G D  L  M R YTA E++  +  LR  
Sbjct: 276 TTSHPLEFSDSLVDAYRDVPQLANYLHLPVQAGSDRILSAMKRGYTALEFKSKIRKLRAV 335

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             D+SI++D IVGFPG            ++ +   ++  F YS R GT A ++E+     
Sbjct: 336 RPDISISSDFIVGFPGETDADFDKTMKLIEDVGFDQSFSFIYSRRPGTPASDLEDDTPDA 395

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            K  R  +L      +    +++ +G V  VL E      +   TG T N   VN   + 
Sbjct: 396 VKQARLARLQAHINAHAAGISQRMVGSVQRVLVEGPSRRDANELTGKTENMRPVNFPGNP 455

Query: 410 NVSGKILNVKINSFEGEVAEGEIVL 434
            + G+ ++V I         G I L
Sbjct: 456 RLVGQFVDVLITEALSNSLRGRIQL 480


>MIAB_XANC8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 485

 Score =  192 bits (487), Expect = 6e-51
 Identities = 136/445 (30%), Positives = 207/445 (46%), Gaps = 14/445 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EG E+ D  E ADV +VNTCS+     +K    +
Sbjct: 38  KLYIKTHGCQMNEYDSAKMADVLAASEGLELTDNPEDADVVLVNTCSIREKAQEKVFSQL 97

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +      II V GC A Q     V     VD+V G +    +   +   R+ GK
Sbjct: 98  GRWKALKAGGKPVIIGVGGCVASQEGEAIVKRAPYVDLVFGPQTLHRLPELIRARRESGK 157

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K   D   E   +   AF+ I +GC+++C++C++PYTRG   S+  + V
Sbjct: 158 SQVDISFPEIEKF--DRLPEPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPFEDV 215

Query: 177 LDEIRSLAEHGFKEIILSG----IHTASYGVDLDEKVTLVDL---LEEIEKIDGIERVRI 229
           L E+  LA  G +EI L G     +  +YG D  E     DL   +  I +IDGI R+R 
Sbjct: 216 LVEVAQLAAQGVREINLLGQNVNAYRGAYGADAGEPAQYADLGLLIRTIAQIDGIGRIRF 275

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P  F++ +V     + +L  + HL +Q+G D  L  M R YTA E++  +  LR  
Sbjct: 276 TTSHPLEFSDSLVDAYRDVPQLANYLHLPVQAGSDRILSAMKRGYTALEFKSKIRKLRAV 335

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             D+SI++D IVGFPG            ++ +   ++  F YS R GT A ++E+     
Sbjct: 336 RPDISISSDFIVGFPGETDADFDKTMKLIEDVGFDQSFSFIYSRRPGTPASDLEDDTPDA 395

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            K  R  +L      +    +++ +G V  VL E      +   TG T N   VN   + 
Sbjct: 396 VKQARLARLQAHINAHAAGISQRMVGSVQRVLVEGPSRRDANELTGKTENMRPVNFPGNP 455

Query: 410 NVSGKILNVKINSFEGEVAEGEIVL 434
            + G+ ++V I         G I L
Sbjct: 456 RLVGQFVDVLITEALSNSLRGRIQL 480


>MIAB_SHELP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (487), Expect = 6e-51
 Identities = 136/444 (30%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDEYQGYTLTEEAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP  II V GC A      +    + VD++ G +    +   + + +  GK
Sbjct: 64  GRWKTLKDKNPNLIIGVGGCVASQEGKAIKDRAQCVDLIFGPQTLHRLPEMIEQIQQGGK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K   D   E       AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AVIDVSFPEIEKF--DRLPEPRAEGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D+ + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDDDICTFAELLRYVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDLILTQMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++ +    +  F YS R GT A ++ + V  ++K ER
Sbjct: 302 ISSDFIVGFPGESKQDFADTMKLIEDVQFDHSFSFIYSARPGTPASDLPDDVSLDEKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T N   VN +AD    
Sbjct: 362 --LAILQDRITQQAMRYSRQMLGTVQRILVEGPSVKNPMELRGRTENNRVVNFEADPKHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++V+I     NS  G+   GE
Sbjct: 420 GSFVDVEIVDVFTNSLRGKFIRGE 443


>MIAB_RALPJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 456

 Score =  192 bits (487), Expect = 6e-51
 Identities = 145/448 (32%), Positives = 209/448 (46%), Gaps = 22/448 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M++     EG    D  E ADV + NTCSV     +K    +
Sbjct: 3   KVFIKTYGCQMNEYDSDKMSDVLNAAEGLVPTDTPEDADVILFNTCSVREKAQEKVFSEL 62

Query: 61  GRARRQN---PEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ ++ V GC A Q   + V+    VDVV G +    +   +   R  G+
Sbjct: 63  GRVKALKALKPDLVVGVGGCVASQEGASIVARAPYVDVVFGPQTLHRLPDLIAARRRTGR 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV V      K F+ L     +  + A++ I +GC+++C+YC++PYTRG   S+    V
Sbjct: 123 SQVDVSFPEIEK-FDHLPPARVDGAS-AYVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY---GVDLDEKVTLVDLLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y     D  E+     LLE + +I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYIGKMGDTSERADFALLLEYVAEIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  F+  ++       KL  H HL +Q G D  L  M R YT  EY+  +  LR    ++
Sbjct: 241 PKEFSSRLIEAYATNPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSSIRKLRAIRPNI 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           SI TD IVGFPG            +  I    +  F YSPR GT A N+ +      K E
Sbjct: 301 SIATDFIVGFPGETDADFAKTMDLIHEIGYDTSFSFIYSPRPGTPAANLHDDTPQAVKLE 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN-AKADC--- 409
           R K L      N    ++  +G V  +L E           G T N   VN A  D    
Sbjct: 361 RLKHLQATIEENVARISQGMVGSVQRILVEGPSRKDPTELHGRTENNRVVNFALPDLPQV 420

Query: 410 ---NVSGKILNVKI-----NSFEGEVAE 429
               + G++L+V+I     +S  GEVAE
Sbjct: 421 RREQLIGQMLDVRIVHAFPHSLRGEVAE 448


>MIAB_MANSM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  192 bits (487), Expect = 6e-51
 Identities = 137/444 (30%), Positives = 222/444 (50%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      G E+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLQSTHGLELTEEAEQADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +++NP  +I V GC A      +      VD++ G +    +   +N+ R  G+
Sbjct: 64  GRWKELKKKNPNLVIGVGGCVASQEGEHIRERAPYVDIIFGPQTLHRLPEMINQIR-AGE 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           + V   +  + + F+ L   +    T AF+ I +GCN++C YC++PYTRG   S+    V
Sbjct: 123 KAVLDISFPEIEKFDRLPEPKAEGPT-AFVSIMEGCNKYCTYCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  + +P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGGICSFAELLRLVAAIDGIDRLRFTTSNP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +Q+G D  L  M R +TA EY+ I+  LR    ++ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQAGSDRILTMMKRGHTAIEYKSIIRKLRAVRPNIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++++    +  F YS R GT A +M + V   +++++
Sbjct: 302 ISSDFIVGFPGETNEEFEQTMNLIQQVNFDMSFSFVYSARPGTPAADMPDDV--TEEEKK 359

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
            +  I   RIN +A  F+   +G    VL E   +      TG T N   VN     ++ 
Sbjct: 360 QRLYILQQRINNQAAQFSRAMLGTEQRVLVEGPSKKDIMELTGRTENNRIVNFAGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK +++KI     NS  G+V   E
Sbjct: 420 GKFVDIKITDVFTNSLRGDVVRTE 443


>MIAB_LEPCP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 469

 Score =  192 bits (487), Expect = 6e-51
 Identities = 136/442 (30%), Positives = 207/442 (46%), Gaps = 11/442 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M++     EGY   D  E AD+ + NTCSV     +K    +
Sbjct: 28  KVYIRTFGCQMNEYDSDKMSDVMAAAEGYTPTDDPEQADLILFNTCSVREKAQEKVFSDL 87

Query: 61  GRARRQNPEAI-IAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +      + I V GC A Q     +     VDVV G +    +   + +   +G+ Q
Sbjct: 88  GRVKHLKARGVLIGVGGCVASQEGAAIIERAPYVDVVFGPQTLHRLPQMLAQRARQGRPQ 147

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L   + +    AF+ I +GC+++C+YC++PYTRG   S+   +VL 
Sbjct: 148 VDISFPEIEK-FDHLPPAKVDGAA-AFVSIMEGCSKYCSYCVVPYTRGEEFSRPFDEVLT 205

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y   + +   + D   LLE + +I GIER+R  +  P 
Sbjct: 206 EVAGLADQGVKEVTLLGQNVNAYRGRMGDTSDIADFATLLEYVHEIPGIERIRYTTSHPN 265

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT  ++     L KL  H HL +Q G D  L  M R YT  EY+  +  LR    D+S+
Sbjct: 266 EFTPALIEAYARLPKLVNHLHLPVQHGSDRILSGMKRGYTVLEYKSTIRKLRAIRPDISL 325

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD IVGFPG            +  I    +  F +SPR GT A  + +      K  R 
Sbjct: 326 STDFIVGFPGETDDDHARTMKLIDDIGFDASFSFIFSPRPGTPAAALHDDTSYEVKLARL 385

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS--- 412
           ++L      N +  +E+ +G V  VL E           G T     VN     N +   
Sbjct: 386 QQLQATIEDNVRRISERRVGTVQRVLVEGPSRRDPNELMGRTECNRIVNFDGGPNAARLV 445

Query: 413 GKILNVKINSFEGEVAEGEIVL 434
           G++++++I         GE VL
Sbjct: 446 GRMIDIRITLAYPHSLRGEPVL 467


>MIAB_ACIBL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 444

 Score =  192 bits (487), Expect = 6e-51
 Identities = 135/385 (35%), Positives = 205/385 (53%), Gaps = 11/385 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N ++SE +    + +GY  V+    A + + NTCS+ +  ++K    +   R+ 
Sbjct: 14  TFGCQMNFHDSEKVVGTLISQGYRQVETELDAGLILYNTCSIRDKAEQKVFHRLSEFRQL 73

Query: 67  NPEAI-IAVVGCYAQIAPTEV-SGIEGVDVVLGS---RNKGEIVYYVNKARDEGKQQVKV 121
             E    AV+GC AQ    ++      V +V GS   RN  E++  +    + G Q++  
Sbjct: 74  QKEGKRFAVLGCVAQQEGEKIFERAPHVSLVAGSASYRNLAEMLVQI----ESGSQRITG 129

Query: 122 GAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
               +     + +     N  R ++ I +GC++FCAYC++PYTRG   S+  + VL E R
Sbjct: 130 LDDRETDQTFETEFTARGNAHRGYITIIEGCDKFCAYCVVPYTRGKERSRSAESVLREAR 189

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
            +A+ GF ++ L G +  SY  D    +T  +LL  + +I GI+RVR  +  P  FT D+
Sbjct: 190 QMADAGFTDVQLLGQNVNSYH-DPSGTMTFAELLTAVGEITGIKRVRFTTSHPRDFTRDI 248

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR-DKIEDVSITTDVI 300
           V  I     LC H HL +QSG    L+ M R YT ++Y + ++ ++  K   +SITTDVI
Sbjct: 249 VEAIDNHPTLCDHVHLPVQSGSSKVLREMFREYTREQYLERISWMKATKNRKLSITTDVI 308

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            L  +       FKYSPR  T A    + V   +K  R + L+E
Sbjct: 309 VGFPGXXXXXXXXXLALLDHVQYDGVFSFKYSPRPNTPALKYIDTVPEQEKSRRLQILME 368

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEE 385
             R  ++A   K+IGE I+V+ E E
Sbjct: 369 HQREIQRANYRKHIGETIEVMVEAE 393


>MIAB_NITWN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 477

 Score =  191 bits (486), Expect = 8e-51
 Identities = 130/435 (29%), Positives = 210/435 (48%), Gaps = 13/435 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EGY      E AD+ ++NTC +     +K    +G
Sbjct: 10  KLHIKSYGCQMNVYDAQRMADTLAVEGYVETTSAEDADLVILNTCHIREKASEKVYSELG 69

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    +A        I V GC AQ    E+      VDVV+G ++   +   + +A+ 
Sbjct: 70  RLRAAKDQAARDGRGMNIVVAGCVAQAEGEEIIRRAPMVDVVVGPQSYHHLPQLLARAKT 129

Query: 114 EGKQQVKVGAVLKNKVF--EDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
            G+       V     F  +  +    +    AF+ +Q+GC++FC +C++PYTRG+  S+
Sbjct: 130 CGRALETEFPVADKFGFLPQPSRQAIRSRGISAFVTVQEGCDKFCTFCVVPYTRGAEASR 189

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRI 229
              KV++++R LA++G +EI L G +  +Y G   D +      LL  +  I GI R+R 
Sbjct: 190 PVAKVVEDVRRLADNGVREITLIGQNVNAYHGEGPDGRPWPFGKLLYRLAGIPGIVRLRY 249

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P    + ++     L  L P  HL +QSG D  L  MNRR+TA +Y  +++  R  
Sbjct: 250 STSHPRDVEDTLIDAHRDLDALMPFVHLPVQSGSDRILAAMNRRHTADDYRRVIDRFRQA 309

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             D++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M+  V   
Sbjct: 310 RPDIAFSSDFIVGFPGETEEDFAATLALVGQIGYAAAYSFKYSPRPGTPAADMQETVSTA 369

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
             D+R  +L  L    + AF    +G  IDVLF +      G   G T      + +A  
Sbjct: 370 DMDQRLVQLQNLIDSQQSAFNRTALGRTIDVLF-DRAGRKPGQIVGRTAYLQPAHVEASD 428

Query: 410 NVSGKILNVKINSFE 424
            + G++L V + S E
Sbjct: 429 AIIGQVLPVTVASLE 443


>MIAB_AZOC5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  191 bits (486), Expect = 8e-51
 Identities = 131/442 (29%), Positives = 222/442 (50%), Gaps = 15/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+S+ M +   +EGY        AD+ ++NTC +     +K    +G
Sbjct: 6   KLYVKSFGCQMNVYDSQRMADALAKEGYVETQDPADADLVILNTCHIREKAAEKVYSELG 65

Query: 62  RARRQNPEA----IIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           R R+   +A     IAV GC AQ    E+      VD+V+G ++   +   + + RD GK
Sbjct: 66  RLRKAKQDAGSDTTIAVAGCVAQAEGAEIMKRAPVVDLVVGPQSYHRLPEMLARVRD-GK 124

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTR---AFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
           + V      ++K            K R   AF+ +Q+GC++FC +C++PYTRG+  S+  
Sbjct: 125 RVVDTEFPAEDKFDHLPAPSAAATKKRGPTAFVTVQEGCDKFCTFCVVPYTRGAEVSRSV 184

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHT-ASYGVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
            K++ E R+L + G +EI L G +  A +G   D +   L  LLEE+  I+G+ R+R  +
Sbjct: 185 SKIVGEARALVDQGVREITLIGQNVNAFHGEGPDGRTWGLGRLLEELAGINGLARLRYTT 244

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P    + ++     L +L P+ HL +QSG D  L  MNR++  + Y +I++ LR    
Sbjct: 245 SHPRDMDDGLIAAHRDLPQLMPYLHLPVQSGSDRILAAMNRKHGREIYFEIIDKLRAARP 304

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+++++D IVGFPG             +R+  +  + FKYS R GT A   ++Q+    K
Sbjct: 305 DIALSSDFIVGFPGETEADFEDTLDLARRVGFASAYSFKYSIRPGTPAAEHDHQLSEEVK 364

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKADC 409
            ER  +L ++   ++ AF    +G   D+L E+   L   +   + Y ++ +     A  
Sbjct: 365 SERLARLHQVLEASKTAFDRACMGRRFDILLEKPGRLPGQLIGRSPYLQSVVVTAPGAGI 424

Query: 410 N--VSGKILNVKINSFEGEVAE 429
              V+  I +V  NS  G+V +
Sbjct: 425 GDFVTVDITDVGPNSLAGQVVD 446


>RIMO_CLOD6 RecName: Full=Ribosomal protein S12
           methylthiotransferase rimO;         Short=S12
           methylthiotransferase;         Short=S12 MTTase;
          Length = 444

 Score =  191 bits (485), Expect = 1e-50
 Identities = 131/432 (30%), Positives = 217/432 (50%), Gaps = 16/432 (3%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           +K+A  +LGC  N  ++E M      +GY+++   E ADV +VNTC       ++S   I
Sbjct: 2   LKIALESLGCSKNLVDAEIMMGILNNKGYKLIGDFEEADVIIVNTCGFIESAKQESIDTI 61

Query: 61  ---GRARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
                 ++     ++ V GC AQ    E+ + I  +D ++G+ +   I   + K   E  
Sbjct: 62  INFAELKKTGNLKLLIVTGCLAQRYSEELKTEIPEIDAIVGTGSYQNIDKIL-KELSEIH 120

Query: 117 QQVKVGAVLKNKVF-EDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           Q V +  +    VF EDL          A+LKI +GC+  C YC+IP  RG   S+  + 
Sbjct: 121 QIVSLNDI--EFVFNEDLPRYISTPSYMAYLKIGEGCSNNCTYCIIPKLRGKYRSRKFED 178

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           ++ E + LAE G KE+++    T  YG DL  K  L +LLEE+ KIDG + +R+    P 
Sbjct: 179 IIKEAKKLAESGVKELVVIAQDTTKYGFDLYGKERLSELLEELAKIDGFKWIRVMYSYPE 238

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
             TE++++ I     +C +F + +Q   +  LK MNR+ T ++  + +NL+R  I D  +
Sbjct: 239 SITEELIQVIKKYDNICSYFDMPIQHASNNILKLMNRKTTKEDILNKINLIRSNIPDAIL 298

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
            T +IVGFPG            ++ +   +   F YS  + T A+ + N +D   K +R 
Sbjct: 299 RTTIIVGFPGETEDDFKQLVDFVEEVKFDRLGAFAYSREEDTPADRLPNHIDEEVKIQRR 358

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIK-----VNAKADCN 410
             L+ + +   +   +K IG+  +VL EE++E    VYTG T+   +     V  K+  N
Sbjct: 359 DTLMMIQQKISEELNDKKIGKTYEVLIEEQIE--DNVYTGRTQGDAEEIDSIVYVKSVDN 416

Query: 411 VS-GKILNVKIN 421
           +  G+ ++V+IN
Sbjct: 417 LEVGEFVSVQIN 428


>MIAB_ZYMMO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  191 bits (485), Expect = 1e-50
 Identities = 117/345 (33%), Positives = 188/345 (54%), Gaps = 8/345 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           + GC++N+Y+ E M+E    +G +  +    AD+ V+NTC +     +K    IGR RR 
Sbjct: 13  SFGCQMNSYDGERMSELLESQGMKAAEEAATADLVVLNTCHIREKAAEKVYSEIGRLRRP 72

Query: 67  NPEA-IIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAV 124
           +  + +IA+ GC AQ    EV +  + VD+V+G +    +   + KA   GK  V +   
Sbjct: 73  DGSSPMIALAGCVAQAEGAEVLARTKMVDIVVGPQAYHHLPELIEKAAS-GKV-VDIDMP 130

Query: 125 LKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLA 184
           L++K   D   E       AFL +Q+GC++FC YC++PYTRG+  S+   +++ E  +L 
Sbjct: 131 LESKF--DALPERRQVGASAFLTVQEGCDKFCTYCVVPYTRGAEVSRPWSRIVKEAHALV 188

Query: 185 EHGFKEIILSGIHTASY-GVDLDEKVTLVD-LLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           + G +EI L G +  ++ G D   +   +D L+  + KIDG+ER+R  +  P   TE ++
Sbjct: 189 DKGAREITLLGQNVNAWTGEDEAGRSQGLDGLIRALAKIDGLERIRYTTSHPNDMTEGLI 248

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                + KL P  HL +QSG +  LK MNR +TA+ Y  ++N L++   D++++ D IVG
Sbjct: 249 EAHGEIDKLMPFLHLPVQSGSNRILKAMNRAHTAESYLTLMNRLKEVRPDIALSGDFIVG 308

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
           FPG            +  +  S    F YSPR GT A +M+NQ+D
Sbjct: 309 FPGESEEDFQATLDLISEVGYSLAFSFAYSPRPGTPAADMDNQID 353


>MIAB_CORU7 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 540

 Score =  191 bits (485), Expect = 1e-50
 Identities = 117/388 (30%), Positives = 197/388 (50%), Gaps = 12/388 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE ++      GY+     E  DV V NTC+V    D +   +  ++   
Sbjct: 47  TFGCQMNVHDSERLSGLLEDSGYQPAANGEEPDVLVFNTCAVRENADNRLYGTLAMVKPM 106

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + +NP   IAV GC AQ      V     VDVV G+ N G +   + ++    + +V++ 
Sbjct: 107 KDRNPGMQIAVGGCMAQKDKDAVVDRAPWVDVVFGTHNIGSLPTLLERSAHNQRAEVEIL 166

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F  +   +  +    ++ +  GCN  C +C++P  RG    + P ++L E+++
Sbjct: 167 DSLEE--FPSVLPAKRESAYSGWVSVSVGCNNTCTFCIVPSLRGKEQDRRPGEILAEVQA 224

Query: 183 LAEHGFKEIILSGIHTASYGVDL-DEKV-----TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G +E+ L G +  +YGV+  DE +         LL    +I+G+ER+R  S  P  
Sbjct: 225 LVDQGVQEVTLLGQNVNAYGVNFADEDLPRDRGAFAKLLRACGEIEGLERLRFTSPHPAE 284

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  LK M R Y +K++  I++ +R++I   +IT
Sbjct: 285 FTDDVIDAMAETPNVCPQLHMPLQSGSDRILKEMRRSYRSKKFLGILDKVRERIPHAAIT 344

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   S    F+YSPR GT A  M +Q+      ER +
Sbjct: 345 TDIIVGFPGETEEDFQATLDVVEKARFSCAFTFQYSPRPGTPAATMPDQIPKAVVQERYE 404

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEE 384
           +LI L    +    ++ +G   ++L +E
Sbjct: 405 RLIALQERIQAEDNKELVGTTQELLVQE 432


>MIAB_XANP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 470

 Score =  191 bits (484), Expect = 1e-50
 Identities = 119/394 (30%), Positives = 201/394 (51%), Gaps = 13/394 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+S  M +   REG+        AD+ ++NTC +     +K    +G
Sbjct: 6   KLYVKSFGCQMNVYDSHRMADTLAREGFVETQDPAEADLVILNTCHIREKAAEKVYSELG 65

Query: 62  RARRQNPEA----IIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           R R+Q  EA    +IAV GC AQ    E+      VD+V+G ++   +   + +A+  GK
Sbjct: 66  RLRKQKQEAGSDTMIAVAGCVAQAEGAEIMRRAPVVDLVVGPQSYHRLPELLAEAK-AGK 124

Query: 117 QQVKVGAVLKNKVFEDL----KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKD 172
           + V      ++K F+ L    +    +    AF+ +Q+GC++FC +C++PYTRG+  S+ 
Sbjct: 125 RVVDTEFPAEDK-FDHLPAPTRAATRSRGPAAFVTVQEGCDKFCTFCVVPYTRGAEVSRP 183

Query: 173 PKKVLDEIRSLAEHGFKEIILSGIHT-ASYGVDLDEKV-TLVDLLEEIEKIDGIERVRIG 230
             K++DE   L + G +EI L G +  A +G   D    +L  L+E + ++DG+ R+R  
Sbjct: 184 VAKIMDEAARLVDQGVREISLIGQNVNAFHGAGPDGTTWSLARLMEHMARLDGLARLRYT 243

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P    +D++     L +L P+ HL +QSG D  L  MNR++   ++  I+  +R   
Sbjct: 244 TSHPRDMDDDLIAAHRDLPQLMPYLHLPVQSGSDRILAAMNRKHGRDDFFAIIEKMRQAR 303

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+++++D IVGFPG            ++R+  +  + FKYSPR GT A + + QV    
Sbjct: 304 PDMALSSDFIVGFPGESEKDFEDTLDLVRRVGFASAYSFKYSPRPGTPAADHDAQVPEEV 363

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEE 384
           K             ++ AF E   G   D+L E+
Sbjct: 364 KXXXXXXXXXXXXXSKAAFDESCRGRTFDILLEK 397


>MIAB_RHOPB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 473

 Score =  191 bits (484), Expect = 1e-50
 Identities = 132/445 (29%), Positives = 213/445 (47%), Gaps = 17/445 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSFGCQMNVYDAQRMVDALAPEGFVETANADEADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E+   +  VDVV+G ++   +         
Sbjct: 66  RLRVAKDEAALQGRRMNIAVAGCVAQAEGAEIIRRQPAVDVVVGPQSYHHLPQXXXXXXX 125

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYN----NKTRAFLKIQDGCNRFCAYCLIPYTRGSVC 169
                     V  +  F  L   + +        AF+ +Q+GC++FC +C++PYTRG+  
Sbjct: 126 XXXXXXTEFPV--DDKFGFLPPPQPDAIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEV 183

Query: 170 SKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERV 227
           S+   K+++++R LA++G +EI L G +  +Y  D  +     L  LL  + KI GI R+
Sbjct: 184 SRPVDKIVEDVRRLADNGVREITLIGQNVNAYHGDGPDGRPWPLGALLHHLAKIPGIVRL 243

Query: 228 RIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLR 287
           R  +  P    + ++     L  L P  HL +QSG DA L  MNR+++A +Y  +V+  R
Sbjct: 244 RYSTSHPRDVDQSLIDAHRDLPALMPFVHLPVQSGSDAILAAMNRKHSADDYRRLVDRFR 303

Query: 288 DKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVD 347
                ++ ++D IVGFPG            + +I  +  + FKYSPR GT A  ++  V 
Sbjct: 304 SANPAIAFSSDFIVGFPGETDEDFAATLALVTQIGYAGAYSFKYSPRPGTPAAELQETVS 363

Query: 348 GNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA 407
               DER  +L EL    + AF    IG  ++VLFE       G   G T      +  A
Sbjct: 364 AAVMDERLVRLQELIDSQQAAFNAAVIGTTVEVLFERAAR-NPGQIVGRTAYLQPAHVMA 422

Query: 408 DCNVSGKILNVKINSFEGEVAEGEI 432
             ++ G++L V+I+S E     GE+
Sbjct: 423 APDIIGQVLPVRIDSLERYSLIGEL 447


>MIAB_PARDP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 445

 Score =  191 bits (484), Expect = 1e-50
 Identities = 134/439 (30%), Positives = 213/439 (48%), Gaps = 20/439 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S+ M E    EGY + +    AD+ ++NTC +     +K    +G
Sbjct: 14  KLFIKTYGCQMNVYDSQRMAEAMGAEGYVLTENQSDADMVLLNTCHIREKAAEKLYSDLG 73

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R +    + P+  I V GC AQ    E+   +  VD+V+G +      Y+   A     +
Sbjct: 74  RLKPLKAERPDLKIGVAGCVAQAEGEEIQRRMPIVDLVVGPQ-----AYHRLPAMARAGR 128

Query: 118 QVKVGAVLKNKVFEDL-KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            V      ++K FE L K          FL +Q+GC++FCA+C++PYTRG+  S+   ++
Sbjct: 129 GVDTEFPAEDK-FEHLPKXXXXXXXXXXFLTVQEGCDKFCAFCVVPYTRGAEVSRPVSRI 187

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E R L   G +EI L G +   +  +  E  +     L+  I +IDG++R+R  +  P
Sbjct: 188 LAEARDLVARGVREITLLGQNVNGWHGEGPEGSEWGFGRLIRAIAEIDGLDRIRYTTSHP 247

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
               +D++       KL P+ HL +QSG D  LK MNRR+T  +Y  ++  +R+   D+ 
Sbjct: 248 NDMADDLIAAHRDEPKLMPYLHLPVQSGSDRILKAMNRRHTVDQYLRLIERIREARPDIM 307

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +T+D IVGFPG            ++ +       FKYSPR GT A     +++G   D R
Sbjct: 308 LTSDFIVGFPGETDQDHQGTLELVRAVNFGTAFSFKYSPRPGTPAYE-RPEIEGAVADAR 366

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            ++L  L    +KA  E  +G  + VLFE+      G   G +     V  +A     G 
Sbjct: 367 LQELQALLTSQQKAAQEGMVGRELGVLFEKPGR-NPGQMVGKSDYLHAVFVEAPAAKVGD 425

Query: 415 ILNVKI-----NSFEGEVA 428
           ++ V+I     NS  G +A
Sbjct: 426 LVRVRITHSAPNSLAGVLA 444


>MIAB_MYCUA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 532

 Score =  191 bits (484), Expect = 1e-50
 Identities = 121/385 (31%), Positives = 183/385 (47%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE M       GY        ADV V NTC+V    D K   +   +   
Sbjct: 30  TYGCQMNVHDSERMAGLLEAAGYRRAAEGTDADVVVFNTCAVRENADNKLYGNLSHLAPR 89

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R +P+  IAV GC AQ      +     VDVV G+ N G +   +++AR     QV++ 
Sbjct: 90  KRTSPDMQIAVGGCLAQKDRDALLRKAPWVDVVFGTHNIGSLPALLDRARHNRVAQVEIA 149

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E++S
Sbjct: 150 EALQQ--FPSSLPSARESAYAAWVSISVGCNNTCTFCIVPSLRGKEIDRSPADILAEVQS 207

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  EI L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 208 LVDTGVVEITLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 267

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  +   +IT
Sbjct: 268 FTDDVIEAMAQTPNVCPALHMPLQSGSDRVLRAMRRSYRAERYLGIIERVRAAMPHAAIT 327

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   S    F+YS R GT A  ++ Q+      ER +
Sbjct: 328 TDLIVGFPGETEQDFAATLDVVRQARFSAAFTFQYSKRPGTPAAELDGQLPKAVVQERYE 387

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +L+EL            +G+ +++L
Sbjct: 388 RLVELQEQISLEGNRAIVGQRVELL 412


>MIAB_MYCS2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  191 bits (484), Expect = 1e-50
 Identities = 122/385 (31%), Positives = 188/385 (48%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE ++      GY+       AD+ V NTC+V    D K   +   +   
Sbjct: 29  TYGCQMNVHDSERLSGLLESAGYQRAAEGTDADIVVFNTCAVRENADNKLYGNLSHLAPR 88

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++ +P   IAV GC AQ     V      VDVV G+ N G +   + +AR   + QV++ 
Sbjct: 89  KQADPNMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNREAQVEIV 148

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E++S
Sbjct: 149 EALQE--FPSALPASRESAYAAWVSISVGCNNTCTFCIVPSLRGKEVDRRPGDILAEVQS 206

Query: 183 LAEHGFKEIILSGIHTASYGVDLDE------KVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  EI L G +  +YGV   +      +     LL     IDG+ERVR  S  P  
Sbjct: 207 LVDQGVLEITLLGQNVNAYGVSFADPELPRDRGAFAKLLRACGGIDGLERVRFTSPHPAE 266

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  + A   +CP  H+ LQSG D  LK M R Y A+ +  I++ +R  I   +IT
Sbjct: 267 FTDDVIEAMAATPNVCPTLHMPLQSGSDRILKAMRRSYRAERFLGIIDKVRAAIPHAAIT 326

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   +    F+YS R GT A +M +Q+  +   ER +
Sbjct: 327 TDLIVGFPGETEEDFQATLDVVEQARFAGAFTFQYSKRPGTPAADMPDQLPKSVVTERYQ 386

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +LIEL          + +G  +++L
Sbjct: 387 RLIELQERISLEQNREQVGRAVELL 411


>MIAB_GEOLS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 438

 Score =  191 bits (484), Expect = 1e-50
 Identities = 124/435 (28%), Positives = 213/435 (48%), Gaps = 11/435 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T+GC++N  +SE +       GY        A + + NTC+V    ++   Q I 
Sbjct: 5   KLYIDTVGCQMNVNDSERIVTMLQPLGYTQTSRRHEAALILFNTCTVRAGAEECLLQNIA 64

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
             +   R+ P  +I V GC AQ    E+      VD+V G+ N   +V  + K  + G++
Sbjct: 65  NLKNLKRKKPGTLIGVAGCVAQQMGAELLQKFPWVDLVFGTHNL-HLVPEMVKDAEAGRR 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           + +   +  ++  +     E   +  AF+ +  GC+ FC+YC++PY RG   S+   ++L
Sbjct: 124 RAETDFLDSSERLDLFPPIEGRKRVSAFVTVMQGCDNFCSYCIVPYVRGREISRRFAEIL 183

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ LA  G +E++L G +  SYG+  +E+ +  +L+  +  + GI+RVR  +  P   
Sbjct: 184 QEVQDLAAQGLREVVLLGQNVNSYGLKGEEQPSFAELVRAVAAVSGIDRVRFVTSHPKDM 243

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           ++D++     L KLC   HL  Q+G +  LK MNR Y+ + Y + +  LR    ++ IT 
Sbjct: 244 SDDLIACFADLAKLCGSLHLPAQAGNNRILKAMNRGYSREHYLETIYKLRQARPEIKITG 303

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            ++ +       F YSPR GT+A  + +++    K  R  +
Sbjct: 304 DMIVGFPGETEAEFEETLSLMEEVRYFDLFSFVYSPRPGTKAAELSDELAKEVKLARLDR 363

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L +L  ++ +   E Y+G    VL  E +    G  +G   +   VN      + GK+++
Sbjct: 364 LQKLQAVHSRIHNETYVGSTQQVLV-EGLAKRHGQVSGRCDSGRIVNLAGSPALIGKLVD 422

Query: 418 VKI-----NSFEGEV 427
           VKI     NS  GE+
Sbjct: 423 VKILEGYANSLLGEL 437


>MIAB_GEOBB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  191 bits (484), Expect = 1e-50
 Identities = 129/438 (29%), Positives = 211/438 (48%), Gaps = 10/438 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N  +SE +       GY+       AD+ ++NTCS+    +++    +G
Sbjct: 6   KLYLETFGCQMNVSDSEKIVTLMKGMGYQQTQDPVDADLVLLNTCSIRATAEQRVYGHLG 65

Query: 62  R---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           +    ++  P  II V GC AQ    ++      V++V G+ N   ++  +  A +EGK+
Sbjct: 66  KFKSIKKTKPGLIIGVGGCVAQQEGEKLLKKAPFVNLVFGTHNL-HLLQGMVAAAEEGKR 124

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
             +   +   K F+     E       F+ +  GC+ FCAYC++P+ RG   S+   KV+
Sbjct: 125 SSQTDFLDDEKRFDLFPHSEAEGGVTRFVTVMQGCDNFCAYCIVPHVRGREISRSAAKVV 184

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
           +E+R+LA+ G  E+ L G +  SY      +    DLL  + ++DGIER+R  +  P   
Sbjct: 185 EEVRALADSGVTEVTLLGQNVNSYCSKQPGEPDFPDLLRLVAQVDGIERIRFTTSHPKDM 244

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           +  ++     L KL PH HL  QSG D  L+RMNR YTA++Y   V  L++    +  T 
Sbjct: 245 SPRLIECFADLPKLAPHIHLPAQSGSDRVLERMNRGYTAQQYLAKVAALKEACPAIQFTG 304

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D+IVGFPG            ++++  +    F YS R GT+A    +     +K  R ++
Sbjct: 305 DMIVGFPGEDEAAFQDTMALMEQVQYADLFSFIYSARPGTKAAEYADDATRAEKQGRLER 364

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTRNYIKVNAKADCNVSGKI 415
           L    +    A      G V  VL E     G  ++  TG  R  +      D +++G++
Sbjct: 365 LQAAQKKTTLARNRSLEGTVQKVLVEGLSSTGDSLFGRTGGNRGTVMA---GDPSLAGRV 421

Query: 416 LNVKINSFEGEVAEGEIV 433
           L+VKI      + +GEIV
Sbjct: 422 LDVKIVEGLQTLLKGEIV 439


>MIAB_ACAM1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  191 bits (484), Expect = 1e-50
 Identities = 128/443 (28%), Positives = 217/443 (48%), Gaps = 41/443 (9%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR-ARR 65
           T GC++N  +SE M       GY+  +  + A++ + NTC++ +  + K    +GR A+R
Sbjct: 12  TYGCQMNKADSERMAGVLENMGYQWSENPDDANLILCNTCTIRDNAEHKVYSYLGRQAKR 71

Query: 66  QN--PEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P+  + V GC AQ      +  +  +D+V+G +       + N+ +D  +Q     
Sbjct: 72  KHAQPDLTLVVAGCVAQQEGDALLRRVPELDLVMGPQ-------HANRLQDLLEQVASGQ 124

Query: 123 AVLKNK---VFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
            VL  +   + ED+     ++   A++ +  GCN  C YC++P  RG   S+ P+ +  E
Sbjct: 125 QVLATEPIHIVEDITKPRRDSAVTAWVNVIYGCNERCTYCVVPNVRGVEQSRTPEAIRAE 184

Query: 180 IRSLAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSI 232
           +  L E GFKE+ L G +  +YG DL         + TL DLL  +  + GIER+R  + 
Sbjct: 185 MVQLGEQGFKEVTLLGQNIDAYGRDLPGTTSEGRHQHTLTDLLYFVHDVPGIERIRFATS 244

Query: 233 DPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIED 292
            P +FTE +++    L K+C HFH+  QSG +  LK M+R YT ++Y  I++ +R  + D
Sbjct: 245 HPRYFTERLIQACYELPKVCEHFHIPFQSGDNDVLKAMSRGYTHEKYRRIIDNIRAIMPD 304

Query: 293 VSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKD 352
            SI+ D IVGFPG            ++ I     +   YSPR GT A   +NQ+    K 
Sbjct: 305 ASISADAIVGFPGETEEQFMNTMQLVEDIEFDLLNTAAYSPRPGTPAALWDNQLSEEVKA 364

Query: 353 ERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
           +R ++L  L  +  +  +++Y   + +VL E++                  N K    V 
Sbjct: 365 DRLQRLNRLVGVCAELRSQRYANRIEEVLVEDQ------------------NPKDPTQVM 406

Query: 413 GKILNVKINSFEGEVAE--GEIV 433
           G+    ++  F G + +  GEI+
Sbjct: 407 GRTRGNRLTFFPGNIEQLRGEII 429


>MIAB2_MYCMM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB 2;       
           EC=2.-.-.-;AltName: Full=tRNA-i(6)A37
           methylthiotransferase 2;
          Length = 532

 Score =  191 bits (484), Expect = 1e-50
 Identities = 121/385 (31%), Positives = 183/385 (47%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE M       GY        ADV V NTC+V    D K   +   +   
Sbjct: 30  TYGCQMNVHDSERMAGLLEAAGYRRAAEGTDADVVVFNTCAVRENADNKLYGNLSHLAPR 89

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R +P+  IAV GC AQ      +     VDVV G+ N G +   +++AR     QV++ 
Sbjct: 90  KRTSPDMQIAVGGCLAQKDRDALLRKAPWVDVVFGTHNIGSLPALLDRARHNRVAQVEIA 149

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E++S
Sbjct: 150 EALQQ--FPSSLPSARESAYAAWVSISVGCNNTCTFCIVPSLRGKEIDRSPADILAEVQS 207

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  EI L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 208 LVDTGVVEITLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 267

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  +   +IT
Sbjct: 268 FTDDVIEAMAQTPNVCPALHMPLQSGSDRVLRAMRRSYRAERYLGIIERVRAAMPHAAIT 327

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   S    F+YS R GT A  ++ Q+      ER +
Sbjct: 328 TDLIVGFPGETEQDFAATLDVVRQARFSAAFTFQYSKRPGTPAAELDGQLPKAVVQERYE 387

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +L+EL            +G+ +++L
Sbjct: 388 RLVELQEQISLEGNRAIVGQRVELL 412


>MIAB_YERE8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  190 bits (483), Expect = 2e-50
 Identities = 130/428 (30%), Positives = 208/428 (48%), Gaps = 13/428 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ +  E AD+ ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLASTHGYQLTEIPEEADLLLLNTCSIREKAQEKVFSLL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+    + +NPE II V GC A      +      VDV+ G +    +   +N  +    
Sbjct: 64  GQWKLLKEKNPELIIGVGGCVASQEGEHLRQRAPCVDVIFGPQTLHRLPEMINHVQGTHS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRQARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  +    ++ F YSPR GT A ++ + V   +K +R
Sbjct: 302 ISSDFIIGFPGETQQDFEQTMKLVADVRFDTSYSFIYSPRPGTPAADLPDDVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI ++A   + + +G V  +L E           G T N   VN +    + 
Sbjct: 362 LHILQQ--RITQQAMEISREMVGTVQRILVEGTSRKNVMELAGRTENNRVVNFEGTPEMI 419

Query: 413 GKILNVKI 420
           GK ++V+I
Sbjct: 420 GKFVDVEI 427


>MIAB_SHESH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  190 bits (483), Expect = 2e-50
 Identities = 135/444 (30%), Positives = 221/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EGY + +    ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLMDEYEGYTLTEEASEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR ++   +NP+ II V GC A Q         + VD++ G +    +   +++ RD GK
Sbjct: 64  GRWKKLKEKNPDLIIGVGGCVASQEGKVIKERAQCVDLIFGPQTLHRLPEMIDQIRDGGK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L  E   +   AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 AVIDISFPEIEK-FDKLP-EPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LA+ G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLADQGVREVNLLGQNVNAYRGATHDDEICTFAELLRYVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTQMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ +    +  F YS R GT A ++ + V   +K ER
Sbjct: 302 ISSDFIIGFPGESKQDFADTMKLIEDVQFDHSFSFIYSARPGTPAADLPDDVTLAEKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T     VN +AD    
Sbjct: 362 --LAILQDRITQQAMRYSRQMLGTVQRILVEGPSVKNPMELRGRTETSRVVNFEADPKHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++V+I     NS  G    GE
Sbjct: 420 GSFVDVEIVDVYTNSLRGTFVRGE 443


>MIAB_SHEAM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  190 bits (483), Expect = 2e-50
 Identities = 131/442 (29%), Positives = 215/442 (48%), Gaps = 14/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGEYQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +    + VD++ G +    +   +++ R   K
Sbjct: 64  GRWKTLKDKNPDLIIGVGGCVASQEGKAIKDRAQCVDIIFGPQTLHRLPEMIDQVRSGEK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 AVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPMDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D ++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGAKHDGEICTFAELLRHVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTAMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++ +    +  F YS R GT A ++ + VD  +K +R
Sbjct: 302 ISSDFIVGFPGETAQDFQDTMKLIEDVNFDMSFSFIYSARPGTPAADLPDDVDMEEKKQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFE-----EEVELGSGVYTGYTRNYIKVNAKADC 409
              L EL       ++ + +G V  +L E       +EL     T    N+  ++     
Sbjct: 362 LADLQELINQQAMRYSRQMMGTVQRILVEGPSVKNPMELRGRTETNRVVNFEGLHKHIGT 421

Query: 410 NVSGKILNVKINSFEGEVAEGE 431
            V  +I++V  NS  G+   GE
Sbjct: 422 FVDVEIVDVFPNSLRGKFIRGE 443


>MIAB_RHOS5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 436

 Score =  190 bits (483), Expect = 2e-50
 Identities = 133/434 (30%), Positives = 214/434 (49%), Gaps = 16/434 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    +GY + +  E AD+ ++NTC +     +K    +G
Sbjct: 6   KLFIKTYGCQMNVYDSERMAEALGAKGYVLTEVAEEADMVLLNTCHIREKAAEKVYSDLG 65

Query: 62  RARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R R      P+  I V GC AQ    E+   +  VD+V+G ++   +   +   R EG  
Sbjct: 66  RLRPLKVARPDLKIGVAGCVAQAEGEEILRRMPLVDLVVGPQSYHRLPDMLE--RTEGGA 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +V      +   FE L   +      AFL +Q+GC++FCA+C++PYTRG+  S+   +++
Sbjct: 124 RVIDTDFPEEDKFEHLPERKALRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSRPFARLM 183

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E R+L E G +EI L G +  ++  D      L  L+ E+ +IDG+ER+R  +  P   
Sbjct: 184 AEARALVEKGVREITLLGQNVNAWSND---GRGLGGLIRELARIDGLERLRYTTSHPNDM 240

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            +D++       KL P+ HL +QSG D  LK MNR++ A++Y  +V  +R    D+ +T+
Sbjct: 241 ADDLIEAHGQEPKLMPYLHLPVQSGSDRILKAMNRKHAAEQYLRLVERIRAARPDILLTS 300

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D IVGFPG            ++ +       FKYS R GT A   + ++     D R + 
Sbjct: 301 DFIVGFPGETDADFEATLALIRAVGFGSAFSFKYSARPGTPAAE-KPELPAELCDARLQT 359

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L  L    ++A     +G  + VL+E+   L  G   G +     V+ +      G ++ 
Sbjct: 360 LQALLGEQQRAAQAAMVGRELGVLYEKAGRL-PGQMVGKSDYLHAVHVEDPGARPGDLVR 418

Query: 418 VKI-----NSFEGE 426
           V+I     NS  GE
Sbjct: 419 VRITASGPNSLAGE 432


>MIAB_PROMP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 464

 Score =  190 bits (483), Expect = 2e-50
 Identities = 125/442 (28%), Positives = 212/442 (47%), Gaps = 20/442 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M     + GY        AD+ + NTC++ +   +K    +G+    
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYSRAIDELKADLVLYNTCTIRDSAQQKVYSFLGKQVKR 84

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +   P+  + V GC AQ    + +  +  +D+++G ++   +   + +  D G Q V   
Sbjct: 85  KHSTPKLKLVVAGCLAQQEGESLLRRVPELDLIMGPQHVNNLENLLERV-DLGNQVV--- 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +  + ED+     ++    ++ I  GCN  C+YC++P  RG   S+ P  +  EI S
Sbjct: 141 ATEETFISEDITNPRRDSSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPDAIKSEIES 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA + FKE+ L G +  +YG DL        ++ +L DLL  I  ++GI+R+R  +  P 
Sbjct: 201 LAHNNFKEVTLLGQNIDAYGRDLPGTTKEGRKENSLTDLLYFIHDVEGIKRIRFSTSHPK 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F++ ++     L K+C HFH+  QSG +  L+ M R YT ++Y+ I+  +R  + + SI
Sbjct: 261 YFSKRLINACYELDKVCEHFHIPFQSGNNEILRLMARGYTIEKYKRIIENIRQLMPNASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  I   +     YSPR  T A   +NQ+    K ER 
Sbjct: 321 TADAIVAFPGETETQYRETLKLISDIGFDQVMTAAYSPRPNTPAAFWDNQIPEEVKKERL 380

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKADCNV 411
           K++ EL     +   ++Y+  +  VL E      +    G TR     +++++   + N 
Sbjct: 381 KEINELVETTSRKRNQRYLNNIESVLIEGLNPKNNAQMMGRTRTNRLTFVEISKNIEFNY 440

Query: 412 S-GKILNVKINSFEGEVAEGEI 432
           S G  +NVKI         G+I
Sbjct: 441 SYGDEINVKITEARSFSLSGQI 462


>MIAB_PHOLL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 476

 Score =  190 bits (483), Expect = 2e-50
 Identities = 133/444 (29%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E AD+ ++NTCS+     +K    +
Sbjct: 6   KLYIKTWGCQMNEYDSSKMADLLESTHGYQLTDVAEEADILLLNTCSIREKAQEKVFHQL 65

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +     NP+ II V GC A      +    + VD++ G +    +   +N+ +    
Sbjct: 66  GRWKNLKDTNPDLIIGVGGCVASQEGDFIRQRAQCVDIIFGPQTLHRLPEMINQVKGTRS 125

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K   D   E       AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 126 PVVDISFPEIEKF--DRLPEPRAEGPSAFVSIMEGCNKYCTFCVVPYTRGEEVSRPCDDV 183

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D  + +  +L+  +  IDGI+R+R  +  P
Sbjct: 184 LFEIAQLAAQGVREVNLLGQNVNAYRGATYDGDICSFAELIRLVAAIDGIDRIRFTTSHP 243

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 244 IEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTLMKRAHTALEYKSIIRKLRKARPDIL 303

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  +    ++ F YS R GT A ++ + V   +K +R
Sbjct: 304 ISSDFIIGFPGETQDDFEKTMKLIADVNFDMSYSFIYSARPGTPAADLPDDVSEEEKKQR 363

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN++A  ++   +G V  +L E          +G T N   VN +   ++ 
Sbjct: 364 LYLLQQ--RINQQAMSYSRAMLGSVQRILVEGTSRKNVMELSGRTENNRVVNFEGQPDMI 421

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 422 GKFVDVEIVDVYANSLRGKVIRTE 445


>MIAB_NITEC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 443

 Score =  190 bits (483), Expect = 2e-50
 Identities = 131/438 (29%), Positives = 205/438 (46%), Gaps = 9/438 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +  + E   E+ +  E AD+ + NTCSV     +K    +
Sbjct: 4   KLYIKTFGCQMNEYDSAKMADILLSEKNMELTEVPEEADLILFNTCSVREKAQEKVFHDL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R      P+ +I V GC A    +E V     VD+V G +    +   ++  R  G+
Sbjct: 64  GRVRHLKNSKPDLLIGVGGCVASQEGSEIVRRAPFVDLVFGPQTLHRLPELIDARRRTGQ 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 SQVDITFPEIEK-FDRLPPARTTGAT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY--GVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  L   G KE+ L G +  +Y      +  +    LL+ I +I G+ R+R  +  P
Sbjct: 182 LTEVAGLVIQGVKEVTLLGQNVNAYYDKTSGEGDIDFATLLDYIHEIPGLVRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT  ++     L KL  H HL +QSG D  L  M R YT  EY+ I+  LR    ++S
Sbjct: 242 REFTARLIETYQRLPKLVGHVHLPIQSGSDRILAAMKRGYTIIEYKSIIRKLRTIRPNIS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +  +   ++  F YSPR GT A ++ +      K  R
Sbjct: 302 ISSDFIVGFPGETDTDFEETMKLIDDVKFDESFSFIYSPRPGTPASDLPDDTPYRIKLAR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L E  + N +  ++  +  +  VL E   +     + G T N   VN      + G 
Sbjct: 362 LHQLQEKIQRNAQMISQSMVDTIQRVLVEGPSKKDPNEFCGRTDNNRVVNFAGHAGLVGS 421

Query: 415 ILNVKINSFEGEVAEGEI 432
            +++KI +       GEI
Sbjct: 422 FVDIKITAVSSHTLRGEI 439


>MIAB_COLP3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  190 bits (483), Expect = 2e-50
 Identities = 129/439 (29%), Positives = 208/439 (47%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M E      G+ +V+  E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTWGCQMNEYDSQKMAELLDSTHGFSLVEEAEQADVILLNTCSIREKAQEKVFHQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +    + P+ +I V GC A      +      VD++ G +    +   +N+ +    
Sbjct: 64  GRWKNLKDKKPDLLIGVGGCVASQEGDSIRKRAPFVDMIFGPQTLHRLPEMLNQLQHSKS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K   D   E   +   AF+ I +GC+++C +C++PYTRG   S+    V
Sbjct: 124 PIIDVSFPEIEKF--DRLPEPKADGASAFVSIMEGCSKYCTFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  +    DL+  +  IDGI+R+R  +  P
Sbjct: 182 LYEIAQLAEQGVREVNLLGQNVNAYRGETHDGSICRFADLVRLVATIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++     + +L  H HL +QSGCD  L +M R +TA EY+  +  L+    ++S
Sbjct: 242 VEFTDDIIEAYTDVPELVNHLHLPVQSGCDRILTQMKRGHTALEYKSQIRKLKKVRPELS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            +K +    +  F YS R GT A ++ + +    K +R
Sbjct: 302 MSSDFIIGFPGETDEDFTATMDLIKAVDFDLSFSFIYSARPGTPAADLPDDISDQTKKDR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            K L E         A + +     VL E           G T N   VN  A  +V G+
Sbjct: 362 LKLLQEQITHQALRIARQMLNTEQRVLVEGPSRKNPMELRGKTENNRTVNFVAPHSVIGQ 421

Query: 415 ILNVKINSFEGEVAEGEIV 433
            +++KI         GE+V
Sbjct: 422 FVDIKITDVVANSLRGELV 440


>MIAB_PSYWF RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 490

 Score =  190 bits (482), Expect = 2e-50
 Identities = 138/456 (30%), Positives = 215/456 (47%), Gaps = 31/456 (6%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFN-EMADVYVVNTCSVTNMGDKKSRQII 60
           KV  AT GC++N Y+SE M          VV  N E ADV ++NTCS+     +K    +
Sbjct: 38  KVYIATQGCQMNVYDSEKMGNVLGDSHDMVVTDNIEEADVLLMNTCSIREKAQEKVFSEL 97

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R+   + P+ +I V GC   +A  E   I+     VD+V G +    +    +K+  
Sbjct: 98  GRWRKLKEEKPDLVIGVGGC---VASQEGDNIQKRAPYVDMVFGPQTLHRLPELYDKSTT 154

Query: 114 E---------GKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYT 164
           +         G   V   ++ K     + K+E Y    RAF+ I +GC+++C++C++PYT
Sbjct: 155 QRNVKPKDRIGTVDVSFPSIEKFDFLPEPKVEGY----RAFVSIMEGCSKYCSFCVVPYT 210

Query: 165 RGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEK--VTLVDLLEEIEKID 222
           RG   S+    VL EI SLAE G +EI L G +   Y  + D+       +LL  +  +D
Sbjct: 211 RGEELSRPLDDVLAEIDSLAEQGVREITLLGQNVNGYRGEKDDGSICRFAELLHYVAHVD 270

Query: 223 GIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDI 282
           GIER+R  +  P  FT+D++     L +L  H HL +QSG +  L  M R +T   Y + 
Sbjct: 271 GIERIRYTTSHPLEFTDDIIEAYAKLPQLVSHLHLPVQSGSNKILAAMKRNHTIDVYINQ 330

Query: 283 VNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENM 342
           +N L     D+ +++D I+GFPG             K +    ++ F YS R GT A  +
Sbjct: 331 INKLMAVRPDMHLSSDFIIGFPGETEEDFLDTLNLAKALDFDHSYSFIYSKRPGTPASEL 390

Query: 343 ENQVDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRN--- 399
            + V    K ER     ++ R +     E+ +G+ + V+ EE  +       G   N   
Sbjct: 391 PDDVSLATKKERLAIFQKVIRDSTLKKTEEMVGKTLRVMVEEIADRYPDQLLGTADNTRS 450

Query: 400 -YIKVNAKADCNVSGKILNVKINSF-EGEVAEGEIV 433
              K   +   ++ GK + VKI  F    +  GE+V
Sbjct: 451 VLFKATEQQKTDLMGKFVTVKITDFVSPHMVRGELV 486


>MIAB_PARD8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  190 bits (482), Expect = 2e-50
 Identities = 129/439 (29%), Positives = 219/439 (49%), Gaps = 10/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           K+   T GC++N  +SE +      +GY + +  E AD   VNTCSV +  ++K     Q
Sbjct: 20  KLFIETYGCQMNVADSEVVASIMKMDGYSMTENIEEADAIFVNTCSVRDNAEQKIYGRLQ 79

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
                +R+    I+ V+GC A+    ++  +   D+V+G  +  ++   V  A + G++ 
Sbjct: 80  YFQSLKRKKKSLIVGVLGCMAERVKEDLIHVHHADLVVGPDSYLDLPNLVG-AVEHGEKA 138

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           + V    +    + + ++        F+ I  GCN FC YC++PYTRG   S+D + +L+
Sbjct: 139 INVELSTQETYKDVIPLKLPGVHISGFVSIMRGCNNFCTYCIVPYTRGRERSRDIESILN 198

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
           EIR + E GFKE+ L G +  SY  + + E +T   LL+ + K     R+R  +  P   
Sbjct: 199 EIRDMHEKGFKEVTLLGQNVNSYSFEKEGETITFPILLDRVAKEVPDMRIRFTTSHPKDM 258

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           ++D +R I A   +C   HL  QSG    LK MNR+YT + Y D +  +R  + D +I+T
Sbjct: 259 SDDTLRVIAANDNICKFIHLPAQSGSSRILKVMNRKYTREWYLDRIAAIRRIVPDCAIST 318

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGT-RAENMENQVDGNKKDERSK 356
           D+  GF              ++ +      +FKYS R GT  A ++E+ V   +K  R +
Sbjct: 319 DLFCGFHSETEEDYQETLSLMREVGYDSAFLFKYSERPGTYAASHLEDNVPEEEKVRRLQ 378

Query: 357 KLIEL-NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYT-RNYIKVNAKADCNVSGK 414
            +I+L N+++E++   + IG+  +VL E   +       G T +N + +  K + +V G+
Sbjct: 379 GMIDLQNKLSEESNL-RDIGKTFEVLIEGFSKRSREQLFGRTSQNKVVIFDKKNYHV-GQ 436

Query: 415 ILNVKINSFEGEVAEGEIV 433
            + VKI+        GE V
Sbjct: 437 FIKVKIHKASSATLFGEPV 455


>MIAB_SYNY3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  189 bits (481), Expect = 3e-50
 Identities = 125/438 (28%), Positives = 203/438 (46%), Gaps = 41/438 (9%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE M       G    D    AD+ + NTCS+ +  ++K    +GR  ++
Sbjct: 12  TFGCQMNKADSERMAGILENLGMTYTDDPNQADLVLYNTCSIRDNAEQKVYSYLGRQAKR 71

Query: 67  N---PEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
               PE  + V GC AQ    ++   +  +D+V+G ++   +        D+  +QV  G
Sbjct: 72  KQVEPELTLVVAGCVAQQEGEQLLRRVPELDLVMGPQHANRL--------DQLLEQVWAG 123

Query: 123 ----AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
               A     + ED+      +   A++ I  GCN  C+YC++P  RG   S+ P+ +  
Sbjct: 124 SQVVATESLHIMEDITKPRRESTVSAWVNIIYGCNERCSYCVVPNVRGVEQSRTPEAIYG 183

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKV-------TLVDLLEEIEKIDGIERVRIGS 231
           E+  LA+ GFKE+ L G +  +YG DL           TL DLL  +  I+GI+R+R  +
Sbjct: 184 EMEVLAQQGFKEVTLLGQNIDAYGRDLPGTTPSGRHLHTLTDLLYHVHDIEGIDRLRFAT 243

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I+  +R  + 
Sbjct: 244 SHPRYFTERLIQACQELPKVCEHFHIPFQSGDNDILKAMKRGYTREKYLQIIEKIRRYMP 303

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D +I+ DVIVGFPG            ++ +     +   YSPR GT A   +NQ+    K
Sbjct: 304 DAAISADVIVGFPGETEAQFENTLNLIEEVGFDLLNTAAYSPRPGTPAAFWDNQLSEEVK 363

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            +R ++L  L        +++Y                              N K+   V
Sbjct: 364 GDRLQRLNHLVSTQAMERSQRY------------------XXXXXXXXXXXXNLKSPGQV 405

Query: 412 SGKILNVKINSFEGEVAE 429
            G+    ++  F+GE++E
Sbjct: 406 MGRTRGNRLTFFQGEISE 423


>MIAB_LEPIN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  189 bits (481), Expect = 3e-50
 Identities = 125/442 (28%), Positives = 213/442 (48%), Gaps = 15/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  ++       Y      E +D+  +NTC++      K     Q
Sbjct: 12  KVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKIYNRLQ 71

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NP  +I V+GC AQ    ++   E  +D+V+G  N   +   + + R +G+ 
Sbjct: 72  SLGYLKKRNPNLVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIR-KGEN 130

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +  + K + +++++    N   +AF+ I  GCN FC +C++PYTRG   S+DPK ++
Sbjct: 131 SISLTRLSKIETYDEIEPRVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSRDPKSIV 189

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ L + G ++I L G +  SY    ++      L++ +     IER+R  S  P  F
Sbjct: 190 REVQDLVQKGIRQITLLGQNVNSYK---EQDTDFAGLIQMLLDETSIERIRFTSPHPKDF 246

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
              +++ +    + CP+ HL LQ+G    L+ M R Y+ +E+ D+V  +R+ + DV ITT
Sbjct: 247 PTHLLQLMSENPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVKEIRNIVPDVGITT 306

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAE-NMENQVDGNKKDERSK 356
           D+IVGFP             ++ +      +FKYS R+GT A+  + + V    K  R  
Sbjct: 307 DIIVGFPNETEEEFEDTLAVVREVQFDMAFMFKYSEREGTMAQRKLPDNVPEEVKSARLT 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYT--RNYIKVNAKADCNVSGK 414
           KL++L            IG V  +L E           G T            + NVSG 
Sbjct: 367 KLVDLQTSISHEQNRARIGRVYSILIENISRKSEKQLCGRTPCGRMTVFPLPQETNVSGM 426

Query: 415 I---LNVKINSFEGEVAEGEIV 433
           I   ++V+I S      +G I+
Sbjct: 427 IGSTVSVQIESATSATLKGRIL 448


>MIAB_LEPIC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  189 bits (481), Expect = 3e-50
 Identities = 125/442 (28%), Positives = 213/442 (48%), Gaps = 15/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQ 58
           KV   T GC++N Y+S  ++       Y      E +D+  +NTC++      K     Q
Sbjct: 12  KVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKIYNRLQ 71

Query: 59  IIGRARRQNPEAIIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
            +G  +++NP  +I V+GC AQ    ++   E  +D+V+G  N   +   + + R +G+ 
Sbjct: 72  SLGYLKKRNPNLVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIR-KGEN 130

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
            + +  + K + +++++    N   +AF+ I  GCN FC +C++PYTRG   S+DPK ++
Sbjct: 131 SISLTRLSKIETYDEIEPRVVNG-IQAFVTIMRGCNNFCTFCVVPYTRGRERSRDPKSIV 189

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
            E++ L + G ++I L G +  SY    ++      L++ +     IER+R  S  P  F
Sbjct: 190 REVQDLVQKGIRQITLLGQNVNSYK---EQDTDFAGLIQMLLDETSIERIRFTSPHPKDF 246

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
              +++ +    + CP+ HL LQ+G    L+ M R Y+ +E+ D+V  +R+ + DV ITT
Sbjct: 247 PTHLLQLMSENPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVKEIRNIVPDVGITT 306

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAE-NMENQVDGNKKDERSK 356
           D+IVGFP             ++ +      +FKYS R+GT A+  + + V    K  R  
Sbjct: 307 DIIVGFPNETEEEFEDTLAVVREVQFDMAFMFKYSEREGTMAQRKLPDNVPEEVKSARLT 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYT--RNYIKVNAKADCNVSGK 414
           KL++L            IG V  +L E           G T            + NVSG 
Sbjct: 367 KLVDLQTSISHEQNRARIGRVYSILIENISRKSEKQLCGRTPCGRMTVFPLPQETNVSGM 426

Query: 415 I---LNVKINSFEGEVAEGEIV 433
           I   ++V+I S      +G I+
Sbjct: 427 IGSTVSVQIESATSATLKGRIL 448


>MIAB_GRAFK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 481

 Score =  189 bits (481), Expect = 3e-50
 Identities = 126/452 (27%), Positives = 229/452 (50%), Gaps = 25/452 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC +N  +SE +     +EG+      E AD+ +VNTCS+    ++  R+ + 
Sbjct: 25  KLFIESYGCAMNFSDSEIVASILSKEGFNTTQNLEEADLVLVNTCSIREKAEQTVRKRLE 84

Query: 62  R---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           +    +R NP   + V+GC A+    +    E  VD+V+G     ++   +N+  +EG+ 
Sbjct: 85  KYNAVKRINPGMKVGVLGCMAERLKDKFLEEEKIVDLVVGPDAYKDLPNLINEV-EEGRD 143

Query: 118 QVKVGAVLKNKVFEDLK-IEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            + V  + K + + D+  +   +N   AF+ I  GC+  C +C++P+TRG   S+DP+ +
Sbjct: 144 AINV-ILSKEETYGDISPVRLQSNGVSAFVSITRGCDNMCTFCVVPFTRGRERSRDPQSI 202

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-----GVDLD-------EKVTLVD---LLEEIEKI 221
           ++E+  LA  G+KEI L G +  SY     G+  D       +K T  +   LL+ + + 
Sbjct: 203 VEEVNDLAAKGYKEITLLGQNVDSYLWYGGGLKKDFKNATEIQKATATNFAALLKLVAEA 262

Query: 222 DGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYED 281
               R+R  + +P   T DV+  + A + +C + HL +QSG D  LK+MNR +T +EY  
Sbjct: 263 QPKMRIRFSTSNPQDMTLDVIEAMAAYRNICNYIHLPVQSGSDRILKKMNRLHTREEYFT 322

Query: 282 IVNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAE- 340
           +++ ++  I +  I+ D+I GFP             ++ +     ++F YS R GT AE 
Sbjct: 323 LIDNIKKMIPNCGISHDLITGFPTETEEDHQDTLSLMEYVKYDFGYMFTYSERPGTTAER 382

Query: 341 NMENQVDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYT-RN 399
            +E+ +    K  R +++++L + + K      IG  ++VL E+E +  +  ++G   RN
Sbjct: 383 KLEDDIPEETKKRRLQEIVDLQQKHSKQNTNSVIGTTVEVLIEKESKKSNKHWSGRNERN 442

Query: 400 YIKVNAKADCNVSGKILNVKINSFEGEVAEGE 431
            + V +K +  + G  + VKI+        GE
Sbjct: 443 TVTVFSKENYQI-GDFVKVKIHDCTSATLIGE 473


>MIAB_RHOBA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 479

 Score =  189 bits (480), Expect = 4e-50
 Identities = 126/401 (31%), Positives = 201/401 (50%), Gaps = 23/401 (5%)

Query: 3   VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           V   T+GC++N  +SE +     R GY VVD    AD+ + NTCS+    ++K+   +G+
Sbjct: 8   VYIKTVGCQMNVLDSEMVIADLKRHGYTVVDTPGEADLLLYNTCSIREQAEEKTYSALGK 67

Query: 63  ARR---QNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKA------- 111
            +    ++PE  I V+GC AQ    T       VD+V+G      I   + K        
Sbjct: 68  LKETKARHPEKTIGVMGCMAQKDQETIFRRAPFVDMVVGPGQLHAIPDMLTKVTSGEGRQ 127

Query: 112 ------RDEGKQQVKVGAVLKNKVFEDLKIEEYN-NKTRAFLKIQDGCNRFCAYCLIPYT 164
                 R +GKQ V       ++ F+ L+         +A+L+IQ GC++FC YC++P T
Sbjct: 128 MAVSLGRKDGKQTV---VARSHETFDPLRDPTMRPTPFQAYLRIQIGCDKFCTYCVVPNT 184

Query: 165 RGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGV-DLDEKVTLVDLLEEIEKIDG 223
           RG    + P++++ E R LAE G  EI L G    SY     D +  +  LLE +  IDG
Sbjct: 185 RGPEQGRSPEEIVSEARVLAEQGALEITLLGQTVNSYRHRGPDGETDMAGLLERLHDIDG 244

Query: 224 IERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIV 283
           ++R++  +  P   T  ++  I  L K+ P+ H+  QSG DA LKRM R YT  +Y ++ 
Sbjct: 245 LKRIKFVTNYPKDMTARLLETIRDLPKVSPYLHVPAQSGSDAVLKRMKRGYTIADYMEMF 304

Query: 284 NLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTR-AENM 342
             +   + + S+++D IVGF G            ++R     + IF+YS R+GT+ A N+
Sbjct: 305 ERIETVLPEASVSSDFIVGFCGETDEDFQKSVKLIERCRFKNSFIFQYSVREGTKAAANL 364

Query: 343 ENQVDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFE 383
            + V    K  R+ +L+ +     K   +K IG+ ++VL E
Sbjct: 365 IDDVPREVKAARNNELLAVQDRISKEDNQKLIGDTVEVLVE 405


>MIAB_LAWIP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  189 bits (480), Expect = 4e-50
 Identities = 115/393 (29%), Positives = 195/393 (49%), Gaps = 16/393 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++NT +S  ++    ++G++ V   + A + ++NTCSV    ++K   I+G+ R  
Sbjct: 10  TFGCQMNTNDSFWLSCSLQKKGFQEVSLED-ASIIIINTCSVREKPEQKVYSILGKIRHA 68

Query: 65  -RQNPEAIIAVVGCYAQ-IAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKV- 121
            + NP++ + + GC AQ +  T       V +V GS         + +   E   ++ + 
Sbjct: 69  TKNNPDSFVVIAGCVAQQLGATFFEKFPQVRLVSGSDGIAMAPDAIERLYAEPDLKLNLT 128

Query: 122 --GAVLKNKVFEDLKIEEYNNKT---RAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
                   + +   K+   NN T    A++ I  GC+ +C YC++PYTRG   S+  + +
Sbjct: 129 DFSEYYPEREYAFSKLTLSNNNTLALMAYVNIMQGCDNYCTYCIVPYTRGKQKSRSVQAI 188

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEK-----VTLVDLLEEIEKIDGIERVRIGS 231
           ++E + L + G KEI+L G +  +YG+D D+      V    L+  I  + G+ER+R  S
Sbjct: 189 VEECQQLIDSGVKEIVLLGQNVNAYGLDKDKNSPANGVNFAMLVHTIASLPGLERLRFFS 248

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F+ +++        LCP  HL LQSG D  L+RM R+Y+  EY  I+  L+    
Sbjct: 249 AHPKEFSSELIDLFGEFSTLCPRLHLPLQSGSDKILRRMGRKYSMDEYISIITKLKKVRP 308

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D++++TD IVGFPG            +  I    +  F YS R GTR+    N+VD   K
Sbjct: 309 DIALSTDFIVGFPGETEEDFLQTLQSINTIKFMSSFSFCYSDRPGTRSSTFSNKVDHEVK 368

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEE 384
            +R ++L      +  ++ +  +G    VL E+
Sbjct: 369 IKRLEQLQATQLEHSTSWLKSRVGVETTVLLEK 401


>MIAB_STRAW RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 508

 Score =  189 bits (479), Expect = 5e-50
 Identities = 122/384 (31%), Positives = 187/384 (48%), Gaps = 8/384 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY-EVVDFNEM-ADVYVVNTCSVTNMGDKKSRQIIGRA- 63
           T GC++N ++SE ++      GY    D ++  ADV V NTC+V    D +    +GR  
Sbjct: 19  TYGCQMNVHDSERLSGLLEDAGYVRAPDGSDGDADVVVFNTCAVRENADNRLYGNLGRLA 78

Query: 64  --RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
             + + P   IAV GC AQ    T V+    VDVV G+ N G++   + +AR + + QV+
Sbjct: 79  PMKTKRPGMQIAVGGCLAQKDRDTIVTKAPWVDVVFGTHNIGKLPVLLERARVQEEAQVE 138

Query: 121 VGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEI 180
           +   L+   F         +   A++ I  GCN  C +C++P  RG    +    +L EI
Sbjct: 139 IAESLE--AFPSTLPTRRESAYAAWVSISVGCNNTCTFCIVPALRGKEKDRRTGDILAEI 196

Query: 181 RSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
            +L   G  EI L G +  +YG D+ ++     LL    +IDG+ERVR  S  P  FT+D
Sbjct: 197 EALVGEGVSEITLLGQNVNAYGSDIGDREAFSKLLRACGQIDGLERVRFTSPHPRDFTDD 256

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           V+  +     + P  H+ +QSG D  LK M R Y    Y  I+  +R  I   +ITTD+I
Sbjct: 257 VIAAMAETPNVMPQLHMPMQSGSDTVLKAMRRSYRQDRYLGIIEKVRAAIPHAAITTDII 316

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++    ++   F+YS R GT A  MENQ+       R ++L+ 
Sbjct: 317 VGFPGETEEDFEQTMHAVREARFTQAFTFQYSKRPGTPAATMENQIPKEVVQARYERLVA 376

Query: 361 LNRINEKAFAEKYIGEVIDVLFEE 384
           L         +K +G  ++++  E
Sbjct: 377 LQEEISWDENKKQVGRTLELMVAE 400


>MIAB_RENSM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 515

 Score =  189 bits (479), Expect = 5e-50
 Identities = 125/389 (32%), Positives = 192/389 (49%), Gaps = 11/389 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE M     R G    +  ++ADV V NTC+V    D K    +G    A
Sbjct: 27  TYGCQMNVHDSERMAGLLERSGLVKAE-GKVADVVVFNTCAVRENADNKLYGNLGMLAPA 85

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +  NP   IAV GC AQ    T +     VDVV G+ N G +   + +AR   + Q+++ 
Sbjct: 86  KEANPGMQIAVGGCLAQKDRDTILKRAPWVDVVFGTHNVGALPTLLERARHNEEAQLEIL 145

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L   VF      + +     ++ I  GCN  C +C++P  RG    + P  +L EI++
Sbjct: 146 ESLD--VFPSTLPTKRDAVYSGWVSISVGCNNTCTFCIVPSLRGKEKDRRPGDILAEIQA 203

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L E G  E+ L G +  SYGV+  ++     LL    +I+G+ERVR  S  P  FTEDV+
Sbjct: 204 LVEDGAIEVTLLGQNVNSYGVEFGDRQAFSKLLRACGEIEGLERVRFTSPHPAAFTEDVI 263

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  LK M R Y + ++  I++ +R +I D +I+TD+IVG
Sbjct: 264 EAMAETHNVMPQLHMPLQSGSDKVLKDMRRSYRSSKFLGILDKVRTQIPDAAISTDIIVG 323

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            + +   +    F+YS R GT A ++ +Q+      ER ++L  L 
Sbjct: 324 FPGETEEDFQATLDVVAKSRFATAFTFQYSKRPGTPAADLPDQLPKAVVQERFERLTALQ 383

Query: 363 RINEKAFAEKYIGEVIDVLFEEEVELGSG 391
                    + IG  ++++    V  GSG
Sbjct: 384 DQISAEENARQIGREVELM----VTAGSG 408


>MIAB_CAMFF RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 434

 Score =  189 bits (479), Expect = 5e-50
 Identities = 144/440 (32%), Positives = 207/440 (47%), Gaps = 19/440 (4%)

Query: 2   KVAFATLGCRVNTYESE-AMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   TLGC +N  +SE  + E   +E YEV +  E AD+ ++NTCSV      K    +
Sbjct: 6   KLFIETLGCAMNVRDSEHIIAELSQKENYEVTNIIEDADLILINTCSVREKPVHKLFSEV 65

Query: 61  GRARRQNPE-AIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G   +   + A I V GC A    +EV      VD VLG+RN  +I   +N  +      
Sbjct: 66  GTYEKAKKKGAKIGVCGCTASHLGSEVFKRAPYVDFVLGARNISKITTALNTPKFVS--- 122

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +        F D +   Y    ++F+ I  GC++ C YC++P TRG   S     +L 
Sbjct: 123 VDINHDESEYAFGDFRSSPY----KSFVNIMIGCDKKCTYCIVPQTRGDEISIPKDIILK 178

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLD---EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E+R  A  G KEI L G +  +YG       EK+   DLL  I ++DG+ER+R  S  P 
Sbjct: 179 EVRKAASSGAKEIFLLGQNVNNYGKRFSGTHEKIDFSDLLNLISEVDGVERIRFTSPHPL 238

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  ++      K+C   H+ LQSG +  LK M R YT + + D    LR+   DV+I
Sbjct: 239 HMDDKFLKEFSTNPKICKSMHMPLQSGSNEILKAMKRGYTKEWFLDRALKLREICSDVTI 298

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IV FPG            ++ I   +   FKYS R  T A +M NQV+    D  S
Sbjct: 299 STDIIVAFPGESDRDFADTMSVVESIKFEQMFSFKYSSRPLTPAASMTNQVN---SDIAS 355

Query: 356 KKLIELNRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           ++L  L   + +   E  K     I  ++ EE+   S V  G T N   V       + G
Sbjct: 356 RRLSTLQARHTEILDEIVKAQKNSIHEVYFEELRANSSV-AGRTFNNFLVQTNGSEELLG 414

Query: 414 KILNVKINSFEGEVAEGEIV 433
           KIL VKI   +  V  G+I+
Sbjct: 415 KILKVKITDPKRMVLYGQII 434


>MIAB_PSESM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  188 bits (478), Expect = 7e-50
 Identities = 134/445 (30%), Positives = 218/445 (48%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +  EV    E ADV ++NTCS+      +    +
Sbjct: 4   KLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R     NPE +IAV GC   +A  E + I      VDVV G +    +   ++ AR 
Sbjct: 64  GRWRELKLANPEMVIAVGGC---VASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDAARI 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
               QV V      K F+ L     +  + A++ + +GC+++C +C++PYTRG   S+  
Sbjct: 121 TRLPQVDVSFPEIEK-FDHLPEPRVDGPS-AYVSVMEGCSKYCTFCVVPYTRGEEVSRPF 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
             VL E+  LAEHG +E+ L G +   Y G   D +V  L DL+  +  +DGI+R+R  +
Sbjct: 179 DDVLTEVTHLAEHGVREVTLLGQNVNGYRGTTHDGRVADLADLIRAVAVVDGIDRIRYTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ +++    + +L  H HL +QSG D  L  M R +T  EY+  +  LR  + 
Sbjct: 239 SHPLEFSDSLIQAHADVPELVKHLHLPVQSGSDRILAAMKRNHTTLEYKSRLRKLRAAVP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            +SI++D IVGFPG            ++      +  F YSPR GT A ++++      K
Sbjct: 299 GISISSDFIVGFPGETEKDFDNTMKLIEDAGFDFSFSFIYSPRPGTPAADLKDDTPEALK 358

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD- 408
            ER   L   +R+N++ F  + + +G +  +L  +  +   G   G T N   VN + D 
Sbjct: 359 KERLAAL--QHRLNQQGFEISRQMVGSIQRILVTDYSKKDPGELQGRTENNRIVNFRCDN 416

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
             + G+  +V I+  +     G ++
Sbjct: 417 PRLIGQFADVHIDDAQPHSLRGSLL 441


>MIAB_SERP5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  188 bits (477), Expect = 9e-50
 Identities = 140/445 (31%), Positives = 214/445 (48%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY+  D  E ADV ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGSTHGYQWTDNAEEADVLLLNTCSIREKAQEKVFAML 63

Query: 61  GRAR---RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR R    +NP  II V GC A      + S    VDVV G +    +   +N  +    
Sbjct: 64  GRWRLLKEKNPALIIGVGGCVASQEGEHIRSRAPCVDVVFGPQTLHRLPEMLNHVQGTRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 124 PIVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEVAQLAAQGVREVNLLGQNVNAYRGATYDGGICSFAELLRLVAAIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRAHTALEYKAIIRKLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            +  I    +  F YS R GT A +M   VD   +DE+
Sbjct: 302 LSSDFIIGFPGETQADFEQTMNLIAEINFDTSFSFIYSSRPGTPAADM---VDDVSEDEK 358

Query: 355 SKKLIEL-NRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ++L  L +RIN++   F+ + +G V  +L E           G T     VN +   ++
Sbjct: 359 KQRLYILQDRINQQVLQFSRRMLGTVQRILVEGTSRKSVMELAGRTACNRMVNFEGTPDM 418

Query: 412 SGKILNVKI-----NSFEGEVAEGE 431
            G+ ++V+I     NS  G V   E
Sbjct: 419 IGQFVDVEITEVLTNSLRGTVVRTE 443


>MIAB_SALAI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 502

 Score =  188 bits (477), Expect = 9e-50
 Identities = 129/434 (29%), Positives = 204/434 (47%), Gaps = 21/434 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY-EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARR 65
           T GC++N ++SE +     + GY               NTC+V    D +    +G+ R 
Sbjct: 18  TYGCQMNVHDSERIAGLLEQAGYLRAGXXXXXXXXXXFNTCAVRENADNRLYGNLGQLRP 77

Query: 66  ---QNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKV 121
              ++P   IAV GC AQ   +E V     VDVV G+ N G +   + +AR     +V++
Sbjct: 78  SKDRHPGMQIAVGGCLAQKDRSEIVRRAPWVDVVFGTHNIGSLPVLLERARHNAAAEVEI 137

Query: 122 GAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
              L   VF         +    ++ I  GCN  C +C++P  RG    + P  VL E+R
Sbjct: 138 LESLD--VFPSTLPTRRESTYAGWVSISVGCNNTCTFCIVPALRGKERDRRPGDVLSEVR 195

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           +L + G  E+ L G +  SYG++  ++     LL     IDG+ERVR  S  P  FT+DV
Sbjct: 196 ALVDEGVLEVTLLGQNVNSYGIEFGDRYAFGKLLRACGDIDGLERVRFTSPHPKDFTDDV 255

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +  +     +C   H+ LQSG D  L+ M R Y ++ Y  I+  +R  + D +ITTD+IV
Sbjct: 256 IAAMAETPNVCHSLHMPLQSGSDDVLRAMRRSYRSERYLGIIEKVRAAMPDAAITTDIIV 315

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++    S    F+YS R GT A  M +Q+      ER ++L+  
Sbjct: 316 GFPGETEADFERTLDVVRSARFSSAFTFQYSKRPGTPAATMADQLPKPVVQERYERLVAC 375

Query: 362 NRINEKAFAE--KYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVK 419
             + E  +AE  + +GE ++VL    V +G G      R   +    +     G++++  
Sbjct: 376 --VEEITWAENRRLVGETVEVL----VAVGEG------RKDERTGRLSGRARDGRLVHFD 423

Query: 420 INSFEGEVAEGEIV 433
             S  G++  G++V
Sbjct: 424 AGSLAGQIRPGDVV 437


>MIAB_RALEH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  188 bits (477), Expect = 9e-50
 Identities = 138/449 (30%), Positives = 211/449 (46%), Gaps = 19/449 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +G E  D  E ADV + NTCSV     +K    +
Sbjct: 3   KVFVKTYGCQMNEYDSDKMVDVLNASQGLEPTDNVEEADVILFNTCSVREKAQEKVFSEL 62

Query: 61  GRARRQN---PEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ +I V GC A Q   + VS    VDVV G +    +   + + +  G+
Sbjct: 63  GRMKALKAVKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGPQTLHRLPDLIARRQRTGQ 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 123 SQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y   + +   + D   L+E + +I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYRGKMGDTTEIADFALLIEYVAEIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT  +V       KL  H HL +Q   D  L  M R Y+  EY+ I+  LR    D+
Sbjct: 241 PKEFTSRLVELYGRCDKLVNHLHLPVQHASDRILMAMKRGYSVLEYKSIIRKLRVLRPDM 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D IVGFPG            ++ I    +  F +SPR GT A N+ +      K  
Sbjct: 301 SMSSDFIVGFPGETDADFEKLMAMIEEIGYDTSFSFIFSPRPGTPAANLHDDTPHEVKLR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN--------A 405
           R ++L      N +  ++  +G V  +L E           G T N   VN        A
Sbjct: 361 RLQRLQATIEENVQRISQNMVGTVQRILVEGPARKDPTELHGRTENNRVVNFALPGVPQA 420

Query: 406 KADCNVSGKILNVKINSFEGEVAEGEIVL 434
             D  + G++++V I         GEIV+
Sbjct: 421 GRD-RLVGQLVDVSITQAFPHSLRGEIVV 448


>MIAB_MYCTU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  188 bits (477), Expect = 9e-50
 Identities = 121/385 (31%), Positives = 177/385 (45%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +       GY        ADV V NTC+V    D +   +   +   
Sbjct: 31  TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRLYGNLSHLAPR 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 91  KRANPDMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIA 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E+RS
Sbjct: 151 EALQQ--FPSSLPSSRESAYAAWVSISVGCNNSCTFCIVPSLRGREVDRSPADILAEVRS 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L   G  E+ L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 209 LVNDGVLEVTLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 268

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +   + +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  I   +IT
Sbjct: 269 FTDDVIEAMAQTRNVCPALHMPLQSGSDRILRAMRRSYRAERYLGIIERVRAAIPHAAIT 328

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +           +YS R GT A  ++ Q+      ER +
Sbjct: 329 TDLIVGFPGETEEDFAATLDVVXXXXXXXXXXXQYSKRPGTPAAQLDGQLPKAVVQERYE 388

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +LI L            +G+ ++VL
Sbjct: 389 RLIALQEQISLEANRALVGQAVEVL 413


>MIAB_MYCTA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  188 bits (477), Expect = 9e-50
 Identities = 121/385 (31%), Positives = 177/385 (45%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +       GY        ADV V NTC+V    D +   +   +   
Sbjct: 31  TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRLYGNLSHLAPR 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 91  KRANPDMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIA 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E+RS
Sbjct: 151 EALQQ--FPSSLPSSRESAYAAWVSISVGCNNSCTFCIVPSLRGREVDRSPADILAEVRS 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L   G  E+ L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 209 LVNDGVLEVTLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 268

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +   + +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  I   +IT
Sbjct: 269 FTDDVIEAMAQTRNVCPALHMPLQSGSDRILRAMRRSYRAERYLGIIERVRAAIPHAAIT 328

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +           +YS R GT A  ++ Q+      ER +
Sbjct: 329 TDLIVGFPGETEEDFAATLDVVXXXXXXXXXXXQYSKRPGTPAAQLDGQLPKAVVQERYE 388

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +LI L            +G+ ++VL
Sbjct: 389 RLIALQEQISLEANRALVGQAVEVL 413


>MIAB_MYCBP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  188 bits (477), Expect = 9e-50
 Identities = 121/385 (31%), Positives = 177/385 (45%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +       GY        ADV V NTC+V    D +   +   +   
Sbjct: 31  TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRLYGNLSHLAPR 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 91  KRANPDMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIA 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E+RS
Sbjct: 151 EALQQ--FPSSLPSSRESAYAAWVSISVGCNNSCTFCIVPSLRGREVDRSPADILAEVRS 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L   G  E+ L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 209 LVNDGVLEVTLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 268

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +   + +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  I   +IT
Sbjct: 269 FTDDVIEAMAQTRNVCPALHMPLQSGSDRILRAMRRSYRAERYLGIIERVRAAIPHAAIT 328

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +           +YS R GT A  ++ Q+      ER +
Sbjct: 329 TDLIVGFPGETEEDFAATLDVVXXXXXXXXXXXQYSKRPGTPAAQLDGQLPKAVVQERYE 388

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +LI L            +G+ ++VL
Sbjct: 389 RLIALQEQISLEANRALVGQAVEVL 413


>MIAB_MYCBO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 512

 Score =  188 bits (477), Expect = 9e-50
 Identities = 121/385 (31%), Positives = 177/385 (45%), Gaps = 12/385 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +       GY        ADV V NTC+V    D +   +   +   
Sbjct: 31  TYGCQMNVHDSERLAGLLEAAGYRRATDGSEADVVVFNTCAVRENADNRLYGNLSHLAPR 90

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 91  KRANPDMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIA 150

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +   A++ I  GCN  C +C++P  RG    + P  +L E+RS
Sbjct: 151 EALQQ--FPSSLPSSRESAYAAWVSISVGCNNSCTFCIVPSLRGREVDRSPADILAEVRS 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKV------TLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L   G  E+ L G +  +YGV   +           +LL     IDG+ERVR  S  P  
Sbjct: 209 LVNDGVLEVTLLGQNVNAYGVSFADPALPRNRGAFAELLRACGDIDGLERVRFTSPHPAE 268

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +   + +CP  H+ LQSG D  L+ M R Y A+ Y  I+  +R  I   +IT
Sbjct: 269 FTDDVIEAMAQTRNVCPALHMPLQSGSDRILRAMRRSYRAERYLGIIERVRAAIPHAAIT 328

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +           +YS R GT A  ++ Q+      ER +
Sbjct: 329 TDLIVGFPGETEEDFAATLDVVXXXXXXXXXXXQYSKRPGTPAAQLDGQLPKAVVQERYE 388

Query: 357 KLIELNRINEKAFAEKYIGEVIDVL 381
           +LI L            +G+ ++VL
Sbjct: 389 RLIALQEQISLEANRALVGQAVEVL 413


>MIAB_MICAN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  188 bits (477), Expect = 9e-50
 Identities = 120/426 (28%), Positives = 205/426 (48%), Gaps = 16/426 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N  +SE M       G++  +    AD+ + NTC++ +  ++K    +GR  ++
Sbjct: 12  TFGCQMNKADSERMAGILEDLGFQWSEDANEADLILYNTCTIRDNAEQKVYSYLGRQAKR 71

Query: 67  N---PEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
               P+  + V GC AQ    ++   +  VD+++G ++   +   + +  D G Q V   
Sbjct: 72  KQTQPDLTLIVAGCVAQQEGEQLLRRVPEVDLIIGPQHANRLGDLLQQVFD-GSQVVATE 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
            +    + ED+     ++   A++ +  GCN  C YC++P  RG   S+ P  +  E+  
Sbjct: 131 PI---HIMEDITKPRRDSNITAWVNVIYGCNERCTYCVVPGVRGVEQSRTPAAIRAEMAQ 187

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVT-------LVDLLEEIEKIDGIERVRIGSIDPT 235
           L + G++EI L G +  +YG DL              DLL  +  + GIER+R  +  P 
Sbjct: 188 LGQQGYQEITLLGQNIDAYGRDLPGVTASGRHLHNFTDLLYYVHDVAGIERLRFATSHPR 247

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE +++    L K+C HFH+  QSG +  LK M R YT ++Y  I+  +RD + D +I
Sbjct: 248 YFTERLIKACQELPKVCEHFHIPFQSGDNDILKAMKRGYTQEKYRQIIANIRDLMPDAAI 307

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + D IVGFPG            +  I   + +   YSPR GT A   ++Q+    K +R 
Sbjct: 308 SADAIVGFPGETEAQFENTLKLVDEIGFDQLNTAAYSPRPGTPAAIWDDQLSEQVKSDRL 367

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC-NVSGK 414
           ++L  L        +++Y+G + ++L E+     +    G TR         D   + GK
Sbjct: 368 QRLNHLVATKAAERSQRYLGRIEEILVEDVNPKDASQVMGRTRGNRLTFFTGDIEELRGK 427

Query: 415 ILNVKI 420
            + VKI
Sbjct: 428 FVKVKI 433


>MIAB_LEGPL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  188 bits (477), Expect = 9e-50
 Identities = 134/443 (30%), Positives = 210/443 (47%), Gaps = 14/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEK-FVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M E  +   G    D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTNGCQMNEYDSSKMAEVLYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+ R    +NP  +I V GC A    +++      VD+V G +    +   +N+  ++ K
Sbjct: 64  GQWREYKAKNPHVLIGVGGCVASQEGSDIIKRAPFVDIVFGPQTLHRLPALLNERLEKNK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 SVVDISFPEIEK-FDHLPAPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPFDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG--VDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E   LA  G +EI L G +   Y   +D  +   L  L+  I  IDGI R+R  +  P
Sbjct: 182 LAECYQLASQGVREINLLGQNVNDYRGIMDNGDIADLALLIHYIAAIDGIGRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F+E+++     + +L  H HL +QSG D  L  M R YTA E++  +  LR    D+ 
Sbjct: 242 LAFSENLINAYAEVPELANHLHLPVQSGSDRILSLMKRGYTALEFKSKIRKLRKIRPDIR 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           ++TD+IVGFPG            +  I    +  F YSPR GT A N+ +      K +R
Sbjct: 302 LSTDIIVGFPGETDKDFQDTMDLVHEIGFDTSFSFIYSPRPGTPAANLPDDTPMEIKKQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L     +N   ++E  IG    +L     +  S   +G T     VN     ++ G+
Sbjct: 362 LQILQNRLLMNAARYSESMIGSKQKILVTGFSKKSSQQLSGRTECNRVVNFDGPPHLIGQ 421

Query: 415 ILNVKI-----NSFEGEVAEGEI 432
            ++V+I     NS  G + E E+
Sbjct: 422 FIDVQISDALPNSLRGRLLEKEM 444


>MIAB_LEGPH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  188 bits (477), Expect = 9e-50
 Identities = 134/443 (30%), Positives = 210/443 (47%), Gaps = 14/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEK-FVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M E  +   G    D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTNGCQMNEYDSSKMAEVLYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+ R    +NP  +I V GC A    +++      VD+V G +    +   +N+  ++ K
Sbjct: 64  GQWREYKAKNPHVLIGVGGCVASQEGSDIIKRAPFVDIVFGPQTLHRLPALLNERLEKNK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 SVVDISFPEIEK-FDHLPAPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPFDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG--VDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E   LA  G +EI L G +   Y   +D  +   L  L+  I  IDGI R+R  +  P
Sbjct: 182 LAECYQLASQGVREINLLGQNVNDYRGIMDNGDIADLALLIHYIAAIDGIGRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F+E+++     + +L  H HL +QSG D  L  M R YTA E++  +  LR    D+ 
Sbjct: 242 LAFSENLINAYAEVPELANHLHLPVQSGSDRILSLMKRGYTALEFKSKIRKLRKIRPDIR 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           ++TD+IVGFPG            +  I    +  F YSPR GT A N+ +      K +R
Sbjct: 302 LSTDIIVGFPGETDKDFQDTMDLVHEIGFDTSFSFIYSPRPGTPAANLPDDTPMEIKKQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L     +N   ++E  IG    +L     +  S   +G T     VN     ++ G+
Sbjct: 362 LQILQNRLLMNAARYSESMIGSKQKILVTGFSKKSSQQLSGRTECNRVVNFDGPPHLIGQ 421

Query: 415 ILNVKI-----NSFEGEVAEGEI 432
            ++V+I     NS  G + E E+
Sbjct: 422 FIDVQISDALPNSLRGRLLEKEM 444


>MIAB_LEGPC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  188 bits (477), Expect = 9e-50
 Identities = 134/443 (30%), Positives = 210/443 (47%), Gaps = 14/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEK-FVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M E  +   G    D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTNGCQMNEYDSSKMAEVLYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+ R    +NP  +I V GC A    +++      VD+V G +    +   +N+  ++ K
Sbjct: 64  GQWREYKAKNPHVLIGVGGCVASQEGSDIIKRAPFVDIVFGPQTLHRLPALLNERLEKNK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 SVVDISFPEIEK-FDHLPAPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPFDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG--VDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E   LA  G +EI L G +   Y   +D  +   L  L+  I  IDGI R+R  +  P
Sbjct: 182 LAECYQLASQGVREINLLGQNVNDYRGIMDNGDIADLALLIHYIAAIDGIGRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F+E+++     + +L  H HL +QSG D  L  M R YTA E++  +  LR    D+ 
Sbjct: 242 LAFSENLINAYAEVPELANHLHLPVQSGSDRILSLMKRGYTALEFKSKIRKLRKIRPDIR 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           ++TD+IVGFPG            +  I    +  F YSPR GT A N+ +      K +R
Sbjct: 302 LSTDIIVGFPGETDKDFQDTMDLVHEIGFDTSFSFIYSPRPGTPAANLPDDTPMEIKKQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L     +N   ++E  IG    +L     +  S   +G T     VN     ++ G+
Sbjct: 362 LQILQNRLLMNAARYSESMIGSKQKILVTGFSKKSSQQLSGRTECNRVVNFDGPPHLIGQ 421

Query: 415 ILNVKI-----NSFEGEVAEGEI 432
            ++V+I     NS  G + E E+
Sbjct: 422 FIDVQISDALPNSLRGRLLEKEM 444


>MIAB_LEGPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  188 bits (477), Expect = 9e-50
 Identities = 134/443 (30%), Positives = 210/443 (47%), Gaps = 14/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEK-FVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M E  +   G    D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTNGCQMNEYDSSKMAEVLYASHGLVKTDQVEDADVILLNTCSIREKAQEKVFSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G+ R    +NP  +I V GC A    +++      VD+V G +    +   +N+  ++ K
Sbjct: 64  GQWREYKAKNPHVLIGVGGCVASQEGSDIIKRAPFVDIVFGPQTLHRLPALLNERLEKNK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 SVVDISFPEIEK-FDHLPAPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEISRPFDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYG--VDLDEKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L E   LA  G +EI L G +   Y   +D  +   L  L+  I  IDGI R+R  +  P
Sbjct: 182 LAECYQLASQGVREINLLGQNVNDYRGIMDNGDIADLALLIHYIAAIDGIGRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F+E+++     + +L  H HL +QSG D  L  M R YTA E++  +  LR    D+ 
Sbjct: 242 LAFSENLINAYAEVPELANHLHLPVQSGSDRILSLMKRGYTALEFKSKIRKLRKIRPDIR 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           ++TD+IVGFPG            +  I    +  F YSPR GT A N+ +      K +R
Sbjct: 302 LSTDIIVGFPGETDKDFQDTMDLVHEIGFDTSFSFIYSPRPGTPAANLPDDTPMEIKKQR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
            + L     +N   ++E  IG    +L     +  S   +G T     VN     ++ G+
Sbjct: 362 LQILQNRLLMNAARYSESMIGSKQKILVTGFSKKSSQQLSGRTECNRVVNFDGPPHLIGQ 421

Query: 415 ILNVKI-----NSFEGEVAEGEI 432
            ++V+I     NS  G + E E+
Sbjct: 422 FIDVQISDALPNSLRGRLLEKEM 444


>MIAB_DINSH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  188 bits (477), Expect = 9e-50
 Identities = 130/442 (29%), Positives = 205/442 (46%), Gaps = 22/442 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+SE M E    EGY   D  E AD+ ++NTC +     +K    +G
Sbjct: 6   KLYIKTYGCQMNVYDSERMAEAMGGEGYVQTDRAEDADMILLNTCHIREKAAEKVYSELG 65

Query: 62  R---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R    + + P+  I V GC AQ    E+   +  VD+V+G +    +     +A    K 
Sbjct: 66  RFKPLKAEKPDLKIGVAGCVAQAEGAEIMRRQPLVDLVVGPQAYHRLPELTARAATGAK- 124

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRA------FLKIQDGCNRFCAYCLIPYTRGSVCSK 171
                  L     E+ K +    + +A      FL +Q+GC++FCA+C++PYTRG+  S+
Sbjct: 125 ------ALDTDFPEEDKFDHLAARPKAKRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSR 178

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGS 231
              +VL E R L E G +EI L G +  +Y         L  L+ ++ +IDG+ER+R  +
Sbjct: 179 PAARVLTEARDLVERGVREITLLGQNVNAYH---GHARGLAGLIWDLAEIDGLERIRFTT 235

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P    + ++    A  KL P+ HL +QSG D  LK MNR++TA+ Y  ++  +R    
Sbjct: 236 SHPNDMDDALIAAHGACDKLMPYLHLPVQSGSDRILKAMNRKHTAESYIRLIERIRAARP 295

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+ ++ D IVGFPG            ++ +   + + FKYS R GT A   E+ V G   
Sbjct: 296 DILLSGDFIVGFPGETDQDFADTMALVEAVGYGQAYSFKYSARPGTPAAEKED-VPGEVA 354

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           D                  +  +G    VLFE+   L  G   G + +   V+  A    
Sbjct: 355 DXXXXXXXXXXXXXXXXIQDAKVGTTARVLFEKPGRL-PGQMVGKSEHLHAVHVAAPDAA 413

Query: 412 SGKILNVKINSFEGEVAEGEIV 433
            G ++ V+I         G ++
Sbjct: 414 RGDLVRVRIAESSANSLRGVLI 435


>MIAB_CUPTR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  188 bits (477), Expect = 9e-50
 Identities = 138/449 (30%), Positives = 212/449 (47%), Gaps = 19/449 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +G E  D  E ADV + NTCSV     +K    +
Sbjct: 3   KVFVKTYGCQMNEYDSDKMVDVLNASQGLEATDNVEDADVILFNTCSVREKAQEKVFSEL 62

Query: 61  GRARRQN---PEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ +I V GC A Q   + VS    VDVV G +    +   + + +  G+
Sbjct: 63  GRMKALKAVKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGPQTLHRLPDLIARRQRTGQ 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 123 SQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y   + +   + D   L+E + +I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYRGKMGDTSEIADFALLIEYVAEIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT  +V       KL  H HL +Q   D  L  M R Y+  EY+ I+  LR    D+
Sbjct: 241 PKEFTSRLVELYGRCDKLVNHLHLPVQHASDRILMAMKRGYSVLEYKSIIRRLRALRPDM 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D IVGFPG            ++ I    +  F +SPR GT A N+ +      K +
Sbjct: 301 SMSSDFIVGFPGETDADFDKLMAMIEEIGYDTSFSFIFSPRPGTPAANLHDDTPREVKLQ 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN--------A 405
           R ++L      N +  ++  +G V  +L E           G T N   VN        A
Sbjct: 361 RLQRLQATIEENVQRISQGMVGTVQRILVEGPARKDPTELHGRTENNRVVNFALPGVPQA 420

Query: 406 KADCNVSGKILNVKINSFEGEVAEGEIVL 434
             D  + G++++V I         GEIV+
Sbjct: 421 GRD-RLVGQLVDVSITQAFPHSLRGEIVV 448


>MIAB_SODGM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  187 bits (476), Expect = 1e-49
 Identities = 136/444 (30%), Positives = 212/444 (47%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDSTHGYQLTDNPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +   PE II V GC A      +      VD++ G +    +   +N       
Sbjct: 64  GRWHMLKEARPELIIGVGGCVASQEGAHIRERANYVDIIFGPQTLHRLPEMINHVNGTRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L        T AF+ I +GCN++C++C++PYTRG   S+    +
Sbjct: 124 PVVDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCNKYCSFCVVPYTRGEEVSRPCDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA+ G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLADQGVREVNLLGQNVNAYRGASYDGGICTFAELLRLVAAIDGIDRIRYITSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 IEFTDDIIDVYRDTPELVSFVHLPVQSGSDRILTMMKRAHTALEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  +    +  F YS R GT A +M + V   +K +R
Sbjct: 302 ISSDFIIGFPGETQQDFEQTMQLIADVNFDMSFSFIYSARPGTPAADMVDNVSEEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L E  RI ++A  ++ +  G+V  +L E          +G T N   VN +   ++ 
Sbjct: 362 LHILQE--RITQQAMQYSRRMKGKVQRILVEGTSRKNVMELSGRTENNRVVNFEGAPSMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G +   E
Sbjct: 420 GKFVDVEIVDVYPNSLRGVLLRTE 443


>MIAB_SHEWM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  187 bits (476), Expect = 1e-49
 Identities = 134/444 (30%), Positives = 218/444 (49%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLMDEYKGYTLTEEAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR ++   +NP  II V GC A Q         + VD++ G +    +   +++    GK
Sbjct: 64  GRWKKLKDKNPNLIIGVGGCVASQEGKVIKDRAQCVDLIFGPQTLHRLPEMIDQIEAGGK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K   D   E   +   AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AVIDVSFPEIEKF--DRLPEPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDDEICTFAELLRYVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTQMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            ++ +    +  F YS R GT A ++ + V  ++K ER
Sbjct: 302 VSSDFIIGFPGESKQDFEDTMKLIEDVQFDHSFSFIYSARPGTPASDLPDDVTLDEKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T     VN +AD    
Sbjct: 362 --LAILQDRITQQAMRYSRQMLGTVQRILVEGPSVKNPMELRGRTETSRVVNFEADPKHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++V+I     NS  G    GE
Sbjct: 420 GSFVDVEIVDVYTNSLRGNFIRGE 443


>MIAB_SHEHH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  187 bits (476), Expect = 1e-49
 Identities = 138/444 (31%), Positives = 222/444 (50%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EGY + D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDEYEGYTLTDNAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + PE II V GC A Q         + VD++ G +    +   +++ R  GK
Sbjct: 64  GRWKTLKDKKPELIIGVGGCVASQEGKAIKERAQCVDLIFGPQTLHRLPEMIDQIR-AGK 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           + V   +  + + F+ L  E   +   AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 123 KAVIDVSFPEIEKFDRLP-EPRADGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDDEICTFAELLRYVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDLILTQMKRGHMAIEYKSIIRRLRKARPDIL 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ I    +  F YS R GT A ++ + V  ++K ER
Sbjct: 302 ISSDFIIGFPGESKQDFADTMKLIEDIQFDHSFSFIYSARPGTPAADLPDDVSLDEKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T N   VN +      
Sbjct: 362 --LAILQDRITQQAMRYSRQMVGTVQRILVEGPSVKNPMELRGRTENSRVVNFEGMHKHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G    GE
Sbjct: 420 GKFVDVEIVDVYTNSLRGVFIRGE 443


>MIAB_RHOFD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 452

 Score =  187 bits (476), Expect = 1e-49
 Identities = 135/443 (30%), Positives = 205/443 (46%), Gaps = 13/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M++     +GYE  D  E AD+ + NTCSV     +K    +
Sbjct: 4   KVFIKTYGCQMNEYDSDKMSDVLGAAQGYEPTDNVEEADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPE-AIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +    + A+I V GC A Q     +     VDVV G +    +   + +     + Q
Sbjct: 64  GRVKHLKKKGALIGVGGCVASQEGAAIIERAPYVDVVFGPQTLHRLPQLLAERERLNRSQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGAS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDVLV 181

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDL--------DEKVTLVDLLEEIEKIDGIERVRIG 230
           E+  LA+ G KEI L G +  ++   +         E      LLE +  I GIER+R  
Sbjct: 182 EVAGLADQGVKEITLLGQNVNAWRSRMIGAASALSSEMADFATLLEYVSDIPGIERIRYV 241

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P  FT  ++     L KL  H HL +Q G D  L  M R YTA EY+  V  LR   
Sbjct: 242 TSHPNEFTPSLIAAYDKLPKLVSHLHLPVQHGSDRILMAMKRGYTAMEYKSTVRKLRAIR 301

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+++++D IVGFPG            +  +    +  F +SPR GT A N+ +      
Sbjct: 302 PDMALSSDFIVGFPGETEDDFSKMMKLIDDVGFDNSFSFIFSPRPGTPAANLHDDTPHEV 361

Query: 351 KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN 410
           K  R + L  +   + K  +E  +G V  +L E   +  S    G T     VN      
Sbjct: 362 KLRRLQHLQTVINDSIKRISESRLGTVQRILVEGASKRDSTELMGRTECNRVVNFCGQPR 421

Query: 411 VSGKILNVKINSFEGEVAEGEIV 433
           + G++++V I         GE+V
Sbjct: 422 LIGQMVDVAITETRSFTLRGEVV 444


>MIAB_PSEU2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  187 bits (476), Expect = 1e-49
 Identities = 133/445 (29%), Positives = 219/445 (49%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +  EV    E ADV ++NTCS+      +    +
Sbjct: 4   KLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R     NPE +IAV GC   +A  E + I      VDVV G +    +   ++ AR 
Sbjct: 64  GRWRELKLANPEMVIAVGGC---VASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDAARV 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
               QV V      K F+ L     +  + A++ + +GC+++C +C++PYTRG   S+  
Sbjct: 121 TRLPQVDVSFPEIEK-FDHLPEPRVDGPS-AYVSVMEGCSKYCTFCVVPYTRGEEVSRPF 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
             VL E+  LAE+G +E+ L G +   Y G   D +V  L DL+  +  +DGI+R+R  +
Sbjct: 179 DDVLSEVIHLAENGVREVTLLGQNVNGYRGTTHDGRVADLADLIRVVAAVDGIDRIRYTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ +++    + +L  H HL +QSG D  L  M R +T  EY+  +  LR  + 
Sbjct: 239 SHPLEFSDSLIQAHAEVPELVKHLHLPVQSGSDRILAAMKRNHTTLEYKSRLRKLRAAVP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            +SI++D IVGFPG            ++ +    +  F YSPR GT A ++++      K
Sbjct: 299 GISISSDFIVGFPGETEKDFDNTMKLIEDVGFDFSFSFVYSPRPGTPAADLKDDTPEALK 358

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD- 408
            ER   L   +R+N++ F  + + +G +  +L  +  +   G   G T N   VN + D 
Sbjct: 359 KERLAAL--QHRLNQQGFEISRQMVGSIQRILVTDYSKKDPGELQGRTENNRIVNFRCDN 416

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
             + G+  +V I+  +     G ++
Sbjct: 417 PKLIGQFADVHIDDAQPHSLRGSLL 441


>MIAB_POLNA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  187 bits (476), Expect = 1e-49
 Identities = 131/438 (29%), Positives = 206/438 (47%), Gaps = 8/438 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M++     EGYE     + AD+ + NTCSV     +K    +
Sbjct: 4   KVFIKTFGCQMNEYDSDKMSDVLHAAEGYENTQNIDEADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPEAI-IAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +    + + I V GC A Q     +     VDVV G +    +   +      GK Q
Sbjct: 64  GRVKHLKAKGVLIGVGGCVASQEGEAIIQRAPYVDVVFGPQTLHRLPQLLASRARLGKPQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGAS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDVLV 181

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y   +     + D   LLE + +I GIER+R  +  P 
Sbjct: 182 EVAGLADQGVKEVTLLGQNVNAYRGSMGGTAEIADFATLLEYVSEIPGIERIRYITSHPN 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT+ ++     L KL  H HL +Q G D  L  M R YTA EY+  +  LR    D+++
Sbjct: 242 EFTQRLIDAYATLPKLVNHLHLPVQHGSDRILMAMKRGYTAMEYKSTIRKLRAIRPDLAM 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            +  +    +  F +SPR GT A N+ +      K +R 
Sbjct: 302 SSDFIVGFPGETEDDFEKLMKLVNDVGYDTSFSFIFSPRPGTPAANLADDTPHEVKLKRL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           + L      + +A +   +G V  +L E      +    G T     V  K    + G++
Sbjct: 362 QHLQATLDDSVRAISASRLGTVQRILVEGTARKDASELMGRTECNRVVILKGQPRLIGQM 421

Query: 416 LNVKINSFEGEVAEGEIV 433
           ++V+I         GE++
Sbjct: 422 VDVRITEASQRSLRGEVL 439


>MIAB_NOCFA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 503

 Score =  187 bits (476), Expect = 1e-49
 Identities = 128/395 (32%), Positives = 184/395 (46%), Gaps = 16/395 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE ++      GY        AD+ V NTC+V    D K    +G     
Sbjct: 11  TFGCQMNVHDSERLSGLLEDAGYVKAAPGATADLVVFNTCAVRENADNKLYGTLGHLAPV 70

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +   P   IAV GC AQ    T V     VDVV G+ N G +   + +AR   + QV++ 
Sbjct: 71  KAGRPGMQIAVGGCLAQKDRDTVVRKAPWVDVVFGTHNIGSLPVLLERARHNEQAQVEIL 130

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F      +  +    ++ I  GCN  C +C++P  RG    + P  VL E+++
Sbjct: 131 ESLE--AFPSTLPAKRESAYAGWVSISVGCNNTCTFCIVPALRGKEVDRRPGDVLAEVQA 188

Query: 183 LAEHGFKEIILSGIHTASYGV---DLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           L + G  E+ L G +  SYG    D DE   +     LL     I+G+ERVR  S  P  
Sbjct: 189 LVDQGVLEVTLLGQNVNSYGASFADPDEPRDRGAFAKLLRACGGIEGLERVRFTSPHPAE 248

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
           FT+DV+  +     +CP  H+ LQSG D  LK M R Y    Y  I+  +R  +   +IT
Sbjct: 249 FTDDVIEAMAQTPNICPQLHMPLQSGSDRVLKAMRRSYRKARYLGIIEKVRAAMPHAAIT 308

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           TD+IVGFPG            +++   +    F+YS R GT A  M +QV      ER  
Sbjct: 309 TDIIVGFPGETEEDFQETLDVVRQARFTSAFTFQYSKRPGTPAAEMADQVPKQVVQERYD 368

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSG 391
           +LI L      A   + IG  +++L  E    GSG
Sbjct: 369 RLIALQEEISLAANRELIGTEVELLVAE----GSG 399


>MIAB_WOLTR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  187 bits (475), Expect = 1e-49
 Identities = 123/385 (31%), Positives = 192/385 (49%), Gaps = 7/385 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR--AR 64
           T GC++N Y+S  M       G+ VV+  E AD+ ++NTC +     +K    +G+  + 
Sbjct: 8   TYGCQMNVYDSILMENIIKPLGFNVVNDVEKADLVILNTCHIREKAAEKLYSELGKIHSS 67

Query: 65  RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGA 123
           R+N E  I   GC AQ    E+      VD+V+G ++   +   + KA    K  V    
Sbjct: 68  RKNKEITIVAAGCVAQAEGEEIFRRAPFVDIVVGPQSITTLPELIVKA-SRSKGHVINTD 126

Query: 124 VLKNKVFEDLKIEEYNNK--TRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
             K   F+ L  E Y N   + AFL IQ+GC++FC +C++PYTRG+  S+   ++  E  
Sbjct: 127 FPKVMKFDRLSDECYGNSQGSSAFLSIQEGCDKFCTFCVVPYTRGAEYSRPVNEIFREAL 186

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
            L  +G KEI L G +  +Y  + + +V  L  L+  I KI+ +ER+R  +  P    E 
Sbjct: 187 KLVANGAKEINLLGQNVNAYHGEYEGEVWDLGKLISHIAKIEKLERIRYTTSHPRDMHES 246

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           +        KL P  HL +QSG +  L+ MNR+YT +EY +I+   R     +  ++D I
Sbjct: 247 LYLAHAEAPKLMPFIHLPVQSGSNKILRAMNRKYTTEEYLEIIERFRKLKPKIEFSSDFI 306

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            ++R+  ++ + FKYS R GT     ++QV    K ER   L +
Sbjct: 307 VGFPGETEKDFEGTIKLVERVRYAQAYSFKYSTRPGTPGAERKDQVPEKVKTERLLHLQK 366

Query: 361 LNRINEKAFAEKYIGEVIDVLFEEE 385
           L    +  F +  +G+ I VLF  +
Sbjct: 367 LINKQQLEFNQSMVGKTIPVLFSNK 391


>MIAB_MARMS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 451

 Score =  187 bits (474), Expect = 2e-49
 Identities = 136/449 (30%), Positives = 220/449 (48%), Gaps = 26/449 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEV--VDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  + E +E+   D  E ADV ++NTCS+      K    
Sbjct: 4   KLFIQTHGCQMNEYDSSRMAD-LLGESHEMELTDNAEEADVLLLNTCSIREKAQDKVYHQ 62

Query: 60  IGR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR    +++NP  +I V GC A      +    + VD++ G +   ++   VN A   G
Sbjct: 63  LGRWKKLKQKNPNLVIGVGGCVASQEGDAIRKRAKHVDMIFGPQTLHKLPEMVNAA---G 119

Query: 116 KQQVKVGAVLKNKV--FEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
           K  + +  V   ++  F+ L          AF+ I +GC+++C +C++PYTRG   S+  
Sbjct: 120 KH-IPITDVTFPEIEKFDHLPAPRVEG-AEAFVSIMEGCSKYCTFCVVPYTRGEEVSRPF 177

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERVRIGS 231
             +L E+  LAE G +EI L G +  +Y  D  E  +  L D++  + +IDG+ER+R  +
Sbjct: 178 DSILKEVVQLAEQGVREIHLLGQNVNAYRGDTAEGDEADLADIIHAVAQIDGVERIRFTT 237

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ ++       KL  H HL +QSG D  L  M R +  + Y D +N +++   
Sbjct: 238 SHPVEFSDSLIEAFRNEPKLVSHLHLPVQSGADNILSAMKRGHDRQYYIDKINRIKEARP 297

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            +S+++D I+GFPG            ++ I    +  F YS R GT A N+E+    + K
Sbjct: 298 GISLSSDFIIGFPGETDDDFVDTMNLIQEIGFDHSFSFVYSQRPGTPASNLEDDTPEDVK 357

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA-D 408
            ER    I   RI+++A+  +   +GEV  +L         G   G T N   VN +A D
Sbjct: 358 KER--LAILQRRISQQAYDISLSMVGEVQRILISGYSPRDPGQLQGRTENNRIVNFRAFD 415

Query: 409 CNVSGKILNVKI-----NSFEGEVAEGEI 432
             + GK  +V I     NS  GE+   E+
Sbjct: 416 PQLIGKFADVVITDAYPNSLLGELVGSEL 444


>MIAB_HYPNA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  187 bits (474), Expect = 2e-49
 Identities = 132/436 (30%), Positives = 208/436 (47%), Gaps = 17/436 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+SE + +     GY  V+  E AD+ VVNTC +     +K    +G+ +R 
Sbjct: 8   TYGCQMNVYDSERIRDVLRPLGYAPVETPESADLVVVNTCHIREKATEKVYSELGQLKRM 67

Query: 67  NPEA----IIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQQVKV 121
              +     IAV GC AQ    E+   +  VD+VLG +   ++   + +A      +++ 
Sbjct: 68  KEASGGRMTIAVAGCVAQAEGEELIRRQPAVDLVLGPQAYHKLPEMIARASRAIGDRLET 127

Query: 122 GAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
                 K F+ L      +   AF+ +Q+GC++FC +C++PYTRG+  S+    ++ E R
Sbjct: 128 EFDTVEK-FDALPKTREADGPAAFVSVQEGCDKFCTFCVVPYTRGAEMSRRVDDIVFETR 186

Query: 182 SLAEHGFKEIILSG-----IHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           SLA  G +EI L G      H  +  ++  E  TL  L   + KI GIER+R  +  P  
Sbjct: 187 SLASQGVREITLLGQNVNAFHGPAPVLEGGEDWTLGQLCRHLSKIGGIERIRYTTSHPRD 246

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
             +D++        + P  HL +QSG D  LK MNR +TA  Y DI+  +R    D++I 
Sbjct: 247 MDDDLIAAHGDTPAMMPFLHLPVQSGSDRILKAMNRGHTADHYRDIITRVRAARPDIAIA 306

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           +D IVGFPG            ++ I  +  + FKYS R GT A  M   +  + KD    
Sbjct: 307 SDFIVGFPGESDADFEATMQLVRDIGYAIAYSFKYSSRPGTPAAEMHGHLSESVKDXXXX 366

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKIL 416
                       F    IG+ + VL   +    +G   G +     V+ +   +++GKI+
Sbjct: 367 XXXXXXXXXXTEFNASQIGKTLPVLVTGKGR-NAGQMHGRSPYLQAVHFEGPDDLNGKIV 425

Query: 417 NVKI-----NSFEGEV 427
           +VK+     NS  GE+
Sbjct: 426 DVKVIGASLNSLTGEL 441


>MIAB_ERWCT RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  187 bits (474), Expect = 2e-49
 Identities = 139/445 (31%), Positives = 216/445 (48%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGSTHGYELTEIAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    +  NP  II V GC A      +      VDV+ G +    +   +N  +    
Sbjct: 64  GRWKALKDLNPNLIIGVGGCVASQEGAHIRERAHYVDVIFGPQTLHRLPEMINHVQGTRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K F+ L     +  T AF+ I +GCN++C +C++PYTRG   S+    V
Sbjct: 124 PIVDISFPEIEK-FDRLPEPRADGPT-AFVSIMEGCNKYCTFCVVPYTRGEEVSRPCDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+RVR  +  P
Sbjct: 182 LFEIAQLAAQGVREVNLLGQNVNAYRGETYDGEICSFAELLRLVAAIDGIDRVRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M RR+TA EY+ I+  L +    + 
Sbjct: 242 IEFTDDIISVYEDTPELVSFLHLPVQSGSDRVLTMMKRRHTALEYKAIIRKLHNARPGIL 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  +    ++ F YS R GT A +M   VD   ++E+
Sbjct: 302 ISSDFIIGFPGETQADFEQTMKLIADVNFDMSYSFVYSARPGTPAADM---VDDVLEEEK 358

Query: 355 SKKLIEL-NRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ++L  L +RI ++A  F+   +G V  +L E          +G T N   VN +   ++
Sbjct: 359 KQRLYLLQDRITKQAMRFSRLMLGTVQRILVEGTSRKSVMELSGRTENNRVVNFEGTPDM 418

Query: 412 SGKILNVKI-----NSFEGEVAEGE 431
            GK ++V+I     NS  G V   E
Sbjct: 419 IGKFVDVEIVDVYTNSLRGIVVRTE 443


>MIAB_ACIAC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  187 bits (474), Expect = 2e-49
 Identities = 131/438 (29%), Positives = 204/438 (46%), Gaps = 8/438 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +GYE     E AD+ + NTCSV     +K    +
Sbjct: 4   KVFVKTFGCQMNEYDSDKMVDVLNAAQGYEPTQDVEEADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPEAI-IAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +      + I V GC A     E+      VDVV G +    +   + +     + Q
Sbjct: 64  GRIKHLKARGVKIGVGGCVASQEGDEIIKRAPYVDVVFGPQTLHRLPELLAQREALARPQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGAS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDVLV 181

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y   +     + D   LLE +  I GIER+R  +  P 
Sbjct: 182 EVAGLADQGVKEVTLLGQNVNAYLGKMGGTAEVADFALLLEYVADITGIERIRFTTSHPN 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT+ ++     + KL  H HL +Q G D  L  M R YTA EY+  +  LR    D+++
Sbjct: 242 EFTQRLIDAYARIPKLVSHLHLPVQHGSDRILMAMKRGYTAMEYKSTIRKLRAIRPDLAM 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            +  I    +  F +SPR GT A ++ +      K  R 
Sbjct: 302 SSDFIVGFPGETEDDFGKMMKLIDDIHFDNSFSFIFSPRPGTPAASLHDDTPHEVKLRRL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++L  +   N K+ +E  +G V  +L E   +       G T     VN      + G++
Sbjct: 362 QELQAVINANIKSISESRVGTVQRILVEGASKRDGSELMGRTECNRVVNFAGHPRLVGQM 421

Query: 416 LNVKINSFEGEVAEGEIV 433
           ++V I   +     GE+V
Sbjct: 422 VDVTITEAKAYTLRGEVV 439


>MIAB_WOLSU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 433

 Score =  186 bits (473), Expect = 3e-49
 Identities = 133/425 (31%), Positives = 205/425 (48%), Gaps = 14/425 (3%)

Query: 2   KVAFATLGCRVNTYESEAM-TEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   TLGC +N  +SE M  E   +EGY + D  + AD+ ++NTCSV    ++K    I
Sbjct: 4   KLFIQTLGCAMNVRDSEHMIAELEAKEGYTLTDDPKEADLILINTCSVREKPERKLFSEI 63

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ ++ +  EA I V GC A    +E+      V  VLG+RN  +I   +++   E   +
Sbjct: 64  GQFSKEKKEEAKIGVCGCTASHLGSEILKKAPSVSFVLGARNVSKISRVIHQ---EKAVE 120

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V       + VF      +Y    +A + I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 121 VATDYDDSSYVFATGSRNDY----KAMVNISIGCDKKCAYCIVPHTRGQEISVPSDLILG 176

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E R LA  G KEI+L G +   YG        K++  +LL E+ +++GIER+R  S  P 
Sbjct: 177 EARRLASAGVKEILLLGQNVNHYGRRFSSAHPKISFTELLRELSQVEGIERLRFTSPHPL 236

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              ++ +    +  K+C   H+ LQSG    L  M R Y+ + + + V  L+    + +I
Sbjct: 237 HMDDEFLEEFASNPKICKSIHMPLQSGSTRILSLMRRGYSQEWFINRVERLKALAPETTI 296

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
            TD+IVGFPG            L+R+     + F YSPR  T A + EN VD     ER 
Sbjct: 297 GTDIIVGFPGESEEDFLGTMEVLERVRFETLYSFVYSPRPHTEAASWENLVDEEVASERL 356

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
            +L   ++   +   +K +G +  VL+E +     G   G T     V  K      G+I
Sbjct: 357 HRLQARHKEILEELNQKEVGAIHSVLWEHQ-RRDEGWCEGRTDTGKMVRMKGGEEFLGRI 415

Query: 416 LNVKI 420
             V+I
Sbjct: 416 TPVRI 420


>MIAB_VIBVU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  186 bits (473), Expect = 3e-49
 Identities = 130/439 (29%), Positives = 205/439 (46%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLLIKTWGCQMNEYDSSKMADLLNAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + P  +I V GC A      +      VDV+ G +    +   + +++ E  
Sbjct: 64  GRWKTLKDKKPGVVIGVGGCVATQEGDHIRERAPFVDVIFGPQTLHRLPEMIKQSQSEDA 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L        T AF+ I +GC+++C YC++PYTRG   S+    V
Sbjct: 124 PVMDISFPEIEK-FDSLPEPRAEGAT-AFVSIMEGCSKYCTYCVVPYTRGEEVSRPMDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LYEIAQLAEQGVREVNLLGQNVNAYRGPTHDGEICSFAELLRLVASIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +T  EY+ I+  LR    D+ 
Sbjct: 242 LEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRPHTGIEYKSIIRKLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +K +    +  F +SPR GT A +    +    K ER
Sbjct: 302 ISSDFIVGFPGESDKDFQDTMKLIKDVDFDMSFSFIFSPRPGTPAADYPCDLSEETKKER 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L +        ++   +G    VL E   +         T N   VN +   ++ G+
Sbjct: 362 LYELQQQINAQAMRYSRLMLGTEQRVLVEGPSKKNLMELRARTENNRVVNFEGSADLIGQ 421

Query: 415 ILNVKINSFEGEVAEGEIV 433
            ++VKI         GEIV
Sbjct: 422 FVDVKITDVFANSLRGEIV 440


>MIAB_STRMK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 472

 Score =  186 bits (473), Expect = 3e-49
 Identities = 129/426 (30%), Positives = 203/426 (47%), Gaps = 9/426 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +G E+ D  E ADV +VNTCS+     +K    +
Sbjct: 34  KLYIKTHGCQMNEYDSAKMADVLAASDGLELTDTPEDADVILVNTCSIREKAQEKVFSQL 93

Query: 61  G---RARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G     + +  E II V GC A Q     +     VD+V G +    +   +   R++ +
Sbjct: 94  GVWKGLKNKGREVIIGVGGCVASQEGEAIIKRAPFVDLVFGPQTLHRLPELIRARREQKR 153

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K   D   E       AF+ I +GC+++C++C++PYTRG+  S+  + V
Sbjct: 154 PQVDISFPEIEKF--DRLPEPRAEGASAFVSIMEGCSKYCSFCVVPYTRGTEVSRPFEDV 211

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           + E+  LA  G +EI L G +  +Y       E   L  L+  I +IDG+ R+R  +  P
Sbjct: 212 VVEVAQLAAQGVREINLLGQNVNAYRGPYGDGEFADLGLLIRTIAEIDGVGRIRFTTSHP 271

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F++ ++     + +L    HL +Q+G D  L  M R YTA E++  +  LR    D+S
Sbjct: 272 LEFSDSLIDAFRDVPQLANFLHLPVQAGSDRVLSAMKRGYTALEFKSKIRKLRAVRPDIS 331

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++ I    +  F YS R GT A ++E+ +   +K  R
Sbjct: 332 ISSDFIVGFPGETDADFEKTMKLIEDIGFDHSFSFIYSRRPGTPAADLEDTISDAEKHAR 391

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L E    +    +EK +G V  VL E          TG T N   VN  A   + G+
Sbjct: 392 LSRLQERINAHAAGISEKMVGTVQTVLVEGPSRKNPNELTGKTENMRSVNFPAPARLIGQ 451

Query: 415 ILNVKI 420
            ++V I
Sbjct: 452 FVDVVI 457


>MIAB_SHESA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  186 bits (473), Expect = 3e-49
 Identities = 133/444 (29%), Positives = 216/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGEYQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +    + VD++ G +    +   +++ R   K
Sbjct: 64  GRWKTLKDKNPDLIIGVGGCVASQEGKAIKDRAQCVDIIFGPQTLHRLPDMIDQVRRGEK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 AVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICTFAELLRYVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTAMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ +A   +  F YS R GT A ++ + VD  +K +R
Sbjct: 302 ISSDFIIGFPGETKEDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVDMEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++   +G V  +L E           G T N   VN +      
Sbjct: 362 --LAILQDRITQQAMRYSRHMMGTVQRILVEGPSVKNPMELRGRTENNRVVNFEGQPKHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++V+I     NS  G+   GE
Sbjct: 420 GSFVDVEIVDVYTNSLRGKFIRGE 443


>MIAB_PSE14 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  186 bits (473), Expect = 3e-49
 Identities = 134/447 (29%), Positives = 220/447 (49%), Gaps = 24/447 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +  EV    E ADV ++NTCS+      +    +
Sbjct: 4   KLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R     NPE +IAV GC   +A  E + I      VDVV G +    +   ++ AR 
Sbjct: 64  GRWRELKLANPEMVIAVGGC---VASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDAARI 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
               QV V      K F+ L     +  + A++ + +GC+++C +C++PYTRG   S+  
Sbjct: 121 TRLPQVDVSFPEIEK-FDHLPEPRVDGPS-AYVSVMEGCSKYCTFCVVPYTRGEEVSRPF 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
             VL E+  LAE+G +E+ L G +   Y G   D +V  L DL+  +  +DGI+R+R  +
Sbjct: 179 DDVLSEVIHLAENGVREVTLLGQNVNGYRGTTHDGRVADLADLIRVVAAVDGIDRIRYTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ +++    + +L  H HL +QSG D  L  M R +T  EY+  +  LR  + 
Sbjct: 239 SHPLEFSDSLIQAHAEVPELVKHLHLPVQSGSDRILAAMKRNHTTLEYKSRLRKLRAAVP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            +SI++D IVGFPG            ++ +    +  F YSPR GT A ++++      K
Sbjct: 299 GISISSDFIVGFPGETEKDFDNTMKLIEDVGFDFSFSFVYSPRPGTPAADLKDDTPEALK 358

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            ER   L   +R+N++ F  + + +G +  +L  +  +   G   G T N   VN +  C
Sbjct: 359 KERLAAL--QHRLNQQGFEISRQMVGSIQRILVTDYSKKDPGELQGRTENNRIVNFR--C 414

Query: 410 N---VSGKILNVKINSFEGEVAEGEIV 433
           N   + G+  +V I+  +     G ++
Sbjct: 415 NNPKLIGQFADVHIDDAQPHSLRGSLL 441


>MIAB_PROMH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 476

 Score =  186 bits (473), Expect = 3e-49
 Identities = 131/444 (29%), Positives = 213/444 (47%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY++ D  E AD+ ++NTCS+     +K    +
Sbjct: 6   KLYIKTWGCQMNEYDSSKMADLLESTHGYQLTDVAEDADILLLNTCSIREKAQEKVFHQL 65

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ II V GC A      +    + VD++ G +    +   +N+ +    
Sbjct: 66  GRWKNFKDNKPDIIIGVGGCVASQEGEYIRQRAQCVDIIFGPQTLHRLPEMINQVKGTKS 125

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V +      K   D   E       AF+ I +GCN++C++C++PYTRG   S+    +
Sbjct: 126 PVVDISFPEIEKF--DRLPEPRAEGPSAFVSIMEGCNKYCSFCVVPYTRGEEVSRPCDDI 183

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G   D ++ +  +LL  +  IDGI+R+R  +  P
Sbjct: 184 LFEIAQLAAQGVREVNLLGQNVNAYRGETFDGQICSFAELLRLVAAIDGIDRIRFTTSHP 243

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 244 IEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTLMKRNHTALEYKSIIRKLRKARPDIL 303

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  +    +  F YS R GT A ++ + V   +K +R
Sbjct: 304 ISSDFIIGFPGETQDDFEKTMKLIADVNFDMSFSFIYSARPGTPAADLPDDVSEEEKKQR 363

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RIN++A  ++   +  V  +L E          +G T N   VN +   ++ 
Sbjct: 364 LYLLQQ--RINQQAMNYSRAMLNSVQRILVEGPSRKNVMELSGRTENNRVVNFEGTPDMI 421

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G+V   E
Sbjct: 422 GKFVDVEIVDVYANSLRGKVVRTE 445


>MIAB_NEOSM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 471

 Score =  186 bits (473), Expect = 3e-49
 Identities = 130/432 (30%), Positives = 215/432 (49%), Gaps = 21/432 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE-GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K    T GC++N Y+SE M EK V   G+ + +  E AD+ ++NTC++     +K    +
Sbjct: 30  KFHIKTYGCQMNVYDSE-MIEKIVSGLGFTLSERAEDADLIILNTCNIREKAAEKLYSEL 88

Query: 61  GRAR----RQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEG 115
           G+ R    ++    +I V GC AQ    E+    E VDVV+G ++   +   + K   + 
Sbjct: 89  GQIRLLQKKKQERILIVVAGCVAQAEGEEIMRRAENVDVVVGPQSIHSLPELIAKVNRQS 148

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNK----TRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
            + +K+      K   D   EE   +    + AFL IQ+GC++FCA+C++PYTRG+  S+
Sbjct: 149 GKAIKMEFDPIEKF--DYLAEETRKRRVPQSSAFLSIQEGCDKFCAFCVVPYTRGAEYSR 206

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLD---EKVTLVDLLEEIEKIDGIERVR 228
             ++V  E  SL   G KEI L G +   Y   LD   + + L  L+  + KI  ++R+R
Sbjct: 207 STEEVYREALSLTTKGVKEITLLGQNVNGYHGTLDSGNKVLNLGQLISRLGKIPSLKRIR 266

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P    +++        KL P  HL +QSG D  LK+MNR+YT  +Y  I+N  ++
Sbjct: 267 YTTSHPVDMHKELYDAHANESKLMPFVHLPVQSGSDKILKQMNRKYTTADYLKIINEFQN 326

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
              D++ ++D IVGFPG            ++++  ++ + FKYSPR GT       Q+  
Sbjct: 327 ARSDIAFSSDFIVGFPGESDDDFQQTLALIEQVNYAQCYSFKYSPRPGTPGATYP-QISE 385

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
             K+ R              F +K IG+ + VLF+++        +G T  Y++     D
Sbjct: 386 ETKNTRXXXXXXXXXXXXXXFNKKMIGKTVTVLFDKK---HPDKISGRT-EYMQQVFSDD 441

Query: 409 CNVSGKILNVKI 420
            N+  KI+ +++
Sbjct: 442 SNLLDKIVTMRV 453


>MIAB_GEOMG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 441

 Score =  186 bits (473), Expect = 3e-49
 Identities = 130/432 (30%), Positives = 212/432 (49%), Gaps = 14/432 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK--SRQIIGRAR 64
           T GC++N  +SE +      EGY     +  AD+ +VNTCSV    + K  S        
Sbjct: 11  TFGCQMNVSDSEKVASLLRGEGYSQTPDSSEADLIIVNTCSVRAKAEHKVYSYXXXXXXX 70

Query: 65  RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGA 123
                       C AQ     +   +  +D+V G+ N   +   V +A ++G+++  V  
Sbjct: 71  XXXXXXXXXXXXCVAQQEGERLLKRVPWLDLVFGTHNLHLLPEMV-RAAEQGERRAAVDF 129

Query: 124 VLKNKVFEDL--KIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
           +  N+   DL  + +E    TR F+ +  GC+ FC+YC++PY RG   S+   +++ EIR
Sbjct: 130 I-DNEARLDLFPQADEGGGVTR-FVTVMQGCDNFCSYCIVPYVRGREISRRSVEIIGEIR 187

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
           S    G +E+ L G +  SYG+    +++   LL EI  IDG+ER+R  +  P   + ++
Sbjct: 188 SAVAGGVREVTLLGQNVNSYGLKTPGELSFAGLLREISAIDGLERIRFTTSHPKDISPEL 247

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +     L KLC H HL  Q+G D+ L RMNR YT +EY + V  LR    ++ IT D+IV
Sbjct: 248 IACFAELPKLCGHIHLPAQAGSDSILARMNRGYTRQEYLEKVAALRAARPEILITGDIIV 307

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++ +  +    F YSPR  T A ++ +++   +  ER +++  L
Sbjct: 308 GFPGETEADFLQTLSLMEEVRYTDIFSFAYSPRPETAAASLGDRIMRKETTERLERVQGL 367

Query: 362 NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI- 420
            R         ++G    VL E   + G  +Y G T   + VN   + +++G +++V+I 
Sbjct: 368 QRDMTIERHAGFVGTCQAVLVEGMSKRGDQLY-GRTDGNLIVNFAGNPSLAGSLVDVRIT 426

Query: 421 ----NSFEGEVA 428
               NS  GE+A
Sbjct: 427 RGYPNSLLGELA 438


>MIAB_VIBVY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  186 bits (472), Expect = 3e-49
 Identities = 129/439 (29%), Positives = 203/439 (46%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLLIKTWGCQMNEYDSSKMADLLNAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + P  +I V GC A      +      VDV+ G +    +   + +++ E  
Sbjct: 64  GRWKTLKDKKPGVVIGVGGCVATQEGDHIRERAPFVDVIFGPQTLHRLPEMIKQSQSEDA 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L        T AF+ I +GC+++C YC++PYTRG   S+    V
Sbjct: 124 PVMDISFPEIEK-FDSLPEPRAEGAT-AFVSIMEGCSKYCTYCVVPYTRGEEVSRPMDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y   +   E  +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LYEIAQLAEQGVREVNLLGQNVNAYRGPMHDGEICSFAELLRLVASIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +T  EY+ I+  LR    D+ 
Sbjct: 242 LEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRPHTGIEYKSIIRKLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +K +    +  F +SPR GT A +    +    K ER
Sbjct: 302 ISSDFIVGFPGETDKDFQDTMKLIKDVDFDMSFSFIFSPRPGTPAADYPCDLSEETKKER 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L +        ++   +G    VL E   +         T N   VN +   ++ G+
Sbjct: 362 LYELQQQINAQAMRYSRLMLGTEQRVLVEGPSKKNLMELRARTENNRVVNFEGSADLIGQ 421

Query: 415 ILNVKINSFEGEVAEGEIV 433
            ++VKI         GEIV
Sbjct: 422 FVDVKITDVFANSLRGEIV 440


>MIAB_STRM5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 472

 Score =  186 bits (472), Expect = 3e-49
 Identities = 128/426 (30%), Positives = 204/426 (47%), Gaps = 9/426 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +G E+ D  + ADV +VNTCS+     +K    +
Sbjct: 34  KLYIKTHGCQMNEYDSAKMADVLAASDGLELTDSPDDADVILVNTCSIREKAQEKVFSQL 93

Query: 61  G---RARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           G     + +  E II V GC A Q     +     VD+V G +    +   +   R++ +
Sbjct: 94  GVWKSLKNKGREVIIGVGGCVASQEGEAIIKRAPFVDLVFGPQTLHRLPELIRARREQKR 153

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K   D   E   +   AF+ I +GC+++C++C++PYTRG+  S+  + V
Sbjct: 154 PQVDISFPEIEKF--DRLPEPRADGASAFVSIMEGCSKYCSFCVVPYTRGTEVSRPFEDV 211

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           + E+  LA  G +EI L G +  +Y       E   L  L+  I +IDG+ R+R  +  P
Sbjct: 212 VVEVAQLAAQGVREINLLGQNVNAYRGPYGDGEFADLGLLIRTIAEIDGVGRIRFTTSHP 271

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F++ ++     + +L    HL +Q+G D  L  M R YTA E++  +  LR    D+S
Sbjct: 272 LEFSDSLIDAFRDVPQLANFLHLPVQAGSDRVLSAMKRGYTALEFKSKIRKLRAVRPDIS 331

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            ++ I    +  F YS R GT A ++E+ +   +K  R
Sbjct: 332 ISSDFIVGFPGETDADFEKTMKLIEDIGFDHSFSFIYSRRPGTPAADLEDTISDAEKHAR 391

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L E    +    +EK +G V  VL E          TG T N   VN  A   + G+
Sbjct: 392 LSRLQERINAHAAGISEKMVGTVQTVLVEGPSRKNPNELTGKTENMRSVNFPAPARLIGQ 451

Query: 415 ILNVKI 420
            ++V I
Sbjct: 452 FVDVVI 457


>MIAB_SHEPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  186 bits (472), Expect = 3e-49
 Identities = 137/444 (30%), Positives = 216/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     EGY + D  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDEYEGYTLTDNAEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + P  II V GC A Q         + VD++ G +    +   +++ +D  K
Sbjct: 64  GRWKTLKDKKPGLIIGVGGCVASQEGKAIKERAQCVDLIFGPQTLHRLPEMIDQIKDGKK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K   D   E       AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AVIDVSFPEVEKF--DRLPEPRAEGPSAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDDEICTFAELLRYVAAIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDLILTQMKRGHMAIEYKSIIRRLRKARPDIL 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ I    +  F YS R GT A ++ + V  ++K ER
Sbjct: 302 ISSDFIIGFPGESKQDFADTMKLIEDIQFDHSFSFIYSARPGTPAADLPDNVSLDEKKER 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T N   VN +      
Sbjct: 362 --LAILQDRITQQAMRYSRQMVGTVQRILVEGPSVKNPMELRGRTENSRVVNFEGLHEHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           GK ++V+I     NS  G    GE
Sbjct: 420 GKFVDVEIVDVYTNSLRGVFIRGE 443


>MIAB_METPP RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 457

 Score =  186 bits (472), Expect = 3e-49
 Identities = 132/443 (29%), Positives = 208/443 (46%), Gaps = 12/443 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     EGYE     E AD+ + NTCSV     +K    +
Sbjct: 9   KVFIKTFGCQMNEYDSDKMADVLRAAEGYEPTTDVEQADLILFNTCSVREKAQEKVFSDL 68

Query: 61  GRARRQNPEAI-IAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +      + I V GC A Q     +     VDVV G +    +   + +   + + Q
Sbjct: 69  GRVKHLKARGVKIGVGGCVASQEGAALIERAPYVDVVFGPQTLHRLPEMLARRDAQQRPQ 128

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L     +  T AF+ I +GC+++C+YC++PYTRG   S+    VL 
Sbjct: 129 VDISFPEIEK-FDHLPPARVDGAT-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDVLT 186

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+ SLA+ G KE+ L G +   Y   + +   + D   LLE + +I GI R+R  +  P 
Sbjct: 187 EVASLADQGVKEVTLLGQNVNGYRGRMGDTAEIADFALLLEYVAEIPGIARIRYTTSHPN 246

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            F++ ++     + +L  H HL +Q G D  L  M R YT+ EY+  +  LR    D+S+
Sbjct: 247 EFSQRLIDVYARVPQLVNHLHLPVQHGSDRILSAMKRGYTSLEYKSSIRKLRAIRPDISL 306

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD IVGFPG            ++ +    +  F YS R GT A  + +      K  R 
Sbjct: 307 STDFIVGFPGETDDDHARTMKLIEDVGFDHSFSFIYSARPGTPAAALHDDAPRELKLARL 366

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFE---EEVELGSG-VYTGYTRNYIKVNAKADCNV 411
           +++ E    N +   +  +G V  +L E      EL +G    G T     VN      +
Sbjct: 367 QQVQEAIEANGRRIGQSRVGTVQRILVEGPSRRPELNAGHELMGRTECNRIVNFAGPARL 426

Query: 412 SGKILNVKINSFEGEVAEGEIVL 434
           +G++++V I         GE++L
Sbjct: 427 TGQLIDVTITEAYPHSLRGEVLL 449


>MIAB_HELP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  186 bits (472), Expect = 3e-49
 Identities = 134/434 (30%), Positives = 216/434 (49%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T+GC +N+ +SE +  +  +  Y+     +MAD+ ++NTCSV    ++K    I
Sbjct: 1   MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKMADLILINTCSVREKPERKLFSEI 60

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K     ++ 
Sbjct: 61  GQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARNVSKISQVIHK-----EKA 115

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V+V        +   +  E   + R+ L I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 116 VEVAIDYDESAYA-FEFFEKKAQIRSLLNISIGCDKKCAYCIVPHTRGKEISIPMDLILK 174

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YGV       KV   DLL+++ +I GIER+R  S  P 
Sbjct: 175 EAEKLANNGTKELMLLGQNVNNYGVRFSSEHAKVDFSDLLDKLSEIPGIERIRFTSPHPL 234

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  + R     K+C   H+ LQSG  A LK M R Y+ + + + V  L+  + +V I
Sbjct: 235 HMNDGFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKEWFLNRVERLKALVPEVGI 294

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 295 STDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEVSSSRL 354

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+ + +  G+     T  +I+V  K  
Sbjct: 355 ERLQNRHKEILEEKAKLE--VGKTHVVLVENRREMDNQI-VGFEGRSDTGKFIEVTCKEK 411

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 412 RN-PGELVKVEIIS 424


>MIAB_SHESR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  186 bits (471), Expect = 4e-49
 Identities = 135/447 (30%), Positives = 217/447 (48%), Gaps = 24/447 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGEYQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR    + +NP+ II V GC   +A  E   I+     VD++ G +    +   + + R 
Sbjct: 64  GRWKTLKDKNPDLIIGVGGC---VASQEGKAIKDRAHCVDIIFGPQTLHRLPDMIEQVRR 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
             K  + V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+  
Sbjct: 121 GEKAVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPS 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGS 231
             ++ EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +
Sbjct: 179 DDIILEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICTFAELLRYVAAIDGIDRIRFTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  FT+D++       +L    HL +QSG D  L  M R + A EY+ I+  LR    
Sbjct: 239 SHPIEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTAMKRGHMAIEYKSIIRRLRKARP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+ I++D I+GFPG            ++ +A   +  F YS R GT A ++ + VD  +K
Sbjct: 299 DIQISSDFIIGFPGETKEDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVDMEEK 358

Query: 352 DERSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            +R    I  +RI ++A  ++   +G V  +L E           G T N   VN +   
Sbjct: 359 KQR--LAILQDRITQQAMRYSRHMMGTVQRILVEGPSVKNPMELRGRTENNRVVNFEGQP 416

Query: 410 NVSGKILNVKI-----NSFEGEVAEGE 431
              G  ++V+I     NS  G+   GE
Sbjct: 417 KHIGSFVDVEIVDVYTNSLRGKFIRGE 443


>MIAB_ERYLH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  186 bits (471), Expect = 4e-49
 Identities = 123/383 (32%), Positives = 191/383 (49%), Gaps = 9/383 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           + GC++N Y+ E M E    +G E     E AD+ V+NTC +      K    IGR    
Sbjct: 14  SFGCQMNVYDGERMAEMLDEKGIEPAPEGEDADLVVLNTCHIREKAVDKVYSDIGRLTKG 73

Query: 64  RRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           + Q    +IAV GC AQ    E+      V +V+G +    +   ++ A   GK+     
Sbjct: 74  KTQTKAPMIAVAGCVAQAEGEEIMARAPAVSMVVGPQAYHRLPGMIDAAV-AGKRSTDTD 132

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
                K F  L  +   +   AFL IQ+GC++FC YC++PYTRG+  S+    ++DE + 
Sbjct: 133 MPADAK-FAALP-KRRKSAPSAFLTIQEGCDKFCTYCVVPYTRGAEISRPFSALIDEAKK 190

Query: 183 LAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDPTFFTED 240
           L E G KEI L G + +++ G D   +   +  L+ E+ K   ++RVR  +  P    ++
Sbjct: 191 LVEAGAKEITLLGQNVSAWTGEDAKGRALGMAGLIRELAKDPDLKRVRYTTSHPADMDDE 250

Query: 241 VVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVI 300
           ++     ++KL P+ HL +QSG D  LK MNR +TA+ Y  ++   R    D++++ D I
Sbjct: 251 LIATHGEVEKLMPYLHLPVQSGNDRVLKAMNRSHTAESYLRLLERFRAARPDLALSGDFI 310

Query: 301 VGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIE 360
           VGFPG            +  +  ++ + FKYSPR GT A  ME QV     DER ++L  
Sbjct: 311 VGFPGETEAEFEDTLKIVDEVRYAQAYSFKYSPRPGTPAATMERQVPKEVMDERLQRLQA 370

Query: 361 LNRINEKAFAEKYIGEVIDVLFE 383
               ++ AF    +G   +VL E
Sbjct: 371 ALNRDQAAFNAGSVGRTCEVLVE 393


>MIAB_WOLPM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  185 bits (470), Expect = 6e-49
 Identities = 120/383 (31%), Positives = 191/383 (49%), Gaps = 5/383 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQ 66
           T GC++N Y+S  M       G+ VV     AD+ ++NTC +     +K    +G+    
Sbjct: 8   TYGCQMNVYDSVLMENVIKPLGFNVVSDAGKADLVILNTCHIREKAAEKLYSELGKIHSL 67

Query: 67  NPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVL 125
             E  I V GC AQ    EV      VD+V+G ++   +   + KA    K  V      
Sbjct: 68  RKEMTIVVAGCVAQAEGEEVFRRAPFVDIVVGPQSIATLPELIVKA-SRSKGHVINTDFP 126

Query: 126 KNKVFEDLKIEEYNNK--TRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSL 183
           +   F+ L  E Y N   + AFL IQ+GC++FC +C++PYTRG+  S+   ++  E   L
Sbjct: 127 EVAKFDKLPDECYGNSQGSSAFLAIQEGCDKFCTFCVVPYTRGAEYSRPVNEIFREALKL 186

Query: 184 AEHGFKEIILSGIHTASYGVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
             +G  EI L G +  +Y  + + +V  L  L+  I KI+ +ER+R  +  P    E + 
Sbjct: 187 VANGANEINLLGQNVNAYHGECEGEVWDLGKLISHIAKIEKLERIRYTTSHPRDMHESLY 246

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
                  KL P  HL +QSG +  L  MNR++TA+EY +I++  R    ++  ++D IVG
Sbjct: 247 LAHAEEPKLMPFVHLPVQSGSNKILHAMNRKHTAEEYLEIIDRFRKLKPEIEFSSDFIVG 306

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++++  ++ + FKYSPR GT     ++QV    K ER  +L +L 
Sbjct: 307 FPGETEKDFEETMKLVEKVRYAQAYSFKYSPRPGTPGAERKDQVPEEVKTERLLRLQKLI 366

Query: 363 RINEKAFAEKYIGEVIDVLFEEE 385
              +  F +  +G+ I VLF ++
Sbjct: 367 SKQQLEFNQSMVGKTIPVLFSDK 389


>MIAB_PROM4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 467

 Score =  185 bits (470), Expect = 6e-49
 Identities = 132/442 (29%), Positives = 202/442 (45%), Gaps = 20/442 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M     R GY+  +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 28  TFGCQMNKADSERMAGILERMGYKQAEEELQADLVLYNTCTIRDNAEQKVYSYLGRQALR 87

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P+  + V GC AQ    + +  +  +D+V+G ++   +   +NK   E  QQV   
Sbjct: 88  KKLFPQLKLIVAGCVAQQEGESLLRRVPELDLVMGPQHANRLETLLNKV--ETGQQVLAT 145

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L   + EDL     ++   A++ +  GCN  C YC++P  RG   S+ P  +  EI +
Sbjct: 146 EELY--IIEDLTTARRDSSICAWVNVIYGCNERCTYCVVPSVRGKEQSRTPPAIKREIEN 203

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA  GFKE+ L G +  +YG DL        +K TL DLL  I  I+GIER+R  +  P 
Sbjct: 204 LANTGFKEVTLLGQNIDAYGRDLPGTTPQGRKKNTLTDLLYYIHDIEGIERIRFATSHPR 263

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FT  ++     L K+C HFH+  QSG D  L +M                 + + + SI
Sbjct: 264 YFTSRLIEACAELPKVCEHFHIPFQSGDDEILNQMXXXXXXXXXXXXXXXXXELMPNASI 323

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T DVIV FPG            ++ I   + +   YSPR  T A    NQ+    K ER 
Sbjct: 324 TADVIVAFPGETNEQFQRSLSLVEEIGFDQLNTAAYSPRPNTPAALWPNQIPEEIKIERL 383

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRN-----YIKVNAKADCN 410
           +KL  L  I  K    +Y   V +VL E           G TR      + KV+ + +  
Sbjct: 384 RKLNSLVEIKAKERNVRYKDRVEEVLAENTNPKDKQQLMGRTRTNRLTFFPKVDNQGNSY 443

Query: 411 VSGKILNVKINSFEGEVAEGEI 432
             G ++ V++         G I
Sbjct: 444 KPGDLVKVRVKDIRAFSLSGVI 465


>MIAB_GLUDA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 480

 Score =  185 bits (470), Expect = 6e-49
 Identities = 131/440 (29%), Positives = 206/440 (46%), Gaps = 18/440 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRAR-- 64
           T GC++N Y+S  MT+     GY  VD  + AD+ ++NTC + +   +K    +GR R  
Sbjct: 37  TWGCQMNVYDSARMTDVLRPLGYHPVDTPDTADMVILNTCHIRDRAAEKVFSELGRLRLV 96

Query: 65  -----RQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
                 +  + ++AV GC AQ    E+ +    VD+VLG +    +   V          
Sbjct: 97  KEARATEGQQTVLAVAGCVAQAEGKEILARAPFVDIVLGPQTYHRLPEMVXXXXXXXXXV 156

Query: 119 VKVGAVLKNKV--FEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
           +      + K     D +  +      +FL IQ+GC++FC++C++PYTRG+  S+    V
Sbjct: 157 IDTDFPAEQKFDFLPDAQAPQSPGGITSFLTIQEGCDKFCSFCVVPYTRGAEASRPVASV 216

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           L E R + E G +EI L G +  +Y G   D +V  L  L E +  I G+ R+R  +  P
Sbjct: 217 LREARRMVECGAREITLLGQNVNAYHGEGPDGRVWGLARLAEALAAIPGLARIRYTTSHP 276

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
                D++     L  L P  HL +QSG D  L  MNR +TA +Y D+V  LRD   D++
Sbjct: 277 RDMDADLIAAHRDLPALMPFLHLPVQSGSDRILDAMNRGHTAADYRDLVLRLRDARPDIA 336

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D IVG PG            ++ +  ++   FKYSPR GT A     QV  + K   
Sbjct: 337 LSSDFIVGHPGETDADFEATLQLIRDVGFAQAFSFKYSPRPGTPAAGAPLQVAEDVKXXX 396

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
                         F +  +G V+ VLF       +G  +G +     V+ +   ++ G+
Sbjct: 397 XXXXXXXXXXXXXXFNDGTVGHVVPVLFTGHGR-KAGQLSGRSPYLQPVHVEGPDSLIGQ 455

Query: 415 ILNVKI-----NSFEGEVAE 429
           I NV+I     NS  G + +
Sbjct: 456 IANVEIRERYTNSLSGTLVQ 475


>MIAB_THET8 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 465

 Score =  185 bits (469), Expect = 7e-49
 Identities = 131/445 (29%), Positives = 203/445 (45%), Gaps = 30/445 (6%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+    T GC++N Y+S  +  + V  G+E+VD  E AD  +VNTC+V     +K R ++
Sbjct: 26  MRAHIITYGCQMNEYDSHLVASELVSLGWELVDSVEEADFVLVNTCAVRGKPVEKVRSLL 85

Query: 61  GRARRQNPEA--IIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           G+ R++      +I ++GC AQ+   +    + GVDV+LG                 G  
Sbjct: 86  GQLRKEKERRGLLIGMMGCLAQLDEGQQMAKKFGVDVLLGP----------------GAL 129

Query: 118 QVKVGAVLKNKVFEDLKIEEY---------NNKTRAFLKIQDGCNRFCAYCLIPYTRGSV 168
                A+  N+ F DL   E               A + I  GCN  C YC++P TRG  
Sbjct: 130 TSLPEALKANERFWDLTFREDVLDYIPPPPKGALSAHVTIIRGCNHHCTYCIVPTTRGPE 189

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVR 228
            S+ P  +L EI  L + G  E+ L G +  SYG D     +  +LL  +  + GI RVR
Sbjct: 190 VSRHPDLILKEIELLKQAGVVEVTLLGQNVNSYGKDQPGFPSFAELLRMVGGM-GIPRVR 248

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P  FT+D++  I     +C + HL +QSG D  L+RM R Y    Y + +  +R+
Sbjct: 249 FLTSHPVNFTDDIIEAIAETPAICRYIHLPVQSGSDRVLRRMAREYRRAHYLERIRKIRE 308

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
            + D  ++TD+IVGFPG               +   + ++F YSPR GT A      +  
Sbjct: 309 ALPDAVLSTDIIVGFPGETEEDFQETLSLYDEVGYDQAYMFIYSPRPGTPAYKHFQDLPR 368

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
             K ER  +LIE  +        +++G+ ++VL   E +   G   G+ R    V   A 
Sbjct: 369 EVKVERLMRLIEKQKEWSYRRNLEWVGKTVEVLVRGEAK-EEGFVQGHDRGNHPVLVPAS 427

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
                 +  V+I      +  GE+V
Sbjct: 428 QAPVPGLYQVEIKQATPHLLFGEVV 452


>MIAB_THET2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 465

 Score =  185 bits (469), Expect = 7e-49
 Identities = 131/445 (29%), Positives = 203/445 (45%), Gaps = 30/445 (6%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           M+    T GC++N Y+S  +  + V  G+E+VD  E AD  +VNTC+V     +K R ++
Sbjct: 26  MRAHIITYGCQMNEYDSHLVASELVSLGWELVDSVEEADFVLVNTCAVRGKPVEKVRSLL 85

Query: 61  GRARRQNPEA--IIAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           G+ R++      +I ++GC AQ+   +    + GVDV+LG                 G  
Sbjct: 86  GQLRKEKERRGLLIGMMGCLAQLDEGQQMAKKFGVDVLLGP----------------GAL 129

Query: 118 QVKVGAVLKNKVFEDLKIEEY---------NNKTRAFLKIQDGCNRFCAYCLIPYTRGSV 168
                A+  N+ F DL   E               A + I  GCN  C YC++P TRG  
Sbjct: 130 TSLPEALKANERFFDLTFREDVLDYIPPPPKGALSAHVTIIRGCNHHCTYCIVPTTRGPE 189

Query: 169 CSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVR 228
            S+ P  +L EI  L + G  E+ L G +  SYG D     +  +LL  +  + GI RVR
Sbjct: 190 VSRHPDLILKEIELLKQAGVVEVTLLGQNVNSYGKDQPGFPSFAELLRMVGGM-GIPRVR 248

Query: 229 IGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRD 288
             +  P  FT+D++  I     +C + HL +QSG D  L+RM R Y    Y + +  +R+
Sbjct: 249 FLTSHPVNFTDDIIEAIAETPAICRYIHLPVQSGSDRVLRRMAREYRRAHYLERIRKIRE 308

Query: 289 KIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDG 348
            + D  ++TD+IVGFPG               +   + ++F YSPR GT A      +  
Sbjct: 309 ALPDAVLSTDIIVGFPGETEEDFQETLSLYDEVGYDQAYMFIYSPRPGTPAYKHFQDLPR 368

Query: 349 NKKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
             K ER  +LIE  +        +++G+ ++VL   E +   G   G+ R    V   A 
Sbjct: 369 EVKVERLMRLIEKQKEWSYRRNLEWVGKTVEVLVRGEAK-EEGFVQGHDRGNHPVLVPAS 427

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
                 +  V+I      +  GE+V
Sbjct: 428 QAPVPGLYQVEIKQATPHLLFGEVV 452


>MIAB_SHEFN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  185 bits (469), Expect = 7e-49
 Identities = 132/444 (29%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +    ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDDYQGYTLTEDASEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP  II V GC A      +    + VD++ G +    +   + + +   K
Sbjct: 64  GRWKSLKDKNPNLIIGVGGCVASQEGKAIKDRAQCVDIIFGPQTLHRLPEMIEQIQRGEK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L     +  T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AVIDISFPEIEK-FDRLPEPRADGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + E+  LA  G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEVAQLAAQGVREVNLLGQNVNAYRGATHDDEICTFAELLRLVASIDGIDRLRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTQMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ +A   +  F YS R GT A ++ + V   +K +R
Sbjct: 302 ISSDFIIGFPGESKDDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVSDEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T N   VN +A     
Sbjct: 362 --LAILQDRITQQAMRYSRQMLGTVQRILVEGPSVKNPMELRGRTENSRVVNFEAAHTHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++VKI     NS  GE   GE
Sbjct: 420 GSFVDVKIVDVYTNSLRGEFVRGE 443


>MIAB_RHOPS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 473

 Score =  185 bits (469), Expect = 7e-49
 Identities = 117/394 (29%), Positives = 196/394 (49%), Gaps = 12/394 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLVILNTCHIREKASEKVYSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        IAV GC AQ    E V          G ++   +   + +A  
Sbjct: 66  RLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAPXXXXXXGPQSYHHLPQLLARADQ 125

Query: 114 EGKQ-QVKVGAVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
            G+  + +     K       + E    +   AF+ +Q+GC++FC +C++PYTRG+  S+
Sbjct: 126 AGRALETEFPVEDKFGFLPQPRPETIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEVSR 185

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRI 229
               ++D+++ LA++G +EI L G +  +Y G   D +  TL  LL  +  + GI R+R 
Sbjct: 186 PVSAIIDDVKRLADNGVREITLIGQNVNAYHGEGPDSRAWTLGRLLRRLAAVPGIVRLRY 245

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P    ++++     L  L P  HL +QSG D  L  MNR++TA +Y  +++  R  
Sbjct: 246 STSHPNDVDDELIEAHRDLDALMPFVHLPVQSGSDPILAAMNRKHTAADYRRVIDRFRAV 305

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
              ++ ++D IVGFPG            + +I  +  + FKYSPR GT A +M+  V   
Sbjct: 306 RPQIAFSSDFIVGFPGETEADFAATLALVTQIGYAGAYSFKYSPRPGTPAADMQEMVPAA 365

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFE 383
             DER ++L +L    + AF +  IG+ +DVLFE
Sbjct: 366 VMDERLERLQQLIDSQQSAFNKAAIGQTVDVLFE 399


>MIAB_HELPJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  185 bits (469), Expect = 7e-49
 Identities = 135/434 (31%), Positives = 215/434 (49%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T+GC +N+ +SE +  +  +  Y+     +MAD+ ++NTCSV    ++K    I
Sbjct: 1   MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKMADLILINTCSVREKPERKLFSEI 60

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K     ++ 
Sbjct: 61  GQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARNVSKISQVIHK-----EKA 115

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V+V        +   +  E   + R+ L I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 116 VEVAIDYDESAYA-FEFFEKKAQIRSLLNISIGCDKKCAYCIVPHTRGKEISIPMDLILK 174

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YGV       KV   DLL+++ +I GIER+R  S  P 
Sbjct: 175 EAEKLANNGTKELMLLGQNVNNYGVRFSSEHAKVGFSDLLDKLSEIQGIERIRFTSPHPL 234

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  + R     K+C   H+ LQSG  A LK M R Y+ + + + V  L+  + +V I
Sbjct: 235 HMNDAFLERFAQNPKVCKSIHMPLQSGSSAVLKMMRRGYSKEWFLNRVERLKALVPEVGI 294

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 295 STDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEISSLRL 354

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+  G   G+     T  +I+V  K  
Sbjct: 355 ERLQNRHKEILEEKAKLE--VGKTHVVLVENRREM-DGQIVGFEGRSDTGKFIEVTCKEK 411

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 412 KN-PGELVRVEIIS 424


>MIAB_SHEON RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  184 bits (468), Expect = 1e-48
 Identities = 133/444 (29%), Positives = 215/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGEYQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + +NP+ II V GC A      +    + VD++ G +    +   + + R   K
Sbjct: 64  GRWKTLKDKNPDLIIGVGGCVASQEGKAIKDRAQCVDIIFGPQTLHRLPEMIEQVRRGEK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 AVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICTFAELLRYVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R + A EY+ I+  LR    D+ 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTAMKRGHMAIEYKSIIRRLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ +A   +  F YS R GT A ++ + VD  +K +R
Sbjct: 302 ISSDFIIGFPGETQEDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVDMEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKA----- 407
               I  +RI ++A  ++   +G V  +L E           G T N   VN +      
Sbjct: 362 --LAILQDRITQQAMRYSRHMMGTVQRILVEGPSVKNPMELRGRTENNRVVNFEGLPKHI 419

Query: 408 DCNVSGKILNVKINSFEGEVAEGE 431
              V  +I++V  NS  G+   GE
Sbjct: 420 GTFVDVEIVDVYTNSLRGKFIRGE 443


>MIAB_POLSJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  184 bits (468), Expect = 1e-48
 Identities = 131/438 (29%), Positives = 202/438 (46%), Gaps = 8/438 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M++     EGYE     + AD+ + NTCSV     +K    +
Sbjct: 4   KVFIKTFGCQMNEYDSDKMSDVLHAAEGYEPTQNVDEADLILFNTCSVREKAQEKVFSDL 63

Query: 61  GRARRQNPEAI-IAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           GR +    + + I V GC A Q     +     VDVV G +    +   + K     K Q
Sbjct: 64  GRVKHLKEKGVLIGVGGCVASQEGAAIIQRAPYVDVVFGPQTLHRLPDLLAKRARLNKPQ 123

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+    VL 
Sbjct: 124 VDISFPEIEK-FDHLPPARVEGAS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDVLV 181

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSIDPT 235
           E+  LA+ G KE+ L G +  +Y   + +   + D   LLE +  I GIER+R  +  P 
Sbjct: 182 EVAGLADQGVKEVTLLGQNVNAYRGPMGDTAEIADFATLLEYVSDIPGIERIRYVTSHPN 241

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
            FT+ ++     L KL  H HL +Q G D  L  M R YTA EY+  +  LR    D+++
Sbjct: 242 EFTQSLIDAYARLPKLVNHLHLPVQHGSDRILMAMKRGYTAMEYKSTIRKLRAIRPDLAM 301

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           ++D IVGFPG            +  +    +  F YSPR GT A  + +      K  R 
Sbjct: 302 SSDFIVGFPGETEDDFNKMMKLIDDVGYDTSFSFIYSPRPGTPAAALHDDTPHEVKLRRL 361

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           + L      + +A +   +G V  +L E           G T     VN K    + G++
Sbjct: 362 QHLQATIDDSVRAISASRLGTVQRILVEGASRKDPTELMGRTECNRVVNFKGQPRLIGQM 421

Query: 416 LNVKINSFEGEVAEGEIV 433
           +++ I         GE++
Sbjct: 422 VDITITQATQRSLRGEVL 439


>MIAB_ALTMD RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 477

 Score =  184 bits (468), Expect = 1e-48
 Identities = 136/444 (30%), Positives = 214/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+SE M +      G+      E ADV ++NTCS+     +K    +
Sbjct: 4   KLYIKTWGCQMNEYDSEKMADLLDSTHGFSAAQSAEEADVILLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++  PE II V GC A Q   T       VD+V G +    +   +N+ +   K
Sbjct: 64  GRWKTLKQDKPELIIGVGGCVASQEGDTIRQRAPFVDLVFGPQTLHRLPEMINELKGGAK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K F+ L        T AF+ I +GC+++C +C++PYTRG   S+    V
Sbjct: 124 SVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCTFCVVPYTRGEEVSRPVDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA  G +E+ L G +  +Y G + D  +    +LLE +  IDGI+R+R  +  P
Sbjct: 182 LLEIAQLAGQGVREVNLLGQNVNAYRGENYDGTICRFSELLELVAAIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++    ++ +L  H HL +QSG D  L  M R +TA EY+  +  L+    ++S
Sbjct: 242 VEFTDDIIDAYASIPELVDHLHLPVQSGSDRILNLMKRGHTALEYKSKMRKLKKIRPNIS 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           +++D I+GFPG            ++ +    +  F YS R GT A +  + V    K +R
Sbjct: 302 LSSDFIIGFPGETDADFEATMDLIQAVDYDLSFSFIYSARPGTPAADAVDDVTEETKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
              L +  RI ++A   A   +G    +L E   +      +G T N   VN +   ++ 
Sbjct: 362 LHLLQQ--RITQQALRIARHMVGTEQRILVEGPSKKNPMELSGRTENNRVVNFEGTPDMI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G+ ++V I     NS  GEV   E
Sbjct: 420 GEFVDVNITDVFTNSLRGEVVRRE 443


>MIAB_SHESM RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  184 bits (467), Expect = 1e-48
 Identities = 135/447 (30%), Positives = 217/447 (48%), Gaps = 24/447 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + +  E AD+ ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLGEYQGYTLTEEAEEADILLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR    + +NP+ II V GC   +A  E   I+     VD++ G +    +   + + R 
Sbjct: 64  GRWKTLKDKNPDLIIGVGGC---VASQEGKAIKDRAHCVDIIFGPQTLHRLPDMIEQVRR 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
             K  + V      K F+ L        T AF+ I +GC+++C++C++PYTRG   S+  
Sbjct: 121 GEKAVIDVSFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPS 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGS 231
             ++ EI  LAE G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +
Sbjct: 179 DDIILEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICTFAELLRYVAAIDGIDRIRFTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  FT+D++       +L    HL +QSG D  L  M R + A EY+ I+  LR    
Sbjct: 239 SHPIEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTAMKRGHMAIEYKSIIRRLRKARP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+ I++D I+GFPG            ++ +A   +  F YS R GT A ++ + VD  +K
Sbjct: 299 DIQISSDFIIGFPGETKEDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVDMEEK 358

Query: 352 DERSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADC 409
            +R    I  +RI ++A  ++   +G V  +L E           G T N   VN +   
Sbjct: 359 KQR--LAILQDRITQQAMRYSRHMMGTVQRILVEGPSVKNPMELRGRTENNRVVNFEGLP 416

Query: 410 NVSGKILNVKI-----NSFEGEVAEGE 431
              G  ++V+I     NS  G+   GE
Sbjct: 417 KHIGSFVDVEIVDVYTNSLRGKFIRGE 443


>MIAB_RHOP2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 468

 Score =  184 bits (467), Expect = 1e-48
 Identities = 126/447 (28%), Positives = 214/447 (47%), Gaps = 16/447 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   + GC++N Y+++ M +    EG+      + AD+ ++NTC +     +K    +G
Sbjct: 6   KLHIKSYGCQMNVYDAQRMVDVLAPEGFVETASVDDADLVILNTCHIREKASEKVFSELG 65

Query: 62  RARRQNPEAI-------IAVVGCYAQIAPTEVSGIE-GVDVVLGSRNKGEIVYYVNKARD 113
           R R    EA        I V GC AQ    E+   +  VDVV+G ++   +   + +A  
Sbjct: 66  RLRLARDEASRDGRRMQIVVAGCVAQAEGDEIVRRQPAVDVVVGPQSYHHLPRLLAQAAQ 125

Query: 114 EGKQ-QVKVGAVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSK 171
            G+  + +     K       + E    +   AF+ +Q+GC++FC +C++PYTRG+  S+
Sbjct: 126 TGRALETEFPIADKFGFLPQPQPEAIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEVSR 185

Query: 172 DPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDE--KVTLVDLLEEIEKIDGIERVRI 229
               +L ++  LA+HG +E+ L G +  +Y  D  +    TL  LL+ +  + GI R+R 
Sbjct: 186 PVAAILADVERLADHGVRELTLIGQNVNAYHGDGPDGRPWTLGRLLQRLAAVPGIVRLRY 245

Query: 230 GSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDK 289
            +  P    +D++     L  L P  HL +QSG D  L  MNR++TA +Y  +++  R  
Sbjct: 246 STSHPNDVDDDLIAAHRDLDALMPFVHLPVQSGSDRILAAMNRKHTAADYRRVIDRFRAV 305

Query: 290 IEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGN 349
             +++ ++D IVGFPG            + +I  +  + FKYSPR GT            
Sbjct: 306 RPEIAFSSDFIVGFPGETDADFEATLALVTQIGYAGAYSFKYSPRPGTXXXXXXXXXXXX 365

Query: 350 KKDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVY--TGYTR--NYIKVNA 405
             DER ++L ++    + AF    IG  +DVLFE        +   T Y +  +      
Sbjct: 366 XXDERLERLQQVIDAQQSAFNRAAIGRTVDVLFERAGRKPGQIVGRTAYLQPAHVFPPAG 425

Query: 406 KADCNVSGKILNVKINSFEGEVAEGEI 432
            A  ++ G+IL V+++S E     GE+
Sbjct: 426 MAPDSLVGQILPVRVDSLERYSLLGEL 452


>MIAB_HELPH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  184 bits (467), Expect = 1e-48
 Identities = 133/434 (30%), Positives = 217/434 (50%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T+GC +N+ +SE +  +  +  Y+  +  ++AD+ ++NTCSV    ++K    I
Sbjct: 1   MKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKIADLILINTCSVREKPERKLFSEI 60

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K     ++ 
Sbjct: 61  GQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARNVSKISQVIHK-----EKA 115

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V+V        +   +  E   + R+ L I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 116 VEVAIDYDESAYA-FEFFEKKAQIRSLLNISIGCDKKCAYCIVPHTRGKEISIPMDLILK 174

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YGV       KV   DLL+++ +I GIER+R  S  P 
Sbjct: 175 EAEKLANNGTKELMLLGQNVNNYGVRFSSEHAKVDFSDLLDKLSEIQGIERIRFTSPHPL 234

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  + R     K+C   H+ LQSG  A LK M R Y+ + + + V  L+  + +V I
Sbjct: 235 HMNDGFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKEWFLNRVERLKALVPEVGI 294

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 295 STDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEVSYSRL 354

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+ + +  G+     T  +I+V  K  
Sbjct: 355 ERLQNRHKEILEEKAKLE--VGKTHVVLVENRREMDNQI-VGFEGRSDTGKFIEVTCKEK 411

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 412 RN-PGELVKVEIIS 424


>MIAB_STRGG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 506

 Score =  184 bits (466), Expect = 2e-48
 Identities = 124/400 (31%), Positives = 191/400 (47%), Gaps = 16/400 (4%)

Query: 7   TLGCRVNTYESEAMTEKFVREGY----EVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
           T GC++N ++SE ++      GY    E  D +  ADV V NTC+V    D K    +GR
Sbjct: 20  TYGCQMNVHDSERLSGLLEGAGYVRAPEGSDGD--ADVVVFNTCAVRENADNKLYGNLGR 77

Query: 63  A---RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
               + + P   IAV GC AQ    T V     VDVV G+ N G++   + +AR + + Q
Sbjct: 78  LAPMKTKRPGMQIAVGGCLAQKDRDTIVKRAPWVDVVFGTHNIGKLPVLLERARVQEEAQ 137

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           +++   L+   F         +   A++ I  GCN  C +C++P  RG    +    +L 
Sbjct: 138 IEIAESLE--AFPSTLPTRRESAYAAWVSISVGCNNTCTFCIVPALRGKEKDRRTGDILA 195

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFT 238
           EI +L   G  EI L G +  +YG D+ ++     LL    +I+G+ERVR  S  P  FT
Sbjct: 196 EIEALVAEGVCEITLLGQNVNAYGSDIGDREAFSKLLRACGRIEGLERVRFTSPHPRDFT 255

Query: 239 EDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTD 298
           +DV+  +     + P  H+ +QSG D  LK M R Y  + +  I+  +R  + + +I+TD
Sbjct: 256 DDVIAAMAETPNVMPQLHMPMQSGSDTVLKAMRRSYRQERFLGIIEKVRAAMPEAAISTD 315

Query: 299 VIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKL 358
           +IVGFPG            ++    +    F+YS R GT A +M+ Q+      ER  +L
Sbjct: 316 IIVGFPGETEEDFEQTMHAVREARFANAFTFQYSKRPGTPAADMDGQIPKEVVQERYMRL 375

Query: 359 IELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTR 398
             L         +K +G  +DV+  E    G G   G T+
Sbjct: 376 SALQEQISWDENKKQVGRTLDVMVAE----GEGRKDGATQ 411


>MIAB_HELAH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  184 bits (466), Expect = 2e-48
 Identities = 134/434 (30%), Positives = 215/434 (49%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           +KV   T+GC +N+ +SE +  +  +  Y+  +  ++AD+ ++NTCSV    ++K    I
Sbjct: 2   LKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKIADLILINTCSVREKPERKLFSEI 61

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K   E   +
Sbjct: 62  GQFAKIKKPNAKIGVCGCTASHMGADILKKSPSVSFVLGARNVSKISQVIHK---EKAVE 118

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V +     +  FE     E   + R+ L I  GC++ C YC++P+TRG   S     +L 
Sbjct: 119 VAIDYDESSYAFEFF---EKKAEVRSLLNISIGCDKKCTYCIVPHTRGKEISIPMDLILK 175

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YGV       KV   DLL+++ +I GIER+R  S  P 
Sbjct: 176 EAEKLANNGTKELMLLGQNVNNYGVRFSSEHAKVNFSDLLDKLSEIPGIERIRFTSPHPL 235

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              ++ + R     K+C   H+ LQSG  A LK M R Y  + + + V  L+  + +V I
Sbjct: 236 HMNDEFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYNKEWFLNRVEKLKALVPEVGI 295

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 296 STDIIVGFPNESDKDFEDTMEVLEKVCFDTLYSFIYSPRPFTEAGAWKERVPLEVSSLRL 355

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+  G   G+     T  +I+V  K  
Sbjct: 356 ERLQNRHKEILEEKARLE--VGKTHVVLVENRHEV-DGQIVGFEGRSDTGKFIEVTCKEK 412

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 413 RN-PGELVEVEIIS 425


>MIAB_AERS4 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 477

 Score =  184 bits (466), Expect = 2e-48
 Identities = 131/442 (29%), Positives = 205/442 (46%), Gaps = 14/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY + +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDASNGYTLTEEPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR ++     P  +I V GC A      + S    VD+V G +    +   + + ++   
Sbjct: 64  GRWKKLKANKPGLVIGVGGCVASQEGENIRSRAPYVDIVFGPQTLHRLPAMIKQVQEGRG 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV + A  + + F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AQVDI-AFPEIEKFDSLPEPRAEGAT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPMDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LYEIAQLAEQGVREVNLLGQNVNAYRGPTFDGSICSFAELLRLVAAIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       ++    HL +QSG D  L  M R +T  EY+  +  LR    D++
Sbjct: 242 IEFTDDIIEVYKDTPEVVSFLHLPVQSGSDRILTMMKRPHTVLEYKSKIRRLRAARPDIT 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFP             ++ I    +  F YSPR GT A +M + VD   K  R
Sbjct: 302 ISSDFIVGFPNETDEDFEATMKLIEEINFDMSFSFIYSPRPGTPAADMPDDVDMEVKKVR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG- 413
             +L  +            +G    +L E    L      G T N   VN +    + G 
Sbjct: 362 LARLQHVINNQSMQIGRAMLGSTQRILVEGPSRLDPMQLCGRTENNRVVNFEGAHTLIGG 421

Query: 414 ----KILNVKINSFEGEVAEGE 431
               +I  V+ NS  G    GE
Sbjct: 422 FADVEITEVRPNSLRGRFIRGE 443


>MIAB_SHEDO RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  183 bits (465), Expect = 2e-48
 Identities = 132/444 (29%), Positives = 217/444 (48%), Gaps = 18/444 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVR-EGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +GY + D    ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDEYQGYTLTDDATEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + P  II V GC A      +    + VD++ G +    +   +++ +   K
Sbjct: 64  GRWKTLKDKKPGLIIGVGGCVASQEGKAIKDRAQCVDIIFGPQTLHRLPEMIDQVQRGEK 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + V      K F+ L     +  T AF+ I +GC+++C++C++PYTRG   S+    +
Sbjct: 124 VVIDVSFPEIEK-FDRLPEPRADGPT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPQDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           + EI  LAE G +E+ L G +  +Y G   D+++ T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 ILEIAQLAEQGVREVNLLGQNVNAYRGATHDDQICTFAELLRLVASIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L +M R + A EY+ I+  LR   E + 
Sbjct: 242 IEFTQDIIDVYEDTPELVSFLHLPVQSGSDRILTQMKRGHMAIEYKSIIRRLRKAREGIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            ++ +A   +  F YS R GT A ++ + V   +K +R
Sbjct: 302 ISSDFIIGFPGESAEDFADTMKLIEDVAFDHSFSFIYSARPGTPAADLPDDVSDEEKKQR 361

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVS 412
               I  +RI ++A  ++ + +G V  +L E           G T N   VN +A     
Sbjct: 362 --LAILQDRITQQAMRYSRQMLGTVQRILVEGPSVKNPMELRGRTENNRVVNFEAPHTHI 419

Query: 413 GKILNVKI-----NSFEGEVAEGE 431
           G  ++V+I     NS  G    GE
Sbjct: 420 GSFVDVEIVDVYTNSLRGIFIRGE 443


>MIAB_RALME RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  183 bits (465), Expect = 2e-48
 Identities = 135/449 (30%), Positives = 208/449 (46%), Gaps = 19/449 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +G E  D  E ADV + NTCS+     +K    +
Sbjct: 3   KVFVKTYGCQMNEYDSDKMVDVLNATQGMEPTDNVEDADVILFNTCSIREKAQEKVFSEL 62

Query: 61  GRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ +I V GC A Q   + VS    VDVV G +    +   +N+ +  G 
Sbjct: 63  GRMKALKAAKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGPQTLHRLPDLINRRQQTGL 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L     +  + AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 123 SQVDISFPEIEK-FDHLPPARVDGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y   +     + D   L+E +  I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYRGAMGGTSEIADFALLIEYVADIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT  ++       KL  H HL +Q   D  L  M R Y+  EY+ I+  LR    D+
Sbjct: 241 PKEFTSRLIELYGRCDKLVNHLHLPVQHASDRVLAGMKRGYSVLEYKSIIRRLRALRPDM 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D IVGFPG            +  I    +  F +SPR GT A N+ +      K  
Sbjct: 301 SMSSDFIVGFPGETDADFDKLMAMVHEIGYDTSFSFIFSPRPGTPAANLHDDTPHEVKLR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN--------A 405
           R + L      N +  ++  +G V  +L E           G T N   VN        A
Sbjct: 361 RLQLLQATIEENVQRISQSMVGTVQRILVEGPARKDPTELHGRTENNRVVNFALPGVPQA 420

Query: 406 KADCNVSGKILNVKINSFEGEVAEGEIVL 434
           + D  + G++++V +         GE V+
Sbjct: 421 QRD-RMIGQMVDVNVTQAFPHSLRGEFVV 448


>MIAB_RALEJ RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 450

 Score =  183 bits (465), Expect = 2e-48
 Identities = 137/449 (30%), Positives = 209/449 (46%), Gaps = 19/449 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           KV   T GC++N Y+S+ M +     +G E  D  E ADV + NTCSV     +K    +
Sbjct: 3   KVFVKTYGCQMNEYDSDKMVDVLNASQGLEPTDNVEDADVILFNTCSVREKAQEKVFSEL 62

Query: 61  GRARRQN---PEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +      P+ +I V GC A Q   + VS    VDVV G +    +   + + +  G+
Sbjct: 63  GRMKALKAVKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGPQTLHRLPDLIARRQRTGQ 122

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L        + AF+ I +GC+++C+YC++PYTRG   S+  + V
Sbjct: 123 SQVDISFPEIEK-FDHLPPARVEGPS-AFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDV 180

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L E+  LAE G +E+ L G +  +Y   +     + D   L+E + +I GIER+R  +  
Sbjct: 181 LAEVAGLAEQGVREVTLLGQNVNAYRGAMGGTSEIADFALLIEYVAEIPGIERIRYTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  FT  +V       KL  H HL +Q   D  L  M R Y+  EY+ I+  LR    D+
Sbjct: 241 PKEFTSRLVELYGRCDKLVNHLHLPVQHASDRVLMAMKRGYSVLEYKSIIRRLRMLRPDM 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D IVGFPG            ++ +    +  F +SPR GT A N+ +      K  
Sbjct: 301 SMSSDFIVGFPGETDADFDKLMALIEEVGYDTSFSFIFSPRPGTPAANLHDDTPHEVKLR 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVN--------A 405
           R + L      N +  +   +G V  +L E           G T N   VN        A
Sbjct: 361 RLQHLQATIEENVQRISRNMVGSVQRILVEGPSRKDPTELHGRTENNRVVNFALPGVPQA 420

Query: 406 KADCNVSGKILNVKINSFEGEVAEGEIVL 434
           + D  + G++++V I         GEIV+
Sbjct: 421 QRD-RMIGQMVDVSITQAFPHSLRGEIVV 448


>MIAB_BUCAI RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  183 bits (465), Expect = 2e-48
 Identities = 130/435 (29%), Positives = 203/435 (46%), Gaps = 13/435 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREG-YEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR--- 62
           T GC++N Y+S  +     +   Y +    E AD+ ++NTCS+     +K    +GR   
Sbjct: 8   TWGCQMNEYDSSMIITLLEKNNQYSLTKSAENADILILNTCSIREKAQEKVFHQLGRWXX 67

Query: 63  ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKV 121
                     AV GC A     E+      VD++ G++    +   +++   + K  + +
Sbjct: 68  XXXXXXXXXXAVGGCVATQEGKEIFKRANYVDIIFGTQTLHRLPKMIDEVEKKRKLSIDI 127

Query: 122 G--AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDE 179
               + K K F   K + Y     A + I +GCN++C++C++PYTRG+  S+    VL E
Sbjct: 128 SFPKLEKFKYFLAPKKKGYT----ADISIMEGCNKYCSFCVVPYTRGNEISRPCDDVLFE 183

Query: 180 IRSLAEHGFKEIILSGIHTASY-GVDLDEKVTLV-DLLEEIEKIDGIERVRIGSIDPTFF 237
           I  LA+ G KEI L G +  +Y G   + KV    +L+  + +IDGIER+R  + +P  F
Sbjct: 184 ISLLAKQGIKEINLLGQNVNAYQGPTFNGKVCYFSELIRLVAEIDGIERIRFTTSNPLEF 243

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
           T+D++       KL    HL +QSG +  L  M R YT ++Y  I+  L     D+ I++
Sbjct: 244 TDDIIEVYKDTPKLVSFLHLPVQSGSNKILNLMKRSYTTEDYTSIIKKLTIARPDIQISS 303

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
           D IVGFPG            +K I    +  F YS R GT A NM + +D  +K  R   
Sbjct: 304 DFIVGFPGESEIDFEKTIEFIKNINFDMSFSFIYSARPGTPASNMNDDLDLKEKKRRLYI 363

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILN 417
           L E   I    ++ K  G +  VL E   +       G T N   V  +    + G+ +N
Sbjct: 364 LQERINIQTMLWSRKMFGSIQSVLVEGVSDKNIMDLYGRTENNRVVTFQGSSKMIGQFVN 423

Query: 418 VKINSFEGEVAEGEI 432
           VKI        +GE+
Sbjct: 424 VKIKKVHTHSLKGEL 438


>MIAB_ACIC1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 497

 Score =  183 bits (465), Expect = 2e-48
 Identities = 122/384 (31%), Positives = 184/384 (47%), Gaps = 10/384 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE +       GY     +E ADV V NTC+V    D +    +G     
Sbjct: 32  TFGCQMNMHDSERIAGLLEAAGYVRAADDEPADVVVFNTCAVRENADNRLYGNLGLLLPV 91

Query: 64  RRQNPEAIIAVVGCYAQIAPTE-VSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P+  IAV GC AQ    + V     VDVV G+ N   +   + +AR   + QV++ 
Sbjct: 92  KKAKPDMQIAVGGCLAQKDKGDIVRRAPWVDVVFGTHNIEALPVLLERARIAREAQVEIR 151

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+  VF         +   A++ I  GCN  C +C++P  RG    + P  +L EI++
Sbjct: 152 EALE--VFPSTLPSRRESVYAAWVAISVGCNNTCTFCIVPSLRGRERDRRPGDILREIQT 209

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L   G  E+ L G +  SYGVD  ++     LL     IDG+ERVR  S  P  FT+DV+
Sbjct: 210 LVADGVLEVTLLGQNVNSYGVDFGDRQAFAKLLRACGTIDGLERVRFTSPHPRDFTDDVI 269

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG DA L+RM R Y  ++Y DI++ +R             VG
Sbjct: 270 AAMAETPNVMPQLHMPLQSGSDAVLRRMRRSYRKEKYLDIISRVRSXXXXXXXXXXXXVG 329

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            +++   +    F+YS R GT A  M +QV  +   +R  +L+ L 
Sbjct: 330 FPGETEDDFAETLDVVRKARFAGAFTFQYSKRPGTPAAEMPDQVPPDVVADRFARLVAL- 388

Query: 363 RINEKAFAEK--YIGEVIDVLFEE 384
            + + A  E    +G V++VL  E
Sbjct: 389 -VEQIALEENQAQVGRVVEVLVAE 411


>RIMO_ALKMQ RecName: Full=Ribosomal protein S12
           methylthiotransferase rimO;         Short=S12
           methylthiotransferase;         Short=S12 MTTase;
          Length = 446

 Score =  183 bits (464), Expect = 3e-48
 Identities = 114/390 (29%), Positives = 201/390 (51%), Gaps = 7/390 (1%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKS-RQI 59
           + V   +LGC  N  ++E M     + GY++ +    ADV +VNTC       ++S  +I
Sbjct: 3   LSVYVESLGCSKNLIDAEVMLGILNQYGYKLTNNEVKADVIIVNTCGFIEAAKEESINKI 62

Query: 60  IGRARRQNPEAIIAVV-GCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
           I   +         +V GC  +    ++   +  VD ++G+    EIV  +++   +G++
Sbjct: 63  IELGQXXXXXXXXXIVAGCLGERYQKDLLEELPEVDAIVGTGGYHEIVKVIHQTM-KGQR 121

Query: 118 QVKVGAVLKNKVFED-LKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            V++G +  N+ +++ L   +      A++KI DGC+ +C YC+IP  RG   S+  + +
Sbjct: 122 IVEIGDI--NRPYDETLPRIQTTASHSAYIKISDGCDNYCTYCIIPKLRGKYRSRKMENI 179

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           + E ++LA +G KEIIL    T  YG+DL ++  L  LL+++ +++GI+ +RI    P  
Sbjct: 180 IQEAQTLANNGVKEIILIAQDTTRYGIDLYDEYRLSALLDKLSEVEGIQWIRILYCYPEM 239

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
            T++++  I    K+C +  + +Q      LK MNRR + +E   ++  L+  + ++ I 
Sbjct: 240 ITDELIATIKNNDKVCKYIDIPIQHCSTKILKLMNRRTSKEEIVSLIEKLKKNVPNIVIR 299

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           T +IVGFPG            ++ I   +  +F YS  +GT A  +  QV    K+ R K
Sbjct: 300 TSIIVGFPGESEEDFNELKAFIEDIKFDRLGVFTYSQEEGTPAAQLAEQVPSELKESRQK 359

Query: 357 KLIELNRINEKAFAEKYIGEVIDVLFEEEV 386
            L+EL +         YIG+ I+VL EEE+
Sbjct: 360 ILMELQQRISLNKNRLYIGQSIEVLIEEEI 389


>MIAB_VIBCH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  183 bits (464), Expect = 3e-48
 Identities = 132/445 (29%), Positives = 209/445 (46%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLLIKTWGCQMNEYDSSKMADLLNAANGYELTEIPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR    + + P  +I V GC   +A  E   I      VDV+ G +    +   + +++ 
Sbjct: 64  GRWKTLKDKKPGVVIGVGGC---VATQEGDSIRDRAPYVDVIFGPQTLHRLPEMIKQSQT 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
                + +      K F+ L        T AF+ I +GC+++C YC++PYTRG   S+  
Sbjct: 121 SDAPVMDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCTYCVVPYTRGEEVSRPM 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGS 231
             VL EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +
Sbjct: 179 DDVLFEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICSFAELLRLVATIDGIDRIRFTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    
Sbjct: 239 SHPLEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRPHTAIEYKSIIRKLRKARP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+ I++D IVGFPG            ++ +    +  F +SPR GT A +    +    K
Sbjct: 299 DIQISSDFIVGFPGETDKDFQDTMKLIRDVDFDMSFSFIFSPRPGTPAADYPCDLSEEVK 358

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ER  +L +        ++   +G    +L E   +       G T N   VN +   ++
Sbjct: 359 KERLYELQQQINSQAMRYSRLMLGTEQRILVEGPSKKDLMELRGRTENNRVVNFEGSPDL 418

Query: 412 SGKILNVKI-----NSFEGEVAEGE 431
            G+ ++VKI     NS  GE+   E
Sbjct: 419 IGQFVDVKIVDVFPNSLRGELLRTE 443


>MIAB_VIBC3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  183 bits (464), Expect = 3e-48
 Identities = 132/445 (29%), Positives = 209/445 (46%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLLIKTWGCQMNEYDSSKMADLLNAANGYELTEIPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR    + + P  +I V GC   +A  E   I      VDV+ G +    +   + +++ 
Sbjct: 64  GRWKTLKDKKPGVVIGVGGC---VATQEGDSIRDRAPYVDVIFGPQTLHRLPEMIKQSQT 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
                + +      K F+ L        T AF+ I +GC+++C YC++PYTRG   S+  
Sbjct: 121 SDAPVMDISFPEIEK-FDRLPEPRAEGPT-AFVSIMEGCSKYCTYCVVPYTRGEEVSRPM 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGS 231
             VL EI  LAE G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +
Sbjct: 179 DDVLFEIAQLAEQGVREVNLLGQNVNAYRGATHDGGICSFAELLRLVATIDGIDRIRFTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    
Sbjct: 239 SHPLEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRPHTAIEYKSIIRKLRKARP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
           D+ I++D IVGFPG            ++ +    +  F +SPR GT A +    +    K
Sbjct: 299 DIQISSDFIVGFPGETDKDFQDTMKLIRDVDFDMSFSFIFSPRPGTPAADYPCDLSEEVK 358

Query: 352 DERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ER  +L +        ++   +G    +L E   +       G T N   VN +   ++
Sbjct: 359 KERLYELQQQINSQAMRYSRLMLGTEQRILVEGPSKKDLMELRGRTENNRVVNFEGSPDL 418

Query: 412 SGKILNVKI-----NSFEGEVAEGE 431
            G+ ++VKI     NS  GE+   E
Sbjct: 419 IGQFVDVKIVDVFPNSLRGELLRTE 443


>MIAB_HELPY RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  183 bits (464), Expect = 3e-48
 Identities = 132/434 (30%), Positives = 215/434 (49%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T+GC +N+ +SE +  +  +  Y+  +  + AD+ ++NTCSV    ++K    I
Sbjct: 1   MKVYIETMGCAMNSRDSEHLLSELSKLDYKETNDPKTADLILINTCSVREKPERKLFSEI 60

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K     ++ 
Sbjct: 61  GQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARNVSKISQVIHK-----EKA 115

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V+V        +   +  E   + R+ L I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 116 VEVAIDYDESAYA-FEFFEKKAQIRSLLNISIGCDKKCAYCIVPHTRGKEISIPMDLILK 174

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YG        KV   DLL+++ +I GIER+R  S  P 
Sbjct: 175 EAEKLANNGTKELMLLGQNVNNYGARFSSEHAKVDFSDLLDKLSEIQGIERIRFTSPHPL 234

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  + R     K+C   H+ LQSG  A LK M R Y+ + + + V  L+  + +V I
Sbjct: 235 HMNDGFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKEWFLNRVERLKALVPEVGI 294

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 295 STDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEVSSSRL 354

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+ + +  G+     T  +I+V  K  
Sbjct: 355 ERLQNRHKEILEEKAKLE--VGKTHVVLVENRREMDNQI-VGFEGRSDTGKFIEVTCKEK 411

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 412 RN-PGELVKVEIIS 424


>MIAB_ARTS2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 522

 Score =  183 bits (464), Expect = 3e-48
 Identities = 121/380 (31%), Positives = 192/380 (50%), Gaps = 9/380 (2%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE M       GY V    E ADV V NTC+V    D K    +G     
Sbjct: 34  TFGCQMNVHDSERMAGMLEDAGY-VPASGENADVVVFNTCAVRENADNKLYGNLGMLAPV 92

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +  NP   IAV GC AQ    T +     VD V G+ N G +   +++AR   + Q+++ 
Sbjct: 93  KAANPGMQIAVGGCLAQKDRETILKKAPWVDAVFGTHNVGALPALLDRARHNNEAQLEIL 152

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L   VF      + ++    ++ I  GCN  C +C++P  RG    + P  +L EI++
Sbjct: 153 ESLD--VFPSTLPTKRDSVYSGWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIQA 210

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL    +I G+ERVR  S  P  FT+DV+
Sbjct: 211 LVDDGAIEVTLLGQNVNSYGVEFGDRQAFSKLLRACGEIQGLERVRFTSPHPAAFTDDVI 270

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  LK M R Y + ++  I++ +R++I   +I+TD+IVG
Sbjct: 271 DAMAETPNVMPQLHMPLQSGSDKVLKDMKRSYRSTKFLGILDKVRERIPHAAISTDIIVG 330

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL- 361
           FPG            +++   +    F+YS R GT A ++ +Q+      ER ++L  L 
Sbjct: 331 FPGETEEDFQATLDVVEKSRFATAFTFQYSKRPGTPAADLPDQLPKAVVQERFERLTALQ 390

Query: 362 NRINEKAFAEKYIGEVIDVL 381
           +RI  +  A + +G  ++V+
Sbjct: 391 DRIAAEENA-RQLGRRVEVM 409


>MIAB_VIBPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  182 bits (463), Expect = 4e-48
 Identities = 127/439 (28%), Positives = 203/439 (46%), Gaps = 9/439 (2%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GYE+ +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLLIKTWGCQMNEYDSSKMADLLNAANGYELTEEPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GR---ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    + + P  +I V GC A      +      VDV+ G +    +   + +++ +  
Sbjct: 64  GRWKTLKDKKPGVVIGVGGCVATQEGDHIRERAPYVDVIFGPQTLHRLPEMIKQSQTDDA 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             + +      K F+ L        T AF+ I +GC+++C YC++PYTRG   S+    V
Sbjct: 124 PVMDISFPEIEK-FDRLPEPRAEGAT-AFVSIMEGCSKYCTYCVVPYTRGEEVSRPMDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLD--EKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LAE G +E+ L G +  +Y   +   E  +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEIAQLAEQGVREVNLLGQNVNAYRGPMHDGEICSFAELLRLVASIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       +L    HL +QSG D  L  M R +TA EY+ I+  LR    D+ 
Sbjct: 242 LEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTMMKRPHTAIEYKSIIRKLRKARPDIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFPG            +K +    +  F +SPR GT A +    +    K ER
Sbjct: 302 ISSDFIVGFPGETDKDFQDTMKLIKDVDFDMSFSFIFSPRPGTPAADYPCDIPEQVKKER 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGK 414
             +L +        ++   +     VL E   +         T N   VN +   ++ G+
Sbjct: 362 LYELQQTINAQAMRYSRLMLATEQRVLVEGPSKKNLMELRARTENNRVVNFEGSADLIGQ 421

Query: 415 ILNVKINSFEGEVAEGEIV 433
            ++VKI         GE+V
Sbjct: 422 FVDVKITDVFANSLRGELV 440


>MIAB_SACD2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 454

 Score =  182 bits (463), Expect = 4e-48
 Identities = 133/448 (29%), Positives = 216/448 (48%), Gaps = 24/448 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVV--DFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  +   +++V  D  E ADV +VNTCS+     +K    
Sbjct: 12  KLYIQTHGCQMNEYDSSRMRD-LLGASHDMVPTDNPEEADVLLVNTCSIREKAQEKLFHQ 70

Query: 60  IGR---ARRQNPEAIIAVVGCYAQIAPTEVSG-IEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR    +   P+ +I V GC A      +S     VD++ G +    +   +   R+ G
Sbjct: 71  LGRWKHLKEAKPDLVIGVGGCVASQEGDAISKRAPFVDLIFGPQTLHRLPEMIETPRENG 130

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
              V +      K F++L   E +  T AF+ + +GC+++C +C++PYTRG   S+    
Sbjct: 131 AVVVDISFPEIEK-FDNLPEPEADGAT-AFVSVMEGCSKYCTFCVVPYTRGEEVSRPAVD 188

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDP 234
           VL E+  LA  G +E+ L G +  +Y  D   E + L +L+  +  IDGI+R+R  +  P
Sbjct: 189 VLREVTHLASQGVREVNLLGQNVNAYRDDSSGEVIDLAELIAAVADIDGIDRIRFTTSHP 248

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FTE +++    + +L  H HL +QSG D  L  M R +T  EY+  +  +R    D+S
Sbjct: 249 MEFTESLIQAYAEIPELVSHLHLPVQSGSDRILSAMKRGHTCLEYKSKLRKIRALRPDIS 308

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
            ++D I+GFPG            ++ I    +  F YSPR GT A ++ +      K +R
Sbjct: 309 FSSDFIIGFPGETEADFAATMKLIEDIGFDNSFSFIYSPRPGTPAADLPDDTPEQVKKDR 368

Query: 355 SKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCN-- 410
            K  I   RI ++A   + + +G    VL     +   G  +G T N   VN +  CN  
Sbjct: 369 LK--ILQTRIIQQAQEISRRMVGNTERVLVTGYSKKDPGQLSGRTENNRVVNFR--CNQP 424

Query: 411 -VSGKILNVKI-----NSFEGEVAEGEI 432
            + GK  ++ I     NS  G +   E+
Sbjct: 425 ELIGKFADILIEEALPNSLRGVLLGSEL 452


>MIAB_PROM9 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 463

 Score =  182 bits (463), Expect = 4e-48
 Identities = 133/445 (29%), Positives = 209/445 (46%), Gaps = 26/445 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR-ARR 65
           T GC++N  +SE M     + GY   D    AD+ + NTC++ +  + K    +GR A+R
Sbjct: 25  TFGCQMNKADSERMAGTLEKMGYTRADDELNADLVLYNTCTIRDNAEHKVYSFLGRQAKR 84

Query: 66  QN--PEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           ++  P   + V GC AQ    + +  +  +D+V+G ++   +   + K  D G Q   V 
Sbjct: 85  KHKIPSLKLVVAGCLAQQEGESLLRRVPELDLVMGPQHVNNLENLLGKV-DLGNQ---VA 140

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
           A  +  + ED+      +    ++ I  GCN  C+YC++P  RG   S+ P  +  EI+ 
Sbjct: 141 ATEETFISEDITNARRESSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPNAIKSEIQK 200

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA+  FKEI L G +  +YG DL        ++ TL DLL  I  I+GI R+R  +  P 
Sbjct: 201 LADDNFKEITLLGQNIDAYGRDLPGTTKEGRKENTLTDLLYYIHDINGISRIRFATSHPR 260

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +F++ +++    L K+C HFH+  QSG D  LK+M+R              R  + D SI
Sbjct: 261 YFSKRLIQACYELDKVCEHFHIPFQSGNDEILKQMSRGXXXXXXXXXXXXXRSLMPDASI 320

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           T D IV FPG            +  I   + +   YSPR  T A    NQ+    ++ + 
Sbjct: 321 TADAIVAFPGETEQQYQDTLKLISDIGFDQVNTAAYSPRPNTPAAVWSNQL---SEEVKK 377

Query: 356 KKLIELNRINEKAFA---EKYIGEVIDVLFEEEVELGSGVYTGYTR----NYIKVNAKAD 408
            +L E+N + EK      ++YI  +  VL E      S    G TR     ++K+     
Sbjct: 378 TRLQEINALVEKTARNRNQRYINNIESVLIEGLNPKNSSQIMGRTRTNRLTFVKIPKNIQ 437

Query: 409 CNVS-GKILNVKINSFEGEVAEGEI 432
            N S G  ++V+IN        GE+
Sbjct: 438 FNFSLGDEIDVRINEARPFSLTGEL 462


>MIAB_PELUB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  182 bits (463), Expect = 4e-48
 Identities = 124/439 (28%), Positives = 224/439 (51%), Gaps = 14/439 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG 61
           K+   T GC++N Y+S  + +   + G+E  +  E A+ Y++NTC + +   +K    IG
Sbjct: 4   KIFIKTFGCQMNEYDSNRIFDTVKKIGFEKTEKYEDANCYLLNTCHIRDKAKEKVYHEIG 63

Query: 62  RAR---RQNPEAIIAVVGCYAQIAPTEVSGIEG-VDVVLGSRNKGEIVYYVNKARDEGKQ 117
           R +   R+  + I+ V GC AQ    E+   E  +D+V+G ++  +I   +         
Sbjct: 64  RVKKIFREKKKPIVVVAGCVAQAENQEMLKREPYIDIVIGPQSYHKINEAILNHLXXXXX 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
                    +K     +I+  ++K  +FL IQ+GC++FC +C++PYTRG   S+   +++
Sbjct: 124 XXXXXFDTISKFNYLSQIKNKDSKVSSFLTIQEGCDKFCHFCVVPYTRGPEYSRPFDQII 183

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLD-EKVTLVDLLEEIEKIDGIERVRIGSIDPTF 236
           +E + L + G KEIIL G +  +Y  D + +K  L DLL +++  D +ER+R  +  P  
Sbjct: 184 NEAKELVQSGAKEIILLGQNVNAYSYDEEGKKYRLSDLLIKLDSFDKLERIRYTTSHPKD 243

Query: 237 FTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSIT 296
            T+D++       KL P  HL +QSG +  L  MNR++T +EY  +   LR     +  +
Sbjct: 244 MTDDLINVYKTSSKLMPLVHLPVQSGSNKILNLMNRKHTIEEYLLVYEKLRKINPKIEFS 303

Query: 297 TDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSK 356
           +D I+G+P             ++++    ++ F +SPR GT A N+   VD  KK ++  
Sbjct: 304 SDFIIGYPEEDEQDFKMTMELIEKVKFINSYSFIFSPRPGTVAANL-TLVD-QKKSKQRL 361

Query: 357 KLIELNRINEKAFAEKYI-GEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKI 415
           ++I+    N +    K +  ++++VL E +++ G  ++ G T     V    +    GK+
Sbjct: 362 EIIQEKLFNNQIKKNKSLENKILNVLVENKMKDGIKLF-GRTEYMTSVIFDGNIENIGKL 420

Query: 416 LNVKI-----NSFEGEVAE 429
           + V+I     NS  G++ E
Sbjct: 421 VQVEIISSNQNSLFGKLTE 439


>MIAB_ERWT9 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 474

 Score =  182 bits (463), Expect = 4e-48
 Identities = 133/445 (29%), Positives = 214/445 (48%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY + +  E ADV ++NTCS+     +K   ++
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLNSTHGYTLTEQAEDADVLLLNTCSIREKAQEKVFALL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR ++    NP+ II V GC A     ++      VD+V G +    +   +N  R    
Sbjct: 64  GRWKKLKESNPDMIIGVGGCVASQEGAQIRQRASCVDIVFGPQTLHRLPEMINSVRGTRS 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
             V V      K   D   E   +   AF+ I +GCN++C +C++PYTRG   S+    +
Sbjct: 124 PVVDVSFPEIEKF--DRMPEPRADGPTAFVSIMEGCNKYCTFCVVPYTRGEEVSRPSDDI 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L E+  LA  G +E+ L G +  +Y G   D  + +  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LFEVAQLAAQGVREVNLLGQNVNAYRGETFDGGICSFAELLRLVAAIDGIDRIRFTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             F +D++       +L    HL +QSG D  L  M R +TA EY+ I+  L     ++ 
Sbjct: 242 IEFNDDIIDVYRDTPELVSFLHLPVQSGADRILTLMKRAHTALEYKAIIRKLLAARPNIQ 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D I+GFPG            +  I    ++ F YS R GT A ++ + V    +DE+
Sbjct: 302 ISSDFIIGFPGETQADFEQTMKLIGEINFDISYSFIYSARPGTPAADLPDDV---SEDEK 358

Query: 355 SKKLIEL-NRINEK--AFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
            ++L  L +RIN++  A++ + +G V  +L E          +G T     VN +     
Sbjct: 359 KQRLYILQDRINQQTTAWSRRKLGTVQRILVEGTSRKNVMELSGRTECNRVVNFEGSPEH 418

Query: 412 SGKILNVKI-----NSFEGEVAEGE 431
            GK ++V+I     NS  G +  GE
Sbjct: 419 IGKFVDVEITDVYANSLRGMLLRGE 443


>MIAB_COXBU RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  182 bits (463), Expect = 4e-48
 Identities = 137/441 (31%), Positives = 210/441 (47%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTE--KFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  KF   G E+ +   +ADV+++NTCSV      K    
Sbjct: 3   KLYLKTHGCQMNEYDSAKMADVLKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSE 61

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  +I V GC A Q   T +     VD+V G +    +   ++    + 
Sbjct: 62  LGRWRPFKEKRPHVVIGVGGCVASQEGETILKQAPFVDIVFGPQTLHRLPDLLDSVIQKR 121

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K  V +      K F+ L        + AF+ I +GC+++C +C++PYTRG   S+    
Sbjct: 122 KSVVDITFPEIEK-FDRLPQPRAEGPS-AFVSIMEGCSKYCTFCVVPYTRGEEISRPFDD 179

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSID 233
           V+ E+ SL E G +EI L G +   Y G+  D +V  L  L+  +  +D IER+R  +  
Sbjct: 180 VIAEVASLCEQGVREITLLGQNVNDYRGLMHDGQVADLALLIHYLAAMDNIERIRFTTSH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P+ F+E+++       KL  H HL +QSG D  L  M R YT  EY+  +  LR    D+
Sbjct: 240 PSAFSENLIDAYAEEPKLANHLHLPVQSGSDRILAAMKRNYTVLEYKSKIRKLRAVRPDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D I+GFPG            +  +    +  F YSPR GT A  + + V    K E
Sbjct: 300 SLSSDFIIGFPGETDADFEATMNLIHDMGFDHSFSFIYSPRPGTPAAQLPDDVPMAVKKE 359

Query: 354 RSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           R    I  NRIN KA   ++  +G    +L     +      +G T N   VN   D  +
Sbjct: 360 R--LAILQNRINAKAAEISQSMVGTQQRILVTGPSKKYPDQLSGRTENNRVVNFNGDTPL 417

Query: 412 SGKILNVKINSFEGEVAEGEI 432
            G+++ +KI         GEI
Sbjct: 418 IGQMVTIKIKEARPYSLWGEI 438


>MIAB_COXBR RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  182 bits (463), Expect = 4e-48
 Identities = 137/441 (31%), Positives = 210/441 (47%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTE--KFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  KF   G E+ +   +ADV+++NTCSV      K    
Sbjct: 3   KLYLKTHGCQMNEYDSAKMADVLKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSE 61

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  +I V GC A Q   T +     VD+V G +    +   ++    + 
Sbjct: 62  LGRWRPFKEKRPHVVIGVGGCVASQEGETILKQAPFVDIVFGPQTLHRLPDLLDSVIQKR 121

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K  V +      K F+ L        + AF+ I +GC+++C +C++PYTRG   S+    
Sbjct: 122 KSVVDITFPEIEK-FDRLPQPRAEGPS-AFVSIMEGCSKYCTFCVVPYTRGEEISRPFDD 179

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSID 233
           V+ E+ SL E G +EI L G +   Y G+  D +V  L  L+  +  +D IER+R  +  
Sbjct: 180 VIAEVASLCEQGVREITLLGQNVNDYRGLMHDGQVADLALLIHYLAAMDNIERIRFTTSH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P+ F+E+++       KL  H HL +QSG D  L  M R YT  EY+  +  LR    D+
Sbjct: 240 PSAFSENLIDAYAEEPKLANHLHLPVQSGSDRILAAMKRNYTVLEYKSKIRKLRAVRPDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D I+GFPG            +  +    +  F YSPR GT A  + + V    K E
Sbjct: 300 SLSSDFIIGFPGETDADFEATMNLIHDMGFDHSFSFIYSPRPGTPAAQLPDDVPMAVKKE 359

Query: 354 RSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           R    I  NRIN KA   ++  +G    +L     +      +G T N   VN   D  +
Sbjct: 360 R--LAILQNRINAKAAEISQSMVGTQQRILVTGPSKKYPDQLSGRTENNRVVNFNGDTPL 417

Query: 412 SGKILNVKINSFEGEVAEGEI 432
            G+++ +KI         GEI
Sbjct: 418 IGQMVTIKIKEARPYSLWGEI 438


>MIAB_COXB2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  182 bits (463), Expect = 4e-48
 Identities = 137/441 (31%), Positives = 210/441 (47%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTE--KFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  KF   G E+ +   +ADV+++NTCSV      K    
Sbjct: 3   KLYLKTHGCQMNEYDSAKMADVLKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSE 61

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  +I V GC A Q   T +     VD+V G +    +   ++    + 
Sbjct: 62  LGRWRPFKEKRPHVVIGVGGCVASQEGETILKQAPFVDIVFGPQTLHRLPDLLDSVIQKR 121

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K  V +      K F+ L        + AF+ I +GC+++C +C++PYTRG   S+    
Sbjct: 122 KSVVDITFPEIEK-FDRLPQPRAEGPS-AFVSIMEGCSKYCTFCVVPYTRGEEISRPFDD 179

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSID 233
           V+ E+ SL E G +EI L G +   Y G+  D +V  L  L+  +  +D IER+R  +  
Sbjct: 180 VIAEVASLCEQGVREITLLGQNVNDYRGLMHDGQVADLALLIHYLAAMDNIERIRFTTSH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P+ F+E+++       KL  H HL +QSG D  L  M R YT  EY+  +  LR    D+
Sbjct: 240 PSAFSENLIDAYAEEPKLANHLHLPVQSGSDRILAAMKRNYTVLEYKSKIRKLRAVRPDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D I+GFPG            +  +    +  F YSPR GT A  + + V    K E
Sbjct: 300 SLSSDFIIGFPGETDADFEATMNLIHDMGFDHSFSFIYSPRPGTPAAQLPDDVPMAVKKE 359

Query: 354 RSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           R    I  NRIN KA   ++  +G    +L     +      +G T N   VN   D  +
Sbjct: 360 R--LAILQNRINAKAAEISQSMVGTQQRILVTGPSKKYPDQLSGRTENNRVVNFNGDTPL 417

Query: 412 SGKILNVKINSFEGEVAEGEI 432
            G+++ +KI         GEI
Sbjct: 418 IGQMVTIKIKEARPYSLWGEI 438


>MIAB_COXB1 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  182 bits (463), Expect = 4e-48
 Identities = 137/441 (31%), Positives = 210/441 (47%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTE--KFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  KF   G E+ +   +ADV+++NTCSV      K    
Sbjct: 3   KLYLKTHGCQMNEYDSAKMADVLKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSE 61

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  +I V GC A Q   T +     VD+V G +    +   ++    + 
Sbjct: 62  LGRWRPFKEKRPHVVIGVGGCVASQEGETILKQAPFVDIVFGPQTLHRLPDLLDSVIQKR 121

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K  V +      K F+ L        + AF+ I +GC+++C +C++PYTRG   S+    
Sbjct: 122 KSVVDITFPEIEK-FDRLPQPRAEGPS-AFVSIMEGCSKYCTFCVVPYTRGEEISRPFDD 179

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSID 233
           V+ E+ SL E G +EI L G +   Y G+  D +V  L  L+  +  +D IER+R  +  
Sbjct: 180 VIAEVASLCEQGVREITLLGQNVNDYRGLMHDGQVADLALLIHYLAAMDNIERIRFTTSH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P+ F+E+++       KL  H HL +QSG D  L  M R YT  EY+  +  LR    D+
Sbjct: 240 PSAFSENLIDAYAEEPKLANHLHLPVQSGSDRILAAMKRNYTVLEYKSKIRKLRAVRPDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D I+GFPG            +  +    +  F YSPR GT A  + + V    K E
Sbjct: 300 SLSSDFIIGFPGETDADFEATMNLIHDMGFDHSFSFIYSPRPGTPAAQLPDDVPMAVKKE 359

Query: 354 RSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           R    I  NRIN KA   ++  +G    +L     +      +G T N   VN   D  +
Sbjct: 360 R--LAILQNRINAKAAEISQSMVGTQQRILVTGPSKKYPDQLSGRTENNRVVNFNGDTPL 417

Query: 412 SGKILNVKINSFEGEVAEGEI 432
            G+++ +KI         GEI
Sbjct: 418 IGQMVTIKIKEARPYSLWGEI 438


>MIAB_AERHH RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 477

 Score =  182 bits (463), Expect = 4e-48
 Identities = 130/442 (29%), Positives = 207/442 (46%), Gaps = 14/442 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +      GY + +  E ADV ++NTCS+     +K    +
Sbjct: 4   KLHIKTWGCQMNEYDSSKMADLLDASNGYTLTEEPEEADVLLLNTCSIREKAQEKVFHQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR ++     P  +I V GC A      + +    VD+V G +    +   + + ++   
Sbjct: 64  GRWKKLKANKPGLVIGVGGCVASQEGDNIRTRAPYVDIVFGPQTLHRLPTMIKQVQEGRG 123

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV V A  + + F+ L        T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 124 AQVDV-AFPEIEKFDSLPEPRAEGAT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDV 181

Query: 177 LDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKV-TLVDLLEEIEKIDGIERVRIGSIDP 234
           L EI  LA+ G +E+ L G +  +Y G   D  + T  +LL  +  IDGI+R+R  +  P
Sbjct: 182 LYEIAQLAQQGVREVNLLGQNVNAYRGPTFDGGICTFAELLRLVAAIDGIDRIRYTTSHP 241

Query: 235 TFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVS 294
             FT+D++       ++    HL +QSG D  L  M R +T  EY+  +  LR    D++
Sbjct: 242 IEFTDDIIEVYKDTPEVVSFLHLPVQSGSDRILTMMKRPHTVLEYKSKIRRLRAARPDIT 301

Query: 295 ITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDER 354
           I++D IVGFP             ++ I    +  F YSPR GT A ++ + VD   K  R
Sbjct: 302 ISSDFIVGFPNETDEDFEATMKLIEEINFDMSFSFIYSPRPGTPAADLPDDVDMEVKKAR 361

Query: 355 SKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG- 413
             +L  +            +G    +L E   +L      G T N   VN +    + G 
Sbjct: 362 LTRLQHVINNQSMQIGRAMLGSTQRILVEGPSKLDPMQLCGRTENNRVVNFEGPHTLIGG 421

Query: 414 ----KILNVKINSFEGEVAEGE 431
               +I  V+ NS  G+   GE
Sbjct: 422 FADVEITEVRPNSLRGKFLRGE 443


>MIAB_PSEPF RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  182 bits (462), Expect = 5e-48
 Identities = 130/445 (29%), Positives = 219/445 (49%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +  EV    E ADV ++NTCS+      +    +
Sbjct: 4   KLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R     NP+ +IAV GC   +A  E + I      VDVV G +    +   ++ AR 
Sbjct: 64  GRWRELKLANPDMVIAVGGC---VASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDAARI 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
               QV V      K F+ L     +  + A++ + +GC+++C +C++PYTRG   S+  
Sbjct: 121 SKLPQVDVSFPEIEK-FDHLPEPRIDGPS-AYVSVMEGCSKYCTFCVVPYTRGEEVSRPF 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
             V+ EI  LAE+G +E+ L G +   Y G+  D ++  L +L+  +  +DGI+R+R  +
Sbjct: 179 DDVIAEIIHLAENGVREVTLLGQNVNGYRGLTHDGRLADLAELIRVVAAVDGIDRIRYTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ +++    + +L  H HL +QSG D  L  M R +TA EY+  +  LR  + 
Sbjct: 239 SHPLEFSDSLIQAHAEVPELVKHLHLPVQSGSDRILAAMKRNHTALEYKSKLRKLRAAVP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            + I++D IVGFPG            +  +    ++ F YS R GT A ++ +      K
Sbjct: 299 GICISSDFIVGFPGETEKDFEQTMKLIADVGFDFSYSFVYSQRPGTPAADLADDTPEELK 358

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD- 408
            ER   L   +R+N++ F  + + +G V  +L  +  +   G   G T N   VN + D 
Sbjct: 359 KERLNAL--QHRLNQQGFEISRQMVGSVQRILVTDYSKKDPGELQGRTENNRIVNFRCDN 416

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
             + G+  +V I++ +     G ++
Sbjct: 417 PTLIGQFADVHIDAAQPHSLRGSLI 441


>MIAB_LEIXX RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 535

 Score =  182 bits (462), Expect = 5e-48
 Identities = 115/379 (30%), Positives = 181/379 (47%), Gaps = 7/379 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N ++SE ++      GY   +  E AD+ V+NTC+V    D K    +G     
Sbjct: 30  TFGCQMNVHDSERLSGSLEAAGYVPAN-GEEADIVVINTCAVRENADNKLYGNLGHLASV 88

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R++    IAV GC AQ     +      VDVV G+ N G +   + +AR          
Sbjct: 89  KRRHAGMQIAVGGCLAQKDKNVILEKAPWVDVVFGTHNMGALPRLLERARHN--DXXXXX 146

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
                  F      + ++    ++ I  GCN  C +C++P  RG    + P  +L E+++
Sbjct: 147 XXXXXXTFPSTLPTKRDSSFSGWVSISVGCNNTCTFCIVPALRGKEKDRRPGDILAEVQA 206

Query: 183 LAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDVV 242
           L + G  E+ L G +  SYGV+  ++     LL    +I+G+ER+R  S  P  FTEDV+
Sbjct: 207 LVDEGAVEVTLLGQNVNSYGVEFGDRQAFSKLLRAAGQIEGLERIRFTSPHPAAFTEDVI 266

Query: 243 RRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVG 302
             +     + P  H+ LQSG D  L+ M R Y ++++  I++ +R K+   +I+TD+IVG
Sbjct: 267 DAMAETPNVMPQLHMPLQSGSDRILRSMRRSYRSEKFLGILDRVRAKLPGAAISTDIIVG 326

Query: 303 FPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIELN 362
           FPG            ++    +    F+YS R GT A  M  QV      ER  +LI L 
Sbjct: 327 FPGETEEDFLDTLRVVEAARFASAFTFQYSIRPGTPAATMAGQVPKEVVQERYDRLIALQ 386

Query: 363 RINEKAFAEKYIGEVIDVL 381
                   EK IG  +++L
Sbjct: 387 ERISLEENEKLIGRDVELL 405


>MIAB_HELPG RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 437

 Score =  182 bits (462), Expect = 5e-48
 Identities = 132/434 (30%), Positives = 214/434 (49%), Gaps = 22/434 (5%)

Query: 1   MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           MKV   T+GC +N+ +SE +  +  +  Y+     + AD+ ++NTCSV    ++K    I
Sbjct: 1   MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKTADLILINTCSVREKPERKLFSEI 60

Query: 61  GR-ARRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQ 118
           G+ A+ + P A I V GC A     ++      V  VLG+RN  +I   ++K     ++ 
Sbjct: 61  GQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARNVSKISQVIHK-----EKA 115

Query: 119 VKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLD 178
           V+V        +   +  E   + R+ L I  GC++ CAYC++P+TRG   S     +L 
Sbjct: 116 VEVAIDYDESAYA-FEFFEKKAQIRSLLNISIGCDKKCAYCIVPHTRGKEISIPMDLILK 174

Query: 179 EIRSLAEHGFKEIILSGIHTASYGVDLDE---KVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           E   LA +G KE++L G +  +YG        KV   DLL+++ +I GIER+R  S  P 
Sbjct: 175 EAEKLANNGTKELMLLGQNVNNYGARFSSEHAKVDFSDLLDKLSEISGIERIRFTSPHPL 234

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
              +  + R     K+C   H+ LQSG  A LK M R Y+ + + + V  L+  + +V I
Sbjct: 235 HMNDGFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKEWFLNRVERLKALVPEVGI 294

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           +TD+IVGFP             L+++     + F YSPR  T A   + +V       R 
Sbjct: 295 STDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEVSSSRL 354

Query: 356 KKLIELNR--INEKAFAEKYIGEVIDVLFEEEVELGSGVYTGY-----TRNYIKVNAKAD 408
           ++L   ++  + EKA  E  +G+   VL E   E+ + +  G+     T  +I+V  K  
Sbjct: 355 ERLQNRHKEILEEKAKLE--VGKTHVVLVENRREINNQI-VGFEGRSDTGKFIEVACKEK 411

Query: 409 CNVSGKILNVKINS 422
            N  G+++ V+I S
Sbjct: 412 RN-PGELVEVEIIS 424


>MIAB_COXBN RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 439

 Score =  182 bits (462), Expect = 5e-48
 Identities = 137/441 (31%), Positives = 210/441 (47%), Gaps = 15/441 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTE--KFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  KF   G E+ +   +ADV+++NTCSV      K    
Sbjct: 3   KLYLKTHGCQMNEYDSAKMADVLKF-SHGLELTEDPAVADVFLLNTCSVREKAQTKVFSE 61

Query: 60  IGRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R    + P  +I V GC A Q   T +     VD+V G +    +   ++    + 
Sbjct: 62  LGRWRPFKEKRPHVVIGVGGCVASQEGETILKQAPFVDIVFGPQTLHRLPDLLDSVIQKR 121

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           K  V +      K F+ L        + AF+ I +GC+++C +C++PYTRG   S+    
Sbjct: 122 KSVVDITFPEIEK-FDRLPQPRAEGPS-AFVSIMEGCSKYCTFCVVPYTRGEEISRPFDD 179

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGSID 233
           V+ E+ SL E G +EI L G +   Y G+  D +V  L  L+  +  +D IER+R  +  
Sbjct: 180 VIAEVASLCEQGVREITLLGQNVNDYCGLMHDGQVADLALLIHYLAAMDNIERIRFTTSH 239

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P+ F+E+++       KL  H HL +QSG D  L  M R YT  EY+  +  LR    D+
Sbjct: 240 PSAFSENLIDAYAEEPKLANHLHLPVQSGSDRILAAMKRNYTVLEYKSKIRKLRAVRPDI 299

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           S+++D I+GFPG            +  +    +  F YSPR GT A  + + V    K E
Sbjct: 300 SLSSDFIIGFPGETDADFEATMNLIHDMGFDHSFSFIYSPRPGTPAAQLPDDVPMAVKKE 359

Query: 354 RSKKLIELNRINEKA--FAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
           R    I  NRIN KA   ++  +G    +L     +      +G T N   VN   D  +
Sbjct: 360 R--LAILQNRINVKAAEISQSMVGTQQRILVTGPSKKYPDQLSGRTENNRVVNFNGDTPL 417

Query: 412 SGKILNVKINSFEGEVAEGEI 432
            G+++ +KI         GEI
Sbjct: 418 IGQMVTIKIKEARPYSLWGEI 438


>MIAB_BORPA RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 475

 Score =  182 bits (461), Expect = 6e-48
 Identities = 134/440 (30%), Positives = 202/440 (45%), Gaps = 15/440 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S+ M +     +G E+ D  E ADV + NTCSV     +K    +
Sbjct: 28  KLYIRTFGCQMNEYDSDKMADVLRADQGLELTDNPEDADVILFNTCSVREKAQEKVFSDL 87

Query: 61  GRA---RRQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR    ++QNP  +I V GC A Q     V     VDVV G +    +   + + R +G 
Sbjct: 88  GRVQHLKKQNPNLVIGVGGCVASQEGEAIVKRAPYVDVVFGPQTLHRLPDLIKRRRAQGV 147

Query: 117 QQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKV 176
            QV +      K F+ L     +  T AF+ I +GC+++C++C++PYTRG   S+    V
Sbjct: 148 SQVDISFPEIEK-FDALPPPRVDGAT-AFVSIMEGCSKYCSFCVVPYTRGEEVSRPFDDV 205

Query: 177 LDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVD---LLEEIEKIDGIERVRIGSID 233
           L EI  LA+ G KE+ L G +  +Y   + +   + D   LLE + +I GIER+R  +  
Sbjct: 206 LLEIADLADQGVKEVTLLGQNVNAYRGAMGDSGEIADFAMLLEYVHEIPGIERIRYTTSH 265

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P   T+ +V     L KL    HL +Q+G D  L  M R YTA E++ +V  LR     +
Sbjct: 266 PKEMTQRMVDAYARLPKLVSFLHLPVQAGSDRVLAAMKRGYTALEFKSVVRRLRAARPSL 325

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           ++++D IVGFPG            ++ +    +  F YS R GT A ++ +    + K  
Sbjct: 326 TLSSDFIVGFPGETEEDFQKTMKLIEDVGFDTSFSFVYSRRPGTPAADLHDDTPQDVKXX 385

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
                               IG    VL E           G T N   VN      + G
Sbjct: 386 XXXXXXXXXXXXXXXXXXGMIGTRQRVLVEGPSRRDPNELMGRTENNRIVNFPGVPRLIG 445

Query: 414 KILNVKI-----NSFEGEVA 428
            +++V +     NS  G VA
Sbjct: 446 HMVDVVVTHAHTNSLRGRVA 465


>MIAB_SYNS3 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 473

 Score =  181 bits (460), Expect = 8e-48
 Identities = 115/388 (29%), Positives = 182/388 (46%), Gaps = 15/388 (3%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRA--- 63
           T GC++N  +SE M       GY+  +    AD+ + NTC++ +  ++K    +GR    
Sbjct: 33  TFGCQMNKADSERMAGILETMGYQEANAELDADLVLYNTCTIRDNAEQKVYSYLGRQAIR 92

Query: 64  RRQNPEAIIAVVGCYAQI-APTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R NP   + V GC AQ    + +  +  +D+V+G ++   +                  
Sbjct: 93  KRTNPNLTLVVAGCVAQQEGESLLRRVPELDLVMGPQHANRL----EXXXXXXXXXXXXX 148

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
               + + EDL     ++ T A++ +  GCN  C YC++P  RG   S+ P+ +L E+  
Sbjct: 149 XXEDHHILEDLTTARRDSSTCAWVNVIYGCNERCTYCVVPSVRGKEQSRLPESILLEMEG 208

Query: 183 LAEHGFKEIILSGIHTASYGVDLD-------EKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           LA  GFKEI L G +  +YG DL         + TL DLL ++  ++GIER+R  +  P 
Sbjct: 209 LAARGFKEITLLGQNIDAYGRDLPGITAEGRRQHTLTDLLHQVHDVEGIERLRFATSHPR 268

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           +FTE ++     L K+C HFH+  QSG +  LK M R YT +            + D +I
Sbjct: 269 YFTERLIDACADLPKVCEHFHIPFQSGDNELLKAMARGYTVEXXXXXXXXXXXXMPDAAI 328

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERS 355
           + DVIV FPG            ++ I   + +   YSPR  T A +  NQ+    K  R 
Sbjct: 329 SADVIVAFPGETDAQYRRTLALIEEIGFDQVNTAAYSPRPNTPAADWNNQLSEEVKVARL 388

Query: 356 KKLIELNRINEKAFAEKYIGEVIDVLFE 383
           +++  L     K    +Y G +  VL E
Sbjct: 389 QEINALVESTAKERNARYAGRIEQVLAE 416


>MIAB_AZOSB RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 449

 Score =  181 bits (460), Expect = 8e-48
 Identities = 139/449 (30%), Positives = 210/449 (46%), Gaps = 23/449 (5%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+SE M +     EG    D  E ADV + NTCSV     +K    +
Sbjct: 3   KLYIRTFGCQMNEYDSEKMADVLGAGEGIAKTDNPEEADVILFNTCSVREKAQEKVFHDL 62

Query: 61  GRAR---RQNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGK 116
           GR +   +  P+ II V GC A Q     V+    VDVV G +    +   +   +  G+
Sbjct: 63  GRVKHLKQLKPDLIIGVGGCVASQEGDAIVARAPYVDVVFGPQTLHRLPALIAARKQSGR 122

Query: 117 QQVKVG--AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPK 174
            QV +    + K       ++E  +    AF+ I +GC+++C +C++PYTRG   S+  +
Sbjct: 123 SQVDISFPEIEKFDAMPPARVEGAS----AFVSIMEGCSKYCTFCVVPYTRGEEISRPLE 178

Query: 175 KVLDEIRSLAEHGFKEIILSGIHTASYGV----DLDEKVTLVDLLEEIEKIDGIERVRIG 230
            VL EI  LAE G KE+ L G +  ++      D  E+     LLE + +I GIER+R  
Sbjct: 179 DVLAEIAGLAEQGVKEVTLLGQNVNAWRGEIVRDAGEEGDFAFLLECVAEIPGIERIRYT 238

Query: 231 SIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKI 290
           +  P   T+ +    + + KL    HL +QSG D  L  M R Y+  E++ IV  LR   
Sbjct: 239 TSHPREMTQRLFDAYVKIPKLVSQLHLPVQSGSDRILAAMKRGYSVLEFKSIVRKLRAAR 298

Query: 291 EDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK 350
            D+S+++D IVGFPG            +  +    +  F YS R GT A ++E+ V    
Sbjct: 299 PDLSLSSDFIVGFPGETEEDFEKTMKLIDEVGFDGSFSFVYSARPGTPAADLEDPVPQET 358

Query: 351 KDERSKKLIELNRINEKAFA--EKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD 408
           K     +L    RI+E+A A  +  +G    +L E      +    G T N   VN  A 
Sbjct: 359 KLAWLARL--QKRIDEQAQAVSQSMVGSAQRILVEGVSRKSAEELMGRTDNNRVVNFPAP 416

Query: 409 C----NVSGKILNVKINSFEGEVAEGEIV 433
                 + G+ + V+I S       GEI+
Sbjct: 417 SPHRDRLVGQFIEVRITSALPHSLRGEIL 445


>RIMO_CLOPE RecName: Full=Ribosomal protein S12
           methylthiotransferase rimO;         Short=S12
           methylthiotransferase;         Short=S12 MTTase;
          Length = 445

 Score =  181 bits (459), Expect = 1e-47
 Identities = 114/387 (29%), Positives = 197/387 (50%), Gaps = 6/387 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII- 60
           KV   +LGC  N  +SE M    V+  YE+ +  + AD+ +VNTC       ++S   I 
Sbjct: 5   KVGMVSLGCDKNRVDSEIMLG-MVQNEYELTNNPKEADIIIVNTCGFIEKAKQESINTIL 63

Query: 61  --GRARRQNPEAIIAVVGCYAQIAPTEVSGI-EGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + +  +   ++   GC  Q    E+  +   +D++LG  +  +I   +    +   +
Sbjct: 64  DMAKYKTSHNCKLLIATGCLTQRYGDELLELMPEIDIMLGVNDYAKINEAIMNFINGNNE 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +VK        + E L++    +K  A+L+I +GC+ FC YC+IP  RG   S+  + ++
Sbjct: 124 KVKATNYSDVSINEGLRLIT-TDKATAYLRIAEGCDNFCTYCIIPKIRGKFRSRALESIV 182

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
           +E + LAE+G KE+IL    T +YG+D+  +  L  +L E+ KI+GIE +R+    P   
Sbjct: 183 EEAKKLAENGVKELILIAQDTTNYGIDIYGEKKLHLVLRELAKIEGIEWIRVLYCYPEAI 242

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            +++++ I    K+C +  L +Q   +  LKRM R+ T +E    +N LR  + ++ + T
Sbjct: 243 YDELIKEISVNDKVCNYLDLPIQHISNNVLKRMGRKTTKEEIIGKINDLRKNVPNIVLRT 302

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
            +IVGFPG            +K I L K  +F YS  +GT A  ME+Q+D   K  R ++
Sbjct: 303 SLIVGFPGESCEDFNELKDFIKTIKLDKVGVFTYSREEGTPAAIMEDQIDEEVKKAREEE 362

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEE 384
           ++ L +   +   +  +G   DVL E+
Sbjct: 363 IMLLQKEVSEEINKNKVGREYDVLIEK 389


>RIMO_CLOP1 RecName: Full=Ribosomal protein S12
           methylthiotransferase rimO;         Short=S12
           methylthiotransferase;         Short=S12 MTTase;
          Length = 445

 Score =  181 bits (459), Expect = 1e-47
 Identities = 114/387 (29%), Positives = 197/387 (50%), Gaps = 6/387 (1%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII- 60
           KV   +LGC  N  +SE M    V+  YE+ +  + AD+ +VNTC       ++S   I 
Sbjct: 5   KVGMVSLGCDKNRVDSEIMLG-MVQNEYELTNNPKEADIIIVNTCGFIEKAKQESINTIL 63

Query: 61  --GRARRQNPEAIIAVVGCYAQIAPTEVSGI-EGVDVVLGSRNKGEIVYYVNKARDEGKQ 117
              + +  +   ++   GC  Q    E+  +   +D++LG  +  +I   +    +   +
Sbjct: 64  DMAKYKTSHNCKLLIATGCLTQRYGDELLELMPEIDIMLGVNDYAKINEAIMNFINGNNE 123

Query: 118 QVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVL 177
           +VK        + E L++    +K  A+L+I +GC+ FC YC+IP  RG   S+  + ++
Sbjct: 124 KVKATNYSDVSINEGLRLIT-TDKATAYLRIAEGCDNFCTYCIIPKIRGKFRSRALESIV 182

Query: 178 DEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFF 237
           +E + LAE+G KE+IL    T +YG+D+  +  L  +L E+ KI+GIE +R+    P   
Sbjct: 183 EEAKKLAENGVKELILIAQDTTNYGIDIYGEKKLHLVLRELAKIEGIEWIRVLYCYPEAI 242

Query: 238 TEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITT 297
            +++++ I    K+C +  L +Q   +  LKRM R+ T +E    +N LR  + ++ + T
Sbjct: 243 YDELIKEISVNDKVCNYLDLPIQHISNNVLKRMGRKTTKEEIIGKINDLRKNVPNIVLRT 302

Query: 298 DVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKK 357
            +IVGFPG            +K I L K  +F YS  +GT A  ME+Q+D   K  R ++
Sbjct: 303 SLIVGFPGESCEDFNELKDFIKTIKLDKVGVFTYSREEGTPAAIMEDQIDEEVKKAREEE 362

Query: 358 LIELNRINEKAFAEKYIGEVIDVLFEE 384
           ++ L +   +   +  +G   DVL E+
Sbjct: 363 IMLLQKEVSEEINKNKVGREYDVLIEK 389


>MIAB_PSEF5 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 442

 Score =  181 bits (459), Expect = 1e-47
 Identities = 132/445 (29%), Positives = 219/445 (49%), Gaps = 20/445 (4%)

Query: 2   KVAFATLGCRVNTYESEAMTEKF-VREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQII 60
           K+   T GC++N Y+S  M +     +  EV    E ADV ++NTCS+      +    +
Sbjct: 4   KLYIETHGCQMNEYDSSRMVDLLGEHQALEVTARAEDADVILLNTCSIRERAQDRVYSQL 63

Query: 61  GRARR---QNPEAIIAVVGCYAQIAPTEVSGIEG----VDVVLGSRNKGEIVYYVNKARD 113
           GR R     NP+ +IAV GC   +A  E + I      VDVV G +    +   ++ AR 
Sbjct: 64  GRWRELKLANPDMVIAVGGC---VASQEGAAIRDRAPYVDVVFGPQTLHRLPEMIDVARI 120

Query: 114 EGKQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDP 173
               QV V      K F+ L     +  + A++ + +GC+++C +C++PYTRG   S+  
Sbjct: 121 TKLPQVDVSFPEIEK-FDHLPEPRIDGPS-AYVSVMEGCSKYCTFCVVPYTRGEEVSRPF 178

Query: 174 KKVLDEIRSLAEHGFKEIILSGIHTASY-GVDLDEKVT-LVDLLEEIEKIDGIERVRIGS 231
             V+ EI  LAE+G +E+ L G +   Y G   D ++  L +L+  +  IDGIER+R  +
Sbjct: 179 DDVIAEIIHLAENGVREVTLLGQNVNGYRGQTHDGRMADLAELIRVVAAIDGIERIRYTT 238

Query: 232 IDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIE 291
             P  F++ +++    + +L  H HL +QSG D  L  M R +TA EY+  +  LR  + 
Sbjct: 239 SHPLEFSDSLIQAHAEVPELVKHLHLPVQSGSDRILAAMKRNHTALEYKSKLRKLRAAVP 298

Query: 292 DVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKK 351
            + I++D IVGFPG            ++ +    ++ F YS R GT A ++ ++     K
Sbjct: 299 GICISSDFIVGFPGETEKDFQQTMKLIEDVGFDFSYSFVYSQRPGTPAADLADETPEAVK 358

Query: 352 DERSKKLIELNRINEKAF--AEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKAD- 408
            ER   L   +R+N++ F  + + +G    +L  +  +   G   G T N   VN + D 
Sbjct: 359 KERLNAL--QHRLNQQGFEISRQMVGSTQRILVTDYSKKDPGELQGRTENNRIVNFRCDN 416

Query: 409 CNVSGKILNVKINSFEGEVAEGEIV 433
             + G+  +V I+S +     G ++
Sbjct: 417 PTLIGQFADVYIDSAQPHSLRGSLL 441


>MIAB_NITOC RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 447

 Score =  181 bits (459), Expect = 1e-47
 Identities = 136/443 (30%), Positives = 211/443 (47%), Gaps = 16/443 (3%)

Query: 2   KVAFATLGCRVNTYESEAMTEKFVRE--GYEVVDFNEMADVYVVNTCSVTNMGDKKSRQI 59
           K+   T GC++N Y+S  M +  +RE  G E+    E A+V ++NTCSV     +K    
Sbjct: 4   KLYIKTHGCQMNEYDSSRMAD-VLRESHGLELTSDPEQAEVLLLNTCSVREKAQEKVFSQ 62

Query: 60  IGRARR---QNPEAIIAVVGCYA-QIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEG 115
           +GR R+     PE +I V GC A Q   T       VD+V G +    +   + +A+   
Sbjct: 63  LGRWRQLKQSRPELVIGVGGCVASQEGETIRVRAPYVDLVFGPQTIHRLPAMLTQAKASS 122

Query: 116 KQQVKVGAVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           +  V +      K F+ L        T AF+ + +GC+++C++C++PYTRG   S+    
Sbjct: 123 QPVVDLSFPEIEK-FDKLPEPRAEGPT-AFVSVMEGCSKYCSFCVVPYTRGEEISRPFDD 180

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT--LVDLLEEIEKIDGIERVRIGSID 233
           V+ EI  LAE G +EI L G +  +Y   + E  T  L  L+  +  I+GIER+R  +  
Sbjct: 181 VIAEIVGLAEQGVREITLLGQNVNAYRGSIGEGDTADLALLIHYVASIEGIERIRFTTSH 240

Query: 234 PTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDV 293
           P  F++ +++    +  L  H HL +QSG D  L  M R +T  EY+  +  LR    D+
Sbjct: 241 PVEFSDSLIQAFAEVPALVSHLHLPVQSGSDRMLSLMKRGHTVLEYKAKLRKLRQVRPDI 300

Query: 294 SITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDE 353
           SI++D IVG PG            +  +    +  F YSPR GT A ++ +      K E
Sbjct: 301 SISSDFIVGLPGETEADFQATLALVDEVGFDHSFSFIYSPRPGTPAASLPDCTPIALKKE 360

Query: 354 RSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSG 413
           R   L    R  E A +   +  V  VL E   +    +  G T N   VN  A  ++ G
Sbjct: 361 RLAILQGRLRALEIAISRGMVDTVQQVLVERPSKKDPTMLAGRTANNRVVNFSASQDMVG 420

Query: 414 KILNVKI-----NSFEGEVAEGE 431
           + +N++I     NS  G V + +
Sbjct: 421 QFVNIRITEALPNSLRGIVLDAK 443


>MIAB_MYCSS RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 525

 Score =  181 bits (459), Expect = 1e-47
 Identities = 122/396 (30%), Positives = 181/396 (45%), Gaps = 23/396 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +                   V V NTC+V    D K   +   +   
Sbjct: 20  TYGCQMNVHDSERLAGLLEXXXXXXXXXXXXXXVVVFNTCAVRENADNKLYGNLSHLAPR 79

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R  P+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 80  KRSEPQMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNRAAQVEIA 139

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +    ++ I  GCN  C +C++P  RG    + P  VL EI++
Sbjct: 140 EALQE--FPSTLPAARESAYAGWVSISVGCNNTCTFCIVPSLRGKEVDRRPGDVLAEIQT 197

Query: 183 LAEHGFKEIILSGIHTASYGVDL--DEKV---------------TLVDLLEEIEKIDGIE 225
           L + G  E+ L G +  +YGV    DE++                  +LL    +IDG+E
Sbjct: 198 LVDQGVLEVTLLGQNVNAYGVSFAADERLREDPRMWQSVPRNRGAFAELLRACGRIDGLE 257

Query: 226 RVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNL 285
           RVR  S  P  FT+DV+  +     +CP  H+ LQSG D  L+ M R Y A++Y  I++ 
Sbjct: 258 RVRFTSPHPAEFTDDVIEAMAETPNVCPALHMPLQSGSDRILRAMRRSYRAEKYLGIIDR 317

Query: 286 LRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQ 345
           +R  I D +ITTD+IVGFPG            +     S    F+YS R GT A +M  Q
Sbjct: 318 VRAAIPDAAITTDLIVGFPGETEEDFQATLDVVAASRFSSAFTFQYSKRPGTPAADMPGQ 377

Query: 346 VDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVL 381
           +      ER ++LIEL         +  +G  +++L
Sbjct: 378 LPKAVVSERYQRLIELQERISLEENQAQVGRTLELL 413


>MIAB_MYCSK RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 529

 Score =  181 bits (459), Expect = 1e-47
 Identities = 122/396 (30%), Positives = 181/396 (45%), Gaps = 23/396 (5%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKK---SRQIIGRA 63
           T GC++N ++SE +                   V V NTC+V    D K   +   +   
Sbjct: 24  TYGCQMNVHDSERLAGLLEXXXXXXXXXXXXXXVVVFNTCAVRENADNKLYGNLSHLAPR 83

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           +R  P+  IAV GC AQ     V      VDVV G+ N G +   + +AR     QV++ 
Sbjct: 84  KRSEPQMQIAVGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNRAAQVEIA 143

Query: 123 AVLKNKVFEDLKIEEYNNKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRS 182
             L+   F         +    ++ I  GCN  C +C++P  RG    + P  VL EI++
Sbjct: 144 EALQE--FPSTLPAARESAYAGWVSISVGCNNTCTFCIVPSLRGKEVDRRPGDVLAEIQT 201

Query: 183 LAEHGFKEIILSGIHTASYGVDL--DEKV---------------TLVDLLEEIEKIDGIE 225
           L + G  E+ L G +  +YGV    DE++                  +LL    +IDG+E
Sbjct: 202 LVDQGVLEVTLLGQNVNAYGVSFAADERLREDPRMWQSVPRNRGAFAELLRACGRIDGLE 261

Query: 226 RVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNL 285
           RVR  S  P  FT+DV+  +     +CP  H+ LQSG D  L+ M R Y A++Y  I++ 
Sbjct: 262 RVRFTSPHPAEFTDDVIEAMAETPNVCPALHMPLQSGSDRILRAMRRSYRAEKYLGIIDR 321

Query: 286 LRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQ 345
           +R  I D +ITTD+IVGFPG            +     S    F+YS R GT A +M  Q
Sbjct: 322 VRAAIPDAAITTDLIVGFPGETEEDFQATLDVVAASRFSSAFTFQYSKRPGTPAADMPGQ 381

Query: 346 VDGNKKDERSKKLIELNRINEKAFAEKYIGEVIDVL 381
           +      ER ++LIEL         +  +G  +++L
Sbjct: 382 LPKAVVSERYQRLIELQERISLEENQAQVGRTLELL 417


>MIAB_HERA2 RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 438

 Score =  181 bits (459), Expect = 1e-47
 Identities = 129/429 (30%), Positives = 212/429 (49%), Gaps = 36/429 (8%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIG----- 61
           T+GC++N  +SE +       GY   +  E AD  V+N+CSV    ++K   IIG     
Sbjct: 10  TVGCQMNVSDSERLESALQGVGYTPAEQAEDADFIVLNSCSVRANAEEK---IIGKITDI 66

Query: 62  -RARRQNPEAIIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVK 120
            R +R+ P+  I + GC   + P   S        +  +    + ++V+ +  +     +
Sbjct: 67  QRIKRERPDTKIVLWGC--MVGPNNQS--------IFKKKLPMVDHFVSPSAVD-----E 111

Query: 121 VGAVLKNKVFE----DLKIEEYN-NKTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKK 175
           V A+  N +++     L + ++        + I  GCN  CAYC+IP  RG   S+  ++
Sbjct: 112 VLALAPNPIYQLDEPALPVADWQVPPVNVHVPINYGCNMSCAYCVIPLRRGKERSRPMEE 171

Query: 176 VLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPT 235
           + +E+R +   G KEI L G    SYG DL  +  L DLLE + +  G+ R+R  +  P 
Sbjct: 172 IAEEVRRICARGAKEITLLGQIVDSYGHDLPGRPDLADLLEYLHETPGLVRLRFLTSHPA 231

Query: 236 FFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSI 295
           F +E ++  I  L K+ P  +L +Q+G D  LK M R YT  +Y  ++  +R+ I +VS+
Sbjct: 232 FMSEKLLHTIARLPKVMPDINLPIQAGDDQLLKVMKRGYTVAKYTKLIERIREIIPNVSL 291

Query: 296 TTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENME-NQVDGNKKDER 354
           +TD+IVG PG            ++ I   K HI  YS R GT+A +ME +     +  E+
Sbjct: 292 STDIIVGHPGETREMFERTLEMVENIRFDKVHIAAYSSRPGTKAADMELDPALAVEHGEK 351

Query: 355 SKKLIELNRINEKAFAEK---YIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNV 411
             + I L R+ E+   E+    +G  ++VL E   E   G + G  RN   V  +AD + 
Sbjct: 352 QYRRIALERLQERIATERNEECLGHEVEVLVE---EFTKGKWRGRDRNNKLVFFEADGDW 408

Query: 412 SGKILNVKI 420
            GK++N+ +
Sbjct: 409 YGKVVNIHV 417


>MIAB_GEOSL RecName: Full=(Dimethylallyl)adenosine tRNA
           methylthiotransferase miaB;         EC=2.-.-.-;AltName:
           Full=tRNA-i(6)A37 methylthiotransferase;
          Length = 446

 Score =  181 bits (459), Expect = 1e-47
 Identities = 126/432 (29%), Positives = 197/432 (45%), Gaps = 8/432 (1%)

Query: 7   TLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR---A 63
           T GC++N  +SE +      EGY   D  E AD+ ++NTCSV    ++K    +GR    
Sbjct: 11  TFGCQMNVNDSEKIATLLKDEGYLPTDDPERADLVILNTCSVRAKAEQKVYGHLGRFKGV 70

Query: 64  RRQNPEAIIAVVGCYAQIAPTEV-SGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVG 122
           R +    ++ V GC AQ     +   +  +D+V G+ N   +                  
Sbjct: 71  RSRKKGFLLGVGGCVAQQEGERLLQKVPWLDLVFGTHNLHLLPEIXXXXXXXXXXXXXX- 129

Query: 123 AVLKNKVFEDLKIEEYNNK-TRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIR 181
             + N+   DL  E         F+ +  GC+ FC+YC++PY RG   S+    ++DE+R
Sbjct: 130 -FIDNETRLDLFPETGGEGGVTRFVTVMQGCDNFCSYCIVPYVRGREISRRSSDIIDEVR 188

Query: 182 SLAEHGFKEIILSGIHTASYGVDLDEKVTLVDLLEEIEKIDGIERVRIGSIDPTFFTEDV 241
                G KE+ L G +  SYG+  + +++   L+  I +++G+ER+R  +  P   + ++
Sbjct: 189 KSVAEGVKEVTLLGQNVNSYGLKTEGELSFAGLIRRIAEVEGLERIRFTTSHPKDISPEL 248

Query: 242 VRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIV 301
           +     + KLC H HL  QSG DA L RMNR YT   Y + V  LR     +  T D+IV
Sbjct: 249 IACFAEVPKLCGHIHLPAQSGSDAVLARMNRGYTRAGYLEKVEALRAARPGIQFTGDMIV 308

Query: 302 GFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNKKDERSKKLIEL 361
           GFPG            ++ +  +    F YSPR  T A  + + V   +K  R  +L  L
Sbjct: 309 GFPGETEEDFQATISLMEEVRYADLFSFIYSPRPETAAAGIRDTVSRKEKQSRLDRLQTL 368

Query: 362 NRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNV