BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAB82040.1 cper0 CPE2334 GIB00075CH01 "conserved hypothetical
protein"
         (99 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YERC_BACSU RecName: Full=Uncharacterized protein yerC;                121   3e-30

>YERC_BACSU RecName: Full=Uncharacterized protein yerC;
          Length = 104

 Score =  121 bits (303), Expect = 3e-30
 Identities = 58/92 (63%), Positives = 73/92 (79%)

Query: 7  KLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAE 66
          KL+GK+LD LF +IL L+D+ ECY FF+D+CTI+E+++LAQRL VA+MLRE  TY +I  
Sbjct: 5  KLRGKELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVARMLREGNTYHKIET 64

Query: 67 ETKASTATISRVNRCLNYGADGYNNILNRLDE 98
          ET ASTATISRV RCLNYG D Y   L+R+ E
Sbjct: 65 ETGASTATISRVKRCLNYGNDAYEMALDRVKE 96


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,767,651,753
Number of extensions: 406467921
Number of successful extensions: 1213779
Number of sequences better than 1.0e-03: 33187
Number of HSP's gapped: 1168628
Number of HSP's successfully gapped: 41861
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)