# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_9012.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAB81143.1  [L=400]
Description: cper0 hemA GIB00075CH01 "glutamyl-tRNA reductase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.3e-38  133.8   0.1    5.8e-38  132.5   0.0    1.7  1  PF05201  Glutamyl-tRNAGlu reductase, N-terminal domain
    1.5e-22   82.8   0.4    1.5e-22   82.8   0.2    1.8  1  PF01488  Shikimate / quinate 5-dehydrogenase
    1.1e-05   27.9   2.6    2.3e-05   26.9   1.8    1.6  1  PF00745  Glutamyl-tRNAGlu reductase, dimerisation domain
  ------ inclusion threshold ------
      0.071   14.9   0.0       0.14   14.0   0.0    1.4  1  PF02826  D-isomer specific 2-hydroxyacid dehydrogenase, NAD 
       0.28   14.2   0.0        1.6   11.8   0.0    2.3  1  PF03807  NADP oxidoreductase coenzyme F420-dependent
       0.41   13.3   1.6       0.73   12.5   0.1    2.1  1  PF02254  TrkA-N domain
       0.88   12.1   2.1        9.1    8.8   0.0    3.1  2  PF00899  ThiF family
        1.1   10.7   0.0        1.8    9.9   0.0    1.3  1  PF02423  Ornithine cyclodeaminase/mu-crystallin family
          2   11.2   1.1         17    8.3   0.2    2.7  1  PF02938  GAD domain
        2.2    9.8   0.0        3.5    9.2   0.0    1.3  1  PF03435  Saccharopine dehydrogenase
        2.9   10.0   0.0        5.9    9.0   0.0    1.5  1  PF02558  Ketopantoate reductase PanE/ApbA
        4.9   10.2   0.4         13    8.9   0.0    1.9  1  PF03447  Homoserine dehydrogenase, NAD binding domain
        5.7    8.4   0.1         15    7.1   0.1    1.7  1  PF07993  Male sterility protein
        7.3    8.1   0.0         11    7.5   0.0    1.3  1  PF04198  Putative sugar-binding domain
        7.7    9.3   0.3         18    8.1   0.2    1.7  1  PF00708  Acylphosphatase
        8.8    8.7   0.0         28    7.1   0.0    1.8  1  PF08182  Pedibin/Hym-346 family
         11    8.1   7.3       0.99   11.4   0.7    2.4  1  PF11447  Protein of unknown function (DUF3201)
         11    8.4   0.0         33    6.9   0.0    1.8  1  PF00243  Nerve growth factor family
         13    8.2   1.6         78    5.7   0.0    2.6  2  PF02912  Aminoacyl tRNA synthetase class II, N-terminal doma
         13    7.7   0.2         26    6.8   0.2    1.4  1  PF02739  5'-3' exonuclease, N-terminal resolvase-like domain
         15    8.6   0.1         59    6.7   0.0    2.0  1  PF06879  Protein of unknown function (DUF1261)
         16    7.8   0.1         35    6.7   0.0    1.6  1  PF06240  Carbon monoxide dehydrogenase subunit G (CoxG)
         18    7.6   0.0         28    7.0   0.0    1.3  1  PF08659  KR domain
         21    7.4   0.1         50    6.2   0.1    1.6  1  PF04572  Alpha 1,4-glycosyltransferase conserved region
         23    7.7   0.0      3e+02    4.1   0.0    2.3  2  PF09836  Uncharacterized protein conserved in bacteria (DUF2
         24    7.4   0.0         85    5.6   0.0    1.9  1  PF04705  Thiostrepton-resistance methylase, N terminus
         28    7.2   0.0         48    6.4   0.0    1.3  1  PF00106  short chain dehydrogenase
         29    6.6   0.1    1.2e+02    4.6   0.0    2.1  1  PF07991  Acetohydroxy acid isomeroreductase, catalytic domai
         29    7.0   0.7         55    6.1   0.5    1.6  1  PF01863  Protein of unknown function DUF45
         36    7.3   0.5         94    6.0   0.3    1.7  1  PF07741  Brf1-like TBP-binding domain
         38    7.2   0.9    1.4e+02    5.3   0.6    2.1  1  PF10587  Eukaryotic elongation factor 1 beta central acidic 
         39    7.2   2.8         93    6.0   1.9    1.8  1  PF04081  DNA polymerase delta, subunit 4
         49    6.3   0.0    2.1e+02    4.3   0.0    2.1  1  PF07206  Baculovirus late expression factor 10 (LEF-10)
         49    6.3   1.1         96    5.4   0.7    1.5  1  PF07295  Protein of unknown function (DUF1451)
         55    6.1   6.0         44    6.4   1.2    2.6  1  PF09891  Uncharacterized protein conserved in archaea (DUF21
         61    6.1   0.1    1.1e+02    5.2   0.0    1.4  1  PF03695  Uncharacterised protein family (UPF0149)
         65    6.3   3.3         46    6.8   0.0    2.4  1  PF09358  Ubiquitin-activating enzyme e1 C-terminal domain
         77    6.3   0.1    2.9e+02    4.5   0.1    1.9  1  PF08562  Crisp
         92    5.4   1.5    2.3e+02    4.1   0.2    2.3  1  PF12212  Piwi/Argonaute/Zwille siRNA-binding domain
         94    5.3   0.0    1.6e+02    4.6   0.0    1.3  1  PF09449  Domain of unknown function (DUF2020)
      1e+02    5.8   0.0    3.9e+02    3.9   0.0    2.1  1  PF12171  Zinc-finger double-stranded RNA-binding
    1.1e+02    5.7   0.0    3.8e+02    4.0   0.0    2.0  1  PF11798  IMS family HHH motif
    1.7e+02    4.7   0.0    4.8e+02    3.3   0.0    1.8  1  PF04644  Motilin/ghrelin
    1.8e+02    4.4   0.0    4.6e+02    3.1   0.0    1.6  1  PF09754  PAC2 family
    1.9e+02    4.8   0.0      5e+02    3.4   0.0    1.7  1  PF00289  Carbamoyl-phosphate synthase L chain, N-terminal do
    3.3e+02    4.3   0.1    1.1e+03    2.7   0.1    1.9  1  PF08251  Mastoparan peptide
    4.5e+02    3.3   0.0    1.2e+03    1.9   0.0    1.7  1  PF01145  SPFH domain / Band 7 family
    9.6e+02    2.4   0.1    2.4e+03    1.1   0.1    1.6  1  PF00123  Peptide hormone


Domain and alignment annotation for each model:
>> PF05201  Glutamyl-tRNAGlu reductase, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  132.5   0.0   2.8e-41   5.8e-38       4     151 ..       8     150 ..       5     151 .. 0.87

  Alignments for each domain:
  == domain 1    score: 132.5 bits;  conditional E-value: 2.8e-41
                 ETTTS-HHHHHHHS---THHHHHHHH-....-----EEEEETTEEEEETTTT.....................---.S-TT---B---HHHHHHHHHH- CS
     PF05201   4 nhktapvelreklafseeeleealaqlkeeegieevvilsTCnRtEiylasedaeaaveelsellae.fkqlslee.leeylyvlegeeavrhlfrVas 100
                 + +++++++rekla+ +++ ++ + +l +  +++evvil+TCnRtEiy++++++  +++   e++++ f+ +++++ l++y++  +++ av+hl++V +
  BAB81143.1   8 K-RNVDIAIREKLALYPKKHKKYVGELLN--SFKEVVILNTCNRTEIYFNCTEE-ISED---EIFDKiFNVFNWNDdLKKYMFLSKEKRAVTHLMEVIC 99 
                 4.899*****************9999976..567**************977633.2233...566663334676655********************** PP

                 ---SS----HHHHHHHHHHHHHHHH-----HHHHHHHHHHHH---HHHHHS CS
     PF05201 101 GLdSmvlGEpqIlgQvkrAyelakeagtlgkiLerlfqkafavakrvrtet 151
                 G++S +lGE+qIlgQ+k+Ay++a + + ++++L+++f+ a+a++k+++te+
  BAB81143.1 100 GFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAIACGKKFKTEC 150
                 *************************************************97 PP

>> PF01488  Shikimate / quinate 5-dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.8   0.2   7.3e-26   1.5e-22      12     134 ..     172     289 ..     164     290 .. 0.94

  Alignments for each domain:
  == domain 1    score: 82.8 bits;  conditional E-value: 7.3e-26
                 T-EEEEE-------HHHHHHHH----EEEE--SSHHHHHHHHHH----...B--GGGHHHHHHT-SEEEE--SSSS--B-HHHHHHHHHHE.EEEE--S CS
     PF01488  12 gkkvlviGAGemarlvakhLlekgvkkiviaNRtaekakeLaeelggeevealpleeleellaeadvvisatsapepiiekeaveeakkklgllvDiav 110
                 ++k++v+G Ge+++l++khLl+++v+ i+++ R+++ka +L  e+    ve+l ++e +++++e+d ++s+t+ap+ ++++e+++     +  ++D+av
  BAB81143.1 172 CRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEI----VEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDII-HIYDLAV 265
                 6899*************************************8877....79**********************************999866.9****** PP

                 S-SB----TTSTTEEEEEHHHHHH CS
     PF01488 111 PRdvepevaeledvrvynvddlke 134
                 PRdv++e++e e v + ++d++ +
  BAB81143.1 266 PRDVDKELSEKERVILKDIDEISK 289
                 *******************99875 PP

>> PF00745  Glutamyl-tRNAGlu reductase, dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.9   1.8   1.1e-08   2.3e-05       4      98 ..     306     398 ..     287     400 .] 0.94

  Alignments for each domain:
  == domain 1    score: 26.9 bits;  conditional E-value: 1.1e-08
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS-S---.------TTHHHHHHHHHHHHHHHHHHS..S-TTTTHHHHHHHHHH CS
     PF00745   4 eaIIeeeveefeewlkslevvplIralrekaeeireeelekalkklalgedpeevleklarsltnkllhaptkalreaaadgdadellealrrlf 98 
                 ++I+ee +eef++wlk +ev+  Ir+++ + +ei  e ++   +k   + ++++ +e++++s      +  ++ l++ a +g +++++e+++++f
  BAB81143.1 306 KHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNK--GNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIF 398
                 68*************************************999999..555788999***********************99999*********99 PP

>> PF02826  D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.0   0.0   6.6e-05      0.14      38     100 ..     174     240 ..     163     249 .. 0.78

  Alignments for each domain:
  == domain 1    score: 14.0 bits;  conditional E-value: 6.6e-05
                 EEEEB-------HHHHHHHHGT-EEEEEBSSHHHHH...HHHHCCB.EECSHHHHHHH-SEEEE--- CS
     PF02826  38 tvGiiGlGrIGqavakrlkafgmkvlaydrskkkee...eeeelga.evvsleellaesDvvslhlp 100
                 +  ++G+G+IG+ ++k l + +++ ++   + k+++   e e +++  +++ +++++e D+++ ++ 
  BAB81143.1 174 KFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKAsdlEGEIVEVlDFNEKNQVINEVDCIVSCTA 240
                 6679***************99999999877766555545333333447889999******9987664 PP

>> PF03807  NADP oxidoreductase coenzyme F420-dependent
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00075       1.6       3      70 ..     176     240 ..     174     258 .. 0.80

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00075
                 EEE----HHHHHHHHHHH--..GGCEE-EE-SSCCCCHHHHHHHH-EEES-SHHHHHHH-SEEEE-S- CS
     PF03807   3 giiGaGnigealakglaaagaqkheviiaasrspekaeelaeelgvkvtavsneeaaeeadvvilavk 70 
                  ++G+G+ig+  +k l+++    + ++++  r+++ka++l+ e+   +   +++++++e d ++ +  
  BAB81143.1 176 MVLGYGEIGKLAIKHLLSHK--VECIYLI-VRDKSKASDLEGEIVEVLDFNEKNQVINEVDCIVSCTA 240
                 689****************9..5555555.***********888755666688889999999887655 PP

>> PF02254  TrkA-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.1   0.00035      0.73       1      45 [.     175     220 ..     175     231 .. 0.87

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00035
                 EEEE---HHHHHHHHHHHHTC.EEEEEEESSHHHHHHHHHCSSEEE CS
     PF02254   1 iiiiGlGrvGrslaeeLsege.kdvvvidkdeerveelreeglevv 45 
                 ++++G+G++G+  ++ L +++ + + +i +d++++  l+ e +ev+
  BAB81143.1 175 FMVLGYGEIGKLAIKHLLSHKvECIYLIVRDKSKASDLEGEIVEVL 220
                 68*****************554689***********9999988876 PP

>> PF00899  ThiF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.0    0.0044       9.1       4      43 ..     174     213 ..     172     229 .. 0.90
   2 ?    1.0   0.1       1.1   2.4e+03      84     118 ..     223     257 ..     214     270 .. 0.73

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.0044
     PF00899   4 kvlvvGaGglGseaaeaLaraGvgkltlvDkDtvelsNln 43 
                 k++v+G G +G  a++ L    v+ + l+ +D+ + s+l 
  BAB81143.1 174 KFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLE 213
                 689**************************99999999986 PP

  == domain 2    score: 1.0 bits;  conditional E-value: 1.1
     PF00899  84 enleellkdvDlvvdalDniearlllndacvkkgi 118
                 ++ ++++++vD++v+++    + +   d+ ++ +i
  BAB81143.1 223 NEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDI 257
                 66789999********9987776555555555555 PP

>> PF02423  Ornithine cyclodeaminase/mu-crystallin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.0   0.00088       1.8     130     217 ..     173     253 ..     169     284 .. 0.73

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.00088
                 -EEEEE----HHHHHHHHHCCCS--SEEEE--SSHHHHHHHHHHHH..C---EEECSCHHHHTSSSEEEE----SS..-SB-GGGS-- CS
     PF02423 130 stlaiiGaGvqaetqlealsavlpieeiriydideeaaekfaenvqefefevvavksaeeavegadivvTvTaakeaapilkaewvkp 217
                 +++ ++G G  +++ ++ l + + +e i ++ +d+++a  +  ++     ev   +++++++++ d +v +Taa +  +++ +e +k 
  BAB81143.1 173 RKFMVLGYGEIGKLAIKHL-LSHKVECIYLIVRDKSKASDLEGEIV----EVLDFNEKNQVINEVDCIVSCTAAPH--TVVRNEDIKT 253
                 5666666666666655554.34567777777888877777666665....69999*********************..9999988874 PP

>> PF02938  GAD domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.2    0.0082        17      16      65 ..     290     338 ..     284     353 .. 0.88

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0082
                 ECS.-----HHHHHHHHCHHHHCCHHHHEEEE-SS-EEBTTTCCC.SHHHH CS
     PF02938  16 vpggaaklsrkeideleefakefgakglayikveenglsgpiakf.lteee 65 
                 ++++++k+ + +++e++ +++e   + l ++k++e  +s++i ++ + e+e
  BAB81143.1 290 IDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIRE--VSSKIRNIkIRENE 338
                 566789999*************************9..99999998877776 PP

>> PF03435  Saccharopine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.2   0.0    0.0017       3.5       2      74 ..     176     238 ..     175     245 .. 0.72

  Alignments for each domain:
  == domain 1    score: 9.2 bits;  conditional E-value: 0.0017
                 EEE----THHHHHHHHHTTTC..EEEEEESSHHHHHHHHTTSTTTTEEEEE--TT-HHHHHHHHTTSSEEEE- CS
     PF03435   2 lvlGaGsvGqavaellarhgdvdeitvadrtlekaqalaakalglrveaialdvsnyeaLeallkegdlvvnl 74 
                 +vlG+G +G+ +++ l  h+    i ++ r+++ka  l  +          + v +  +  ++++e d +v++
  BAB81143.1 176 MVLGYGEIGKLAIKHLLSHKVE-CIYLIVRDKSKASDLEGE---------IVEVLDFNEKNQVINEVDCIVSC 238
                 69*****************876.***********8777532.........23333333334555566666655 PP

>> PF02558  Ketopantoate reductase PanE/ApbA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0028       5.9       2      55 ..     176     233 ..     175     255 .. 0.75

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0028
                 EEE-------HHHHHHTCHHHE.EEEE-S-H.HHHHHHH---EEEESS..EEEE...C CS
     PF02558   2 ailGaGaiGsllaakLakagad.vtlilrsr.rlealkknglrlksdk..geeivrpp 55 
                  +lG G iG l   +L  ++ + ++li+r++ ++  l+ + +++ + +  +++i+ ++
  BAB81143.1 176 MVLGYGEIGKLAIKHLLSHKVEcIYLIVRDKsKASDLEGEIVEVLDFNekNQVINEVD 233
                 69**************9977777********777767777776666664444444444 PP

>> PF03447  Homoserine dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0061        13       1      68 [.     179     241 ..     179     251 .. 0.74

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0061
                 -------HHHHHHHH...SSEEEEEEEEESSEEE.TTHHHHHT-TCEEEEHCCHHHHC.S-CEEEE-.S- CS
     PF03447   1 GlGaiGsallellkrqqeeiplelvavadrdsllskarkallgdeavtldlddlvadl.rvdvvVEc.as 68 
                 G+G iG+  +++l +++     e +++ +rd   + ++  l g++  +ld+ +  + + +vd +V c a+
  BAB81143.1 179 GYGEIGKLAIKHLLSHKV----ECIYLIVRD---KSKASDLEGEIVEVLDFNEKNQVInEVDCIVSCtAA 241
                 9***************75....566666666...234556778888888888766655579999999533 PP

>> PF07993  Male sterility protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.1     0.007        15       6      92 ..     181     261 ..     179     287 .. 0.69

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.007
     PF07993   6 GfLGkvllekllrtqpevkiyllvRaksgesaleRleeelekkelfsallkelaerikvvegDlseprlgLseedlqelaeevdvii 92 
                 G +Gk  ++ ll  + e  iyl vR ks++s le    e+ +++  +++     +++ +++   + p+    +ed+++   ++ +i+
  BAB81143.1 181 GEIGKLAIKHLLSHKVE-CIYLIVRDKSKASDLEGEIVEVLDFNEKNQV----INEVDCIVSCTAAPHTVVRNEDIKTE-GDIIHIY 261
                 6789999*****88766.9******999887766554555555544444....56666666666666666666666555.4555555 PP

>> PF04198  Putative sugar-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0053        11     162     250 ..     119     209 ..      86     212 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0053
                 GHHTTS-HHHHHHHHHTTEEEEBTTBEEE----EEEHHHHCCB-S--HHHHCTSSEEEEE----TTHHHHHHHCCTT..--SEEEEEHHHH CS
     PF04198 162 vkrgllteeelkelreegaVGeilgrffDaeGevvetelndrviglsleqlrkipkviavAggesKaeAilAaLrgg..linvLitdestA 250
                 +k+ + +++  +el++   ++ ++g  f +e ++ e ++++ +i+++ + l+ ++k +++  ge    Ai+  L  +   i  ++ d+s A
  BAB81143.1 119 YKTAISDNSISSELQKMFEIAIACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKveCIYLIVRDKSKA 209
                 5677888899999999999****************************************************99988743455555566655 PP

>> PF00708  Acylphosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.2    0.0085        18      52      82 ..     310     340 ..     294     350 .. 0.82

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.0085
     PF00708  52 eekvekfleelkkgppaakveeveveeveee 82 
                 ee++e+fl++lk ++  +k+++++++e e  
  BAB81143.1 310 EESIEEFLNWLKIREVSSKIRNIKIRENEIC 340
                 789**********************876654 PP

>> PF08182  Pedibin/Hym-346 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.014        28       9      43 ..     244     279 ..     242     282 .. 0.79

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.014
     PF08182   9 tPvsaeeLkaeiavLq.ekLaaGeDvsheLeekeka 43 
                 t v  e++k e  ++    La   Dv  eL eke+ 
  BAB81143.1 244 TVVRNEDIKTEGDIIHiYDLAVPRDVDKELSEKERV 279
                 55777888888776652579**************85 PP

>> PF11447  Protein of unknown function (DUF3201)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.4   0.7   0.00048      0.99      80     124 ..      26      70 ..      19      88 .. 0.91

  Alignments for each domain:
  == domain 1    score: 11.4 bits;  conditional E-value: 0.00048
                 -HHHHHHHHHH-SEEEEE---TTT--SEETTS-----HHHHHHHT CS
     PF11447  80 seefiedflrafkksfiygaenfledfynsenplsfeevlerike 124
                 +++++ ++l++fk+  i  + n  e ++n ++ +s +e++++i +
  BAB81143.1  26 HKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN 70 
                 5899**************************************987 PP

>> PF00243  Nerve growth factor family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.016        33      14      38 ..     198     222 ..     192     248 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.016
                 EE---B----EEEB----EEEE--- CS
     PF00243  14 svsvwvtdkktavdikGkevtvlee 38 
                 ++   v dk++a d++G+ v+vl+ 
  BAB81143.1 198 CIYLIVRDKSKASDLEGEIVEVLDF 222
                 5667899***************964 PP

>> PF02912  Aminoacyl tRNA synthetase class II, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.037        78      26      52 ..      15      41 ..      13      45 .. 0.90
   2 ?    0.3   0.3       1.9   3.9e+03      30      67 ..     287     324 ..     280     330 .. 0.74

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.037
                TT----SGGG--SS----HHHHHHHHH CS
     PF02912 26 llkkLgklsaeeRkkvGkliNelkekv 52
                +++kL   ++  +k vG+l+N +ke v
  BAB81143.1 15 IREKLALYPKKHKKYVGELLNSFKEVV 41
                67899999****************987 PP

  == domain 2    score: 0.3 bits;  conditional E-value: 1.9
                 --SGGG--SS----HHHHHHHHHTHHHHHHHHHHHTTH CS
     PF02912  30 LgklsaeeRkkvGkliNelkekveealeekkkeLeeae 67 
                 + k++   +k   +++ e+k  vee +ee  + L+  e
  BAB81143.1 287 ISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIRE 324
                 55667777888888999999999999998776666555 PP

>> PF02739  5'-3' exonuclease, N-terminal resolvase-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.2     0.012        26      58      90 ..     290     322 ..     282     340 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.012
     PF02739  58 fDakkktfRkelyeeYKanRektpeelleqipl 90 
                  D k+k+ Rke +eeYK   e+  ee+l+ +++
  BAB81143.1 290 IDDKNKKIRKERMEEYKHIVEESIEEFLNWLKI 322
                 689999********************9987664 PP

>> PF06879  Protein of unknown function (DUF1261)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.028        59      84     121 ..      19      57 ..       9      59 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.028
     PF06879  84 vaadpnkaCkavekatncveqq.fkqaCgkeagywgCea 121
                 +a  p+k+ k+v +++n +++  + ++C+  + y+ C +
  BAB81143.1  19 LALYPKKHKKYVGELLNSFKEVvILNTCNRTEIYFNCTE 57 
                 5556889999************9**************76 PP

>> PF06240  Carbon monoxide dehydrogenase subunit G (CoxG)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.017        35     110     138 ..     353     381 ..     344     383 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.017
                 --CCC----HHHHHHHHHHHHHH---TTT CS
     PF06240 110 gllaqlGsrlidsaarklineffeclask 138
                 g  a+l++r+i+s+a++ +n+++e l+s+
  BAB81143.1 353 GENAKLAERMIKSTADAYVNRAIELLKSE 381
                 66799*******************99987 PP

>> PF08659  KR domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.013        28       8      67 ..     179     241 ..     175     276 .. 0.69

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.013
     PF08659   8 GlgglGlelarwLaergarhlvllsrsaapdeeaea...llaelealgaevtvvaaDvadrda 67 
                 G g++G+ ++++L+++  + + l+ r+++++++ e     + + ++++  ++ v++ v+  +a
  BAB81143.1 179 GYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGeivEVLDFNEKNQVINEVDCIVSCTAA 241
                 79*************************766666554111222333344444444454555555 PP

>> PF04572  Alpha 1,4-glycosyltransferase conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.1     0.024        50      72     132 ..      47     107 ..      42     110 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.024
     PF04572  72 kkwkkfFeeekkeetlklvkesyvvHlwNklskklkveegskvavetLaeqhcpkvykavk 132
                 ++ + +F+ +++ ++ + +++ + v  wN   kk  + ++ k av++L+e  c +  ++++
  BAB81143.1  47 NRTEIYFNCTEEISEDEIFDKIFNVFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILG 107
                 66778999999999999999*********************************98887765 PP

>> PF09836  Uncharacterized protein conserved in bacteria (DUF2063)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0       1.8   3.8e+03      30      77 ..      32      79 ..      14      85 .. 0.78
   2 ?    4.1   0.0      0.15     3e+02      19      48 ..     289     318 ..     277     319 .. 0.82

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.8
                ----HHHHHHHHHHHHHHHHHTTTGGGGS-HHHHHHHH---TTSGGGG CS
     PF09836 30 rrlavYrnlvfnnlteaLeatFpvlkallgeelfealarafvrehppr 77
                + l+ +++ v+ n ++  e  F  ++++ ++e f+++ + f  + + +
  BAB81143.1 32 ELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFNVFNWNDDLK 79
                55667778888888888899999*************999997766655 PP

  == domain 2    score: 4.1 bits;  conditional E-value: 0.15
                 .......--------HHHHHHHHHHHHHHH CS
     PF09836  19 klaeaggasaarrlavYrnlvfnnlteaLe 48 
                 k+ +++++++++r++ Y++ v ++++e+L+
  BAB81143.1 289 KIDDKNKKIRKERMEEYKHIVEESIEEFLN 318
                 667788999*******************95 PP

>> PF04705  Thiostrepton-resistance methylase, N terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.041        85      67     102 ..     148     183 ..     139     190 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.041
                 CC-------B--B-HHHHCCT-------S-E-EEE- CS
     PF04705  67 dlcekreipvrlidasivnqlfkaerkakvfgiarv 102
                   c+  e+pv  ++ si   l+k+ rk  v+g   +
  BAB81143.1 148 TECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEI 183
                 569999***********************9997766 PP

>> PF00106  short chain dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.023        48       8      47 ..     179     216 ..     176     259 .. 0.75

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.023
                 -------HHHHHHHHH.-EEEEEESSS.SHHHHHHHHHHH CS
     PF00106   8 GlgglGlalArwLveegarhlvlvsrredapgaaeliael 47 
                 G g +G+   ++L++++++ ++l+ r+  + +a++l  e+
  BAB81143.1 179 GYGEIGKLAIKHLLSHKVECIYLIVRD--KSKASDLEGEI 216
                 689***********************9..66666663333 PP

>> PF07991  Acetohydroxy acid isomeroreductase, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0      0.06   1.2e+02       5      59 ..     173     227 ..     168     254 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.06
                 --EEEE-------HHHHHHHH----EEE------HHHHHHHH---EE--HHHHHH CS
     PF07991   5 kkiaviGyGsqGhaqalnlrdsgldvvvglregsksvekakkdgfevltveeavk 59 
                 +k  v+GyG  G+   + l   +++ ++ + +++++++  + + +evl+ +e  +
  BAB81143.1 173 RKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEIVEVLDFNEKNQ 227
                 6889**********************99999999888888888888887766433 PP

>> PF01863  Protein of unknown function DUF45
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.5     0.026        55      70     138 ..     265     333 ..     223     379 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.026
     PF01863  70 veegkeasveekreelelavkkeeeaeklrkaleewlkkeakeeleerlakyaeklgvevksvrirdmk 138
                 v ++ +++ +ek++ +  ++ + ++ ++++k++++   +e+k+++ee ++++ ++l+++  s +ir+ k
  BAB81143.1 265 VPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRNIK 333
                 444446677777778888888888889999999999999999999999999999999988888888766 PP

>> PF07741  Brf1-like TBP-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.3     0.045        94      26      88 ..     267     329 ..     260     336 .. 0.66

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.045
                 HHHHHHHHHCCCCT---------------------------------------...---------- CS
     PF07741  26 kdyleeqeakelkaeadaaagaksrkekkqrkakkkkneaspaataaeavkkm...LekkkfskkI 88 
                  d+++e ++ke+   +d  ++ k   + k++k +k+++ +  +    e++++    L+ +++s+kI
  BAB81143.1 267 RDVDKELSEKERVILKDIDEISKI--DDKNKKIRKERM-EEYKHIVEESIEEFlnwLKIREVSSKI 329
                 578888899998888888766554..455556666666.556666666666551115666688888 PP

>> PF10587  Eukaryotic elongation factor 1 beta central acidic region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.6     0.068   1.4e+02      10      25 ..     291     306 ..     291     307 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.068
     PF10587  10 DeEaerireeRLaaYa 25 
                 D++ ++ir eR ++Y+
  BAB81143.1 291 DDKNKKIRKERMEEYK 306
                 77889**********7 PP

>> PF04081  DNA polymerase delta, subunit 4
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   1.9     0.044        93       7      62 ..     257     312 ..     247     344 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.044
     PF04081   7 ikdvfevvvreeskqeekkeeeePkkeeielseleeawnkidaeriaetvhtedlt 62 
                 i ++++  v ++ ++e + +e+   k+ +e+s+++    ki++er+ e  h+ + +
  BAB81143.1 257 IIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEES 312
                 6788999999999999999999999************99********988865433 PP

>> PF07206  Baculovirus late expression factor 10 (LEF-10)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.099   2.1e+02      52      70 ..     115     133 ..     100     134 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.099
     PF07206  52 tdsadkeavsdsSssseLs 70 
                  + a k a+sd S sseL+
  BAB81143.1 115 IKDAYKTAISDNSISSELQ 133
                 4677899***********8 PP

>> PF07295  Protein of unknown function (DUF1451)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.7     0.046        96       5      67 ..     269     331 ..     265     372 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.046
     PF07295   5 lketekksekelkeaiekakealkaaeeltkeelalieeylkrDleefaesveelkekesldl 67 
                 + ++ +++e+ + + i+++ +  ++ +++ ke ++++++ ++  +eef+++ +  + ++++  
  BAB81143.1 269 VDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRN 331
                 566678888999999**********************************99988555555444 PP

>> PF09891  Uncharacterized protein conserved in archaea (DUF2118)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   1.2     0.021        44       9      56 ..     270     317 ..     265     326 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.021
     PF09891   9 EgeeeenlevileeeeevkkflekveekllkgkvvYevildelvdlle 56 
                 + e +e+++vil++ +e+ k+ +k+++ + +  + Y++i++e ++   
  BAB81143.1 270 DKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFL 317
                 55677788******************999999999**99999887655 PP

>> PF03695  Uncharacterised protein family (UPF0149)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.055   1.1e+02     119     172 ..     268     318 ..     255     324 .. 0.67

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.055
                 TTGGG-------HHHHHHHHTT---SS-.-SHHHHHHHHHHHHHHHHHHHHHHH CS
     PF03695 119 eddeelsaeldelledlaaiadlddedeeddeeseelleelpellrvavldlye 172
                 + d+els+  +  l+d+ +i+++dd  +     ++e++ee   ++  ++ ++ +
  BAB81143.1 268 DVDKELSEKERVILKDIDEISKIDDKNKK---IRKERMEEYKHIVEESIEEFLN 318
                 4489999999*************854444...3333333333333346655555 PP

>> PF09358  Ubiquitin-activating enzyme e1 C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0     0.022        46      62     107 ..     191     236 ..     184     251 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.022
     PF09358  62 misvgvkllYssfskekkkerlekkiselveevskkklpeekkyld 107
                  +s++v+++Y  + +++k+ +le +i e++  ++k+++ +e ++++
  BAB81143.1 191 LLSHKVECIYLIVRDKSKASDLEGEIVEVLDFNEKNQVINEVDCIV 236
                 589999****999999***************999998877776664 PP

>> PF08562  Crisp
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1      0.14   2.9e+02      15      31 ..      44      60 ..      39      68 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.14
                -B-SS--SSTTHHHHHH CS
     PF08562 15 NpCeyedkysnCkslkk 31
                N C+ ++ y nC +  +
  BAB81143.1 44 NTCNRTEIYFNCTEEIS 60
                99**********98665 PP

>> PF12212  Piwi/Argonaute/Zwille siRNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.2      0.11   2.3e+02      20      28 ..     276     284 ..     273     287 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.11
                 TTT-EEEET CS
     PF12212  20 kENgiLKDI 28 
                 kE+ iLKDI
  BAB81143.1 276 KERVILKDI 284
                 9*******9 PP

>> PF09449  Domain of unknown function (DUF2020)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.075   1.6e+02      52      90 ..     236     274 ..     197     278 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.075
                 --SSSS-SEEEEEEE-SSHHHHHHHHHHHS-TTTS---- CS
     PF09449  52 wsypeepqltvivremateddaiavvdwaapidstekae 90 
                  s   +p   v   +++te d i + d a p d  ++  
  BAB81143.1 236 VSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELS 274
                 467788999999999****************99776554 PP

>> PF12171  Zinc-finger double-stranded RNA-binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.19   3.9e+02       5      14 ..     140     149 ..     138     149 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.19
                 -HHHHHHHHH CS
     PF12171   5 vaCdkyFkse 14 
                 +aC+k Fk+e
  BAB81143.1 140 IACGKKFKTE 149
                 79******98 PP

>> PF11798  IMS family HHH motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.18   3.8e+02       2      17 ..     310     325 ..     309     325 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.18
                 GGGHHHHH----GGGS CS
     PF11798   2 pddvpefLwplpitdl 17 
                 +++++efL++l+i+++
  BAB81143.1 310 EESIEEFLNWLKIREV 325
                 5899*********996 PP

>> PF04644  Motilin/ghrelin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.23   4.8e+02       6      12 ..     129     135 ..     128     137 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.23
     PF04644   6 ysElQrm 12 
                 +sElQ+m
  BAB81143.1 129 SSELQKM 135
                 9*****9 PP

>> PF09754  PAC2 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.22   4.6e+02       7      21 ..     179     193 ..     177     199 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.22
                 -------HHHHHHHH CS
     PF09754   7 daGnvgqlavdlLid 21 
                 + G++g+la+++L++
  BAB81143.1 179 GYGEIGKLAIKHLLS 193
                 89***********96 PP

>> PF00289  Carbamoyl-phosphate synthase L chain, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.24     5e+02       3      41 ..     173     211 ..     171     225 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.24
     PF00289   3 kkvlvanrGeiavriiralrelgietvavnsnpdtvstd 41 
                 +k +v++ Gei+  +i+ l ++++e++ +   +++++ d
  BAB81143.1 173 RKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASD 211
                 799*******************99999888777776665 PP

>> PF08251  Mastoparan peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.54   1.1e+03       2       6 ..     318     322 ..     317     326 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.54
     PF08251   2 NWLKL 6  
                 NWLK 
  BAB81143.1 318 NWLKI 322
                 ****5 PP

>> PF01145  SPFH domain / Band 7 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.59   1.2e+03      90     144 ..     108     162 ..      71     167 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.59
     PF01145  90 enllrrllesalrevlsqmtldeilsnrselaaelknelneqlqkygievvdvri 144
                 e+++   +++a + ++s+++++  l++  e+a +++++++ +++++ + v +v+i
  BAB81143.1 108 EDQILGQIKDAYKTAISDNSISSELQKMFEIAIACGKKFKTECKMFEVPVSSVSI 162
                 6788889999999********9999999********************9999987 PP

>> PF00123  Peptide hormone
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.1       1.2   2.4e+03      21      27 ..     315     321 ..     314     321 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 1.2
     PF00123  21 kFlqwLm 27 
                 +Fl+wL+
  BAB81143.1 315 EFLNWLK 321
                 7*****7 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (400 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       951  (0.0798355); expected 238.2 (0.02)
Passed bias filter:                      360  (0.0302216); expected 238.2 (0.02)
Passed Vit filter:                        51  (0.0042814); expected 11.9 (0.001)
Passed Fwd filter:                        50  (0.00419745); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              48  [number of targets reported over threshold]
# CPU time: 0.31u 0.04s 00:00:00.35 Elapsed: 00:00:01
# Mc/sec: 2785.68
//