# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_9016.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAB81560.1  [L=219]
Description: cper0 CPE1854 GIB00075CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.3e-38  135.4   0.0    1.6e-38  135.1   0.0    1.0  1  PF01168  Alanine racemase, N-terminal domain
     0.0018   20.2   0.8     0.0029   19.5   0.3    1.5  1  PF02784  Pyridoxal-dependent decarboxylase, pyridoxal bindin
  ------ inclusion threshold ------
      0.051   15.2   0.4      0.079   14.6   0.3    1.3  1  PF09703  CRISPR-associated protein (Cas_Csa4)
       0.35   12.1   0.2       0.44   11.8   0.2    1.1  1  PF04295  D-galactarate dehydratase / Altronate hydrolase, C 
        0.7   12.7   1.2        1.8   11.4   0.3    2.0  1  PF11315  Mediator complex subunit 30
       0.81   11.9   4.5         29    6.9   0.0    2.8  2  PF12347  Holliday junction regulator protein family C-termin
       0.89   11.7   3.6        3.1   10.0   0.3    2.3  2  PF01997  Translin family
        2.1   10.8   0.2        4.6    9.7   0.1    1.6  1  PF00799  Geminivirus Rep catalytic domain
        2.9   10.7   0.4          9    9.1   0.3    1.9  1  PF06260  Protein of unknown function (DUF1024)
        3.5    9.3   0.2        4.5    9.0   0.2    1.2  1  PF02091  Glycyl-tRNA synthetase alpha subunit
        5.4   10.0   0.3         17    8.4   0.0    1.9  1  PF01503  Phosphoribosyl-ATP pyrophosphohydrolase
        5.4    9.3   0.0        9.9    8.4   0.0    1.3  1  PF05729  NACHT domain
        5.5    9.0   3.7        4.4    9.3   0.9    1.9  2  PF10899  Protein of unknown function (DUF2743)
          9    8.4   3.8        9.9    8.3   0.2    2.6  1  PF06162  Caenorhabditis elegans protein of unknown function 
        9.3    8.8   0.0         21    7.6   0.0    1.6  1  PF10733  Protein of unknown function (DUF2525)
         14    7.4   0.0         28    6.4   0.0    1.3  1  PF00777  Glycosyltransferase family 29 (sialyltransferase)
         15    8.4   0.0         34    7.2   0.0    1.6  1  PF07571  Protein of unknown function (DUF1546)
         15    8.4   0.9         37    7.2   0.6    1.6  1  PF06688  Protein of unknown function (DUF1187)
         16    8.1   0.2         35    7.0   0.1    1.6  1  PF06153  Protein of unknown function (DUF970)
         20    6.8   0.0         33    6.1   0.0    1.3  1  PF09950  Uncharacterized protein conserved in bacteria (DUF2
         22    7.4   0.0         48    6.3   0.0    1.7  1  PF10742  Protein of unknown function (DUF2555)
         23    7.7   0.9    1.3e+02    5.2   0.0    2.3  2  PF01984  Double-stranded DNA-binding domain
         29    7.1   2.9         35    6.9   0.1    2.4  1  PF06522  B12D protein
         39    6.5   0.2         83    5.4   0.1    1.4  1  PF07872  Protein of unknown function (DUF1659)
         39    6.0   0.4         51    5.6   0.3    1.2  1  PF02601  Exonuclease VII, large subunit
         41    6.7   4.3         47    6.5   1.0    2.4  1  PF05168  HEPN domain
         42    6.9   0.0         99    5.7   0.0    1.6  1  PF08544  GHMP kinases C terminal
         43    5.0   0.1         56    4.6   0.0    1.2  1  PF04209  homogentisate 1,2-dioxygenase
         44    6.4   0.3         92    5.3   0.2    1.6  1  PF00272  Cecropin family
         44    6.4   0.0         88    5.5   0.0    1.6  1  PF07485  Domain of Unknown Function (DUF1259)
         53    6.4   0.0         97    5.5   0.0    1.5  1  PF02058  Guanylin precursor
         53    7.0   3.2         49    7.1   0.5    2.2  1  PF08609  Nucleotide exchange factor Fes1
         68    5.4   2.1         75    5.3   0.0    2.0  1  PF06417  Protein of unknown function (DUF1077)
         73    5.9   0.1    2.1e+02    4.4   0.0    1.7  1  PF10815  ComZ
         78    5.9   0.3    2.1e+02    4.5   0.1    1.6  1  PF11827  Protein of unknown function (DUF3347)
         79    6.2   0.0    2.3e+02    4.7   0.0    1.8  1  PF00550  Phosphopantetheine attachment site
         97    5.2   0.1    2.2e+02    4.1   0.0    1.5  1  PF05225  helix-turn-helix, Psq domain
    1.3e+02    4.7   0.0    2.1e+02    4.0   0.0    1.2  1  PF01606  Arterivirus envelope protein
    1.3e+02    4.9   0.1      4e+02    3.4   0.0    1.7  1  PF09618  CRISPR-associated protein (Cas_Csy4)
    1.3e+02    5.7   0.2    5.2e+02    3.9   0.0    2.0  1  PF02629  CoA binding domain
    1.5e+02    5.2   0.2    3.5e+02    4.0   0.2    1.6  1  PF11332  Protein of unknown function (DUF3134)
    1.9e+02    4.5   1.1    3.1e+02    3.9   0.1    1.9  1  PF05814  Baculovirus protein of unknown function (DUF843)
    2.2e+02    3.7   0.1    4.5e+02    2.6   0.1    1.5  1  PF01595  Domain of unknown function DUF21
    3.8e+02    3.5   4.5    1.2e+02    5.2   0.6    2.0  1  PF11680  Protein of unknown function (DUF3276)
    4.1e+02    3.6   0.0    9.1e+02    2.5   0.0    1.5  1  PF00486  Transcriptional regulatory protein, C terminal
    5.2e+02    3.1   0.0    8.3e+02    2.4   0.0    1.2  1  PF03188  Eukaryotic cytochrome b561
    1.9e+03    1.2   6.3    1.5e+02    4.7   0.0    2.4  1  PF11637  ATP-dependant DNA helicase UvsW


Domain and alignment annotation for each model:
>> PF01168  Alanine racemase, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  135.1   0.0   7.6e-42   1.6e-38       6     213 ..       3     216 ..       2     217 .. 0.92

  Alignments for each domain:
  == domain 1    score: 135.1 bits;  conditional E-value: 7.6e-42
                 HHHHHHHHHHHS.TS.EEEEE-HHHHCCHHHHHHHHHHHCC--EEEESSHHHHH................HHHHGCEEE-C--TGGGHHHHHHT.TEEE CS
     PF01168   6 lrhniaalreaa.ra.kllaVvKanayghgavrvakalaagadgfgvarlqEal................elrsnkilvlegfepeelaalvey.dlvp 85 
                 +++n++++ e++ ++ +l+aV+K+     + ++ a+ +  g++ fg++++qE +                +l++nk+        + +   v++ +l++
  BAB81560.1   3 IKENLTKFTEKIpSNvQLIAVSKT--RTIEEMEEAY-EF-GIRKFGENKVQEIIrkfdefhqdvewhligHLQTNKV--------KYI---VDKvHLIQ 86 
                 799*********6535********..9999999999.88.9************************************........999...88889*** PP

                 EE-SHHHHHHHHHHHHHTSS-EEEEEBE--SSS..----SHHHHHHHHHHHHCSTTEEEEEEBE--SSTTSSSHHHHHHHHHHHHHHHHHHH--EE-S. CS
     PF01168  86 tvdsleqaealskaakeagrplrvhlkvdtgme..RlGvepeeaeelaealaalpglrleGlmthfaladepdetereqfarfreladeleaaglkpl. 181
                 ++ds +++++++k   ++++ ++ +++v++g e  + G+  ee++el+ea++a++++++ G+mt+ +   e++  ++ +f + ++l+ el+++++k++ 
  BAB81560.1  87 SLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREeqKYGILEEELDELIEAIEACNNVNVLGIMTIIPKGTEEE-CRK-YFSKTHKLFCELKEKKFKNIk 183
                 ********************************9********99*************************98844.666.999999999999666644345 PP

                 ..S-BEE-HHHHHHHGGC..TTEEEE--TT---- CS
     PF01168 182 ..vlslgnSadlllaiahegstmvRpGialyGar 213
                   +ls+g+S+d++ a  +egs+mvR+G  ++G r
  BAB81560.1 184 mdILSMGMSGDYEIAT-EEGSNMVRIGQGIFGKR 216
                 88*************9.89*************87 PP

>> PF02784  Pyridoxal-dependent decarboxylase, pyridoxal binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.5   0.3   1.4e-06    0.0029      82     210 ..      78     195 ..      65     208 .. 0.70

  Alignments for each domain:
  == domain 1    score: 19.5 bits;  conditional E-value: 1.4e-06
                 HHHHT--EEEESSHHHHHHHHHH-TT-EEEEB-B-------TTSSTS-----T---BGGG.HHHHHHHHHHTT.-EE---B--------CCHHHHHHHH CS
     PF02784  82 aleaqvvvvtvdneeeLekvaklapelelllRvkpdvdakahkklstgqedsKFGldlekeaeellkaakele.lklvGvhfhvGSqisdleafvkAve 179
                 ++++   +  +d+ + L+ ++k++ ++        +  a++  +++ g+e++K+G+  e+ ++el++a++  + ++++G+   +  + +  e+  k  +
  BAB81560.1  78 IVDKVHLIQSLDSIKLLKEIEKVYGKH--------NKIANTLIQVNIGREEQKYGILEEE-LDELIEAIEACNnVNVLGIMTIIPKGTE--EECRKYFS 165
                 444444444555555555555555555........2235777889999*********998.***********99********9988765..56677778 PP

                 HHHHHHH---........--SEEE--------T CS
     PF02784 180 earevfeelakelGve..elkiLdvGGGlgvdy 210
                 + +++f+el+++  ++  +++iL++G  +++dy
  BAB81560.1 166 KTHKLFCELKEKK-FKniKMDILSMG--MSGDY 195
                 8888888887443.431147888886..55555 PP

>> PF09703  CRISPR-associated protein (Cas_Csa4)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.6   0.3   3.7e-05     0.079     237     337 ..      18     127 ..       3     149 .. 0.82

  Alignments for each domain:
  == domain 1    score: 14.6 bits;  conditional E-value: 3.7e-05
     PF09703 237 alLyvllltetllEllteskftvlvYgleksgnnqavrsfrelelsklmdfllelkavdfyetiklpklldkl............lredleillrliea 323
                  +L  ++ t+t++E+ +  +f ++ +g+ k+++   +r+f e   ++ +  +++l+      ++  ++l++ l             ++   i+ +li+ 
  BAB81560.1  18 VQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEI--IRKFDEFHQDVEWHLIGHLQTNKVKYIVDKVHLIQSLdsikllkeiekvYGKHNKIANTLIQ- 113
                 588999**************************99..*******9999999999999544444445566666668889889988888888899999999. PP

     PF09703 324 llfededalYsalr 337
                 +  ++e++ Y++l 
  BAB81560.1 114 VNIGREEQKYGILE 127
                 66668999999986 PP

>> PF04295  D-galactarate dehydratase / Altronate hydrolase, C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.2   0.00021      0.44      41     160 ..      55     191 ..      26     193 .. 0.81

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00021
     PF04295  41 fkee.........llpnvdgvvalthqyGcgqlgedlellrrtlaglakhPNvagvlv.vglGCeknqieklaeeiaekge.....kevevleiqee.. 122
                 f+e             + ++v+++ ++    q  + ++ll+++ + ++kh  +a  l+ v +G e+ ++  l+ee++e  e     ++v+vl i     
  BAB81560.1  55 FDEFhqdvewhliGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIqVNIGREEQKYGILEEELDELIEaieacNNVNVLGIMTIip 153
                 333344466654314588889999999999999999999999999******99996655*********9999999777655555688888888887777 PP

     PF04295 123 ggtektiekgvklvkelleeankakreevplseLvvgl 160
                 +gte++ +k  +++++l  e++++k ++++++ L +g+
  BAB81560.1 154 KGTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGM 191
                 8*******************************999998 PP

>> PF11315  Mediator complex subunit 30
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.4   0.3   0.00082       1.8       7      83 ..      42     116 ..      38     149 .. 0.86

  Alignments for each domain:
  == domain 1    score: 11.4 bits;  conditional E-value: 0.00082
     PF11315   7 riGQetvQdivsrlrelFqllrdiqlpngttsqasaaqdklskiqeqlrtlklLlrklrlvyekcneavagleetdv 83 
                 + G + vQ+i+ ++ e  q ++   +    t++ +   dk  ++ + l ++k Ll+ +  vy k n+ ++ l ++++
  BAB81560.1  42 KFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYIVDK-VHLIQSLDSIK-LLKEIEKVYGKHNKIANTLIQVNI 116
                 7899************999998887777788888888888.788899***98.679*********998887777776 PP

>> PF12347  Holliday junction regulator protein family C-terminal repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.2     0.025        53      20      36 ..      44      60 ..      22      62 .. 0.85
   2 ?    6.9   0.0     0.014        29       7      35 ..     105     134 ..      99     136 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.025
     PF12347 20 teekYkeIkeeFDkLhq 36
                +e+k +eI  +FD  hq
  BAB81560.1 44 GENKVQEIIRKFDEFHQ 60
                89**************9 PP

  == domain 2    score: 6.9 bits;  conditional E-value: 0.014
     PF12347   7 kespaPdisva.grteekYkeIkeeFDkLh 35 
                  ++ ++ i+v  gr e kY  ++ee+D L+
  BAB81560.1 105 NKIANTLIQVNiGREEQKYGILEEELDELI 134
                 566677788888***************996 PP

>> PF01997  Translin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1       0.3   6.5e+02       3     185 ..       3      62 ..       1      72 [. 0.48
   2 ?   10.0   0.3    0.0014       3.1      15      82 ..      72     139 ..      65     152 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.3
                 HHHHHHHHHHHHHHHHHHHHHH.GGT-GG..---H.HHHHHCTTHHHHHHHHS-......---HHHHCHHHHHHHHHHHHHHHHHHHHH------HHHH CS
     PF01997   3 rRErlikisrditalskkiifl.vhrida..eeae.eilkeakerlaklsellssvaelqglnyyrysrqlsralqelvealtfahyletqsLlsleev 97 
                 ++E+l+k +++i ++ + i ++  ++i++  e+ e  i k  +++++++  +++                                             
  BAB81560.1   3 IKENLTKFTEKIPSNVQLIAVSkTRTIEEmeEAYEfGIRKFGENKVQEIIRKFD--------------------------------------------- 56 
                 555666666666666555544444444443322223444444444444444444............................................. PP

                 HHH---BSSST---B--HHHHH---HHHHHHHHHHHHHHHH---HHHHHHHHHH--------TTC--.....---------------- CS
     PF01997  98 geilevevnkeeefhvteedYllGlfdltgELmRfavnsvtlgdyekpleileflrelysgfellnlprahkknddlrkKldvlrqsv 185
                                                                                                    + q+v
  BAB81560.1  57 ----------------------------------------------------------------------------------EFHQDV 62 
                 ..................................................................................444444 PP

  == domain 2    score: 10.0 bits;  conditional E-value: 0.0014
                 HHHHHHHHHHGGT-GG---HHHHHHCTTHHHHHHHHS-.......---HHHHCHHHHHHHHHHHHHHHH CS
     PF01997  15 talskkiiflvhridaeeaeeilkeakerlaklsellssva.elqglnyyrysrqlsralqelvealtf 82 
                 t + k i+  vh i++ ++ ++lke+++ + k ++ +++++    g ++++ ++ l+++l el+ea+  
  BAB81560.1  72 TNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIqVNIGREEQK-YGILEEELDELIEAIEA 139
                 5677888888******9999*******************996444455554.589***********865 PP

>> PF00799  Geminivirus Rep catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.1    0.0022       4.6      26      67 ..      40      81 ..      21      93 .. 0.79

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.0022
     PF00799 26 laellkkvekkyikvarelhedGephlhaliqlekkvkitde 67
                +++  +++ ++ i+   e+h+d e+hl   +q++k   i d+
  BAB81560.1 40 IRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYIVDK 81
                666777788889999*****************9987777665 PP

>> PF06260  Protein of unknown function (DUF1024)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.3    0.0042         9      21      65 ..      89     135 ..      84     148 .. 0.60

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0042
     PF06260  21 dteGllkeiedvykkaqafde..ilegltnalqealkedieldeavg 65 
                 d+  llkeie vy k     +  i+  +  + q++   + elde ++
  BAB81560.1  89 DSIKLLKEIEKVYGKHNKIANtlIQVNIGREEQKYGILEEELDELIE 135
                 55679********9977655511333444444444333345555444 PP

>> PF02091  Glycyl-tRNA synthetase alpha subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.2    0.0021       4.5     182     254 ..      28      98 ..       4     123 .. 0.78

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0021
     PF02091 182 tygdifleaevelskynfetadvdlllklfdkyekealkllekelplpaydlvlkashafnlldargaisvte 254
                 t ++  +e+ +e+   +f + +v+ +++ fd+++++ +  l  +l     ++++   h    ld+ + +   e
  BAB81560.1  28 TIEE--MEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIE 98 
                 4433..3455788889999*********************************************988776544 PP

>> PF01503  Phosphoribosyl-ATP pyrophosphohydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.0    0.0078        17      20      47 ..     115     142 ..      94     149 .. 0.67

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0078
     PF01503  20 dpelaalraallvEElvElleAasqgdl 47 
                  + ++ + +  l+EEl+El+eA ++ + 
  BAB81560.1 115 NIGREEQKYGILEEELDELIEAIEACNN 142
                 55666778899***********976555 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.0    0.0047       9.9     113     162 ..      10      55 ..       5      59 .. 0.82

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0047
     PF05729 113 irkkllpeasllltvrpdavrdleeqleeaivlevegfseerrkqlvrky 162
                 +++k+++++ l++ +++++     e +eea+ + ++ f e+++++++rk+
  BAB81560.1  10 FTEKIPSNVQLIAVSKTRTI----EEMEEAYEFGIRKFGENKVQEIIRKF 55 
                 67888899999999999998....4555555677*************997 PP

>> PF10899  Protein of unknown function (DUF2743)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.9    0.0021       4.4      84     152 ..       9      76 ..       2     100 .. 0.79
   2 ?    0.9   0.2      0.78   1.7e+03      69     117 ..      75     138 ..      71     183 .. 0.70

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0021
     PF10899  84 ellkklddvneqefkeetqskleenlelilayiktfdgseyknkkyvkksfyderEWRsvpnfdeieee 152
                 + ++k+ + n q ++ +++  +ee  e++ + i++f ++++++   ++++f+++ EW ++ +++  + +
  BAB81560.1   9 KFTEKIPS-NVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVK 76 
                 45555555.455678889999999999999**********8888889*************999665544 PP

  == domain 2    score: 0.9 bits;  conditional E-value: 0.78
     PF10899  69 VlYvlensellkslre..llkklddvneqe.............fkeetqskleenlelilayik 117
                 V Y+ ++++l++sl +  llk++++v +++              +e++   lee+l ++++ i 
  BAB81560.1  75 VKYIVDKVHLIQSLDSikLLKEIEKVYGKHnkiantliqvnigREEQKYGILEEELDELIEAIE 138
                 6777777777777643115566666555446666666666766666666667777766666665 PP

>> PF06162  Caenorhabditis elegans protein of unknown function (DUF976)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.2    0.0046       9.9      68      98 ..      46      76 ..       8      84 .. 0.81

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0046
     PF06162 68 ekvdeiveelaeeeikvaihlsshslknviq 98
                +kv+ei+ +++e +  v  hl  h++ n ++
  BAB81560.1 46 NKVQEIIRKFDEFHQDVEWHLIGHLQTNKVK 76
                69*************************9875 PP

>> PF10733  Protein of unknown function (DUF2525)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0      0.01        21      18      56 ..       9      48 ..       2      50 .. 0.74

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.01
     PF10733 18 hrteddperv.lvdgrekhTwRELaeaFELDIhDfsvsEv 56
                + te  p++v l+   +  T  E+ ea+E  I+ f+   v
  BAB81560.1  9 KFTEKIPSNVqLIAVSKTRTIEEMEEAYEFGIRKFGENKV 48
                5566666666245666789****************97665 PP

>> PF00777  Glycosyltransferase family 29 (sialyltransferase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.013        28     201     233 ..     134     169 ..     130     184 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.013
     PF00777 201 llalelCdeVsvyGFga...sdrkknwhhYydnvkn 233
                 + a+e C++V+v G ++   ++++++  +Y+++ ++
  BAB81560.1 134 IEAIEACNNVNVLGIMTiipKGTEEECRKYFSKTHK 169
                 6799***********999988888888899998443 PP

>> PF07571  Protein of unknown function (DUF1546)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0     0.016        34      12      53 ..      30      71 ..      18      86 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.016
     PF07571 12 sspeleehwalRdfAAslLskiakkysksykslkprltrtll 53
                ++ e   ++ +R+f  + ++ i++k+++ ++ ++ +l+ +l+
  BAB81560.1 30 EEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQ 71
                4445567899*********************99998887765 PP

>> PF06688  Protein of unknown function (DUF1187)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.6     0.017        37      26      37 ..     156     167 ..     153     181 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.017
     PF06688  26 tkeeCeknlskk 37 
                 t+eeC+k +sk 
  BAB81560.1 156 TEEECRKYFSKT 167
                 99********96 PP

>> PF06153  Protein of unknown function (DUF970)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.1     0.016        35       6      69 ..      83     145 ..      76     169 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.016
     PF06153   6 aivqdkdaeelvkaLtekgfrvtklastGGflkeGnttlliGvedekvdevlsiikekcktreq 69 
                  ++q  d+ +l k++++   +  k+a t   +  G      G+ +e++de++++i+ +c++++ 
  BAB81560.1  83 HLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEELDELIEAIE-ACNNVNV 145
                 5799999*******99999999*********************************6.6777654 PP

>> PF09950  Uncharacterized protein conserved in bacteria (DUF2184)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.015        33      23      72 ..      13      63 ..       7      76 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.015
     PF09950 23 ktespvklwgigygytlqEleaaqalg.rsLdtqKaeaarlaaeekideiv 72
                k  s+v+l++++ + t++E+e+a  +g r+  ++K++ + ++ +e+ +++ 
  BAB81560.1 13 KIPSNVQLIAVSKTRTIEEMEEAYEFGiRKFGENKVQEIIRKFDEFHQDVE 63
                667899********************9457999999999999999988875 PP

>> PF10742  Protein of unknown function (DUF2555)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.023        48      34      57 .]      62      85 ..      42      85 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.023
     PF10742 34 kdwhlLralaiqrpeLvepYihLl 57
                 +whl+  l++++ + + + +hL+
  BAB81560.1 62 VEWHLIGHLQTNKVKYIVDKVHLI 85
                47********************97 PP

>> PF01984  Double-stranded DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.063   1.3e+02      59      94 ..      57      92 ..      51     103 .. 0.89
   2 ?    0.2   0.4       2.2   4.8e+03      62      95 ..     105     139 ..      86     145 .. 0.68

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.063
                HHHHHHHHHHHHHHHHT--SS-B-HHHHHHHHHHHT CS
     PF01984 59 erAeavenqliqlaqsGqirkkvteeqlkelLeqia 94
                e+ ++ve  li   q+++++  v+  +l++ L++i+
  BAB81560.1 57 EFHQDVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIK 92
                6789*************************9999987 PP

  == domain 2    score: 0.2 bits;  conditional E-value: 2.2
                 HHHHHHHHHHHHHT--SS-..B-HHHHHHHHHHHTT CS
     PF01984  62 eavenqliqlaqsGqirkk..vteeqlkelLeqiae 95 
                 +++ n+liq+ + G+ ++k  + ee+l el+e+i+ 
  BAB81560.1 105 NKIANTLIQV-NIGREEQKygILEEELDELIEAIEA 139
                 5666677764.4455444444889999999988875 PP

>> PF06522  B12D protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.1     0.016        35      52      84 ..      29      61 ..      17      63 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.016
     PF06522 52 feeGekyaqhalrkfvrnkrpeimpslnkffsd 84
                 ee e   + ++rkf +nk +ei+  +++f  d
  BAB81560.1 29 IEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQD 61
                46667777899*****************99876 PP

>> PF07872  Protein of unknown function (DUF1659)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1     0.039        83      25      35 ..     175     185 ..     174     186 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.039
     PF07872  25 knktfsnVKpd 35 
                 k k+f+n+K+d
  BAB81560.1 175 KEKKFKNIKMD 185
                 89*******97 PP

>> PF02601  Exonuclease VII, large subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.3     0.024        51     147     271 ..       2     131 ..       1     147 [. 0.85

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.024
     PF02601 147 elkeklknleqrlsralksklekekaklnllknrltlksrrkplskleqeeerleelkerleksleqllqskesqleklnaslaknnpdyklnkkleki 245
                 ++ke+l ++++++ + ++  + ++++++++ ++ +    r+  ++k+++  ++++e  + +e  l   lq+++ ++   + +l+++  + kl k+ ek+
  BAB81560.1   2 DIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKV 100
                 578899999999999999999999999999999999999999888899999999999999999999999999999888789999999999999999999 PP

     PF02601 246 tllkneldsels.....saesklrileeklk 271
                 + ++n+ ++ l      ++e+k+ ilee+l+
  BAB81560.1 101 YGKHNKIANTLIqvnigREEQKYGILEEELD 131
                 8888888888777778877888888887776 PP

>> PF05168  HEPN domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   1.0     0.022        47      57     110 ..      91     143 ..      80     178 .. 0.69

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.022
                 HHHHHTTTTT..S-HHHHHHHHHHHTCSCCCCTCGGS---HHHHHHHHHHHHHH CS
     PF05168  57 reLleelkkelkeseelreelreLekayiesrYpdaeeeteedaeealkkaeev 110
                 ++Ll+e++k  ++ ++++++l  ++  + e  Y+  ee + ++  ea++++ +v
  BAB81560.1  91 IKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEE-ELDELIEAIEACNNV 143
                 67888888888889999999999999999999999998.555555555554443 PP

>> PF08544  GHMP kinases C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.046        99      22      43 ..     117     140 ..      91     148 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.046
     PF08544  22 l..kavvgilspelrellealeel 43 
                    ++ +gil +el+el+ea+e++
  BAB81560.1 117 GreEQKYGILEEELDELIEAIEAC 140
                 14566799************9876 PP

>> PF04209  homogentisate 1,2-dioxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.026        56     104     171 ..     140     207 ..     103     213 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.026
                 ----S----EEEE----CCCT---EEEE--B-S---SEEEEE----EEEEEEE--EEEEE----EEE- CS
     PF04209 104 ekvdfveglatlagagdalsrtglaihvysanksmeeklfynaDgdllivpqqGeldlktefGelevk 171
                  + + v g++t++++g+  + +    +++++  + +ek f n   d+l +  +G  ++ te G+ +v+
  BAB81560.1 140 CNNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGMSGDYEIATEEGSNMVR 207
                 55666889999999999998888889999999999***************************998776 PP

>> PF00272  Cecropin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.2     0.043        92       1       9 [.      92     100 ..      92     104 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.043
     PF00272   1 kifKKiEkv 9  
                 k++K+iEkv
  BAB81560.1  92 KLLKEIEKV 100
                 89******9 PP

>> PF07485  Domain of Unknown Function (DUF1259)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.042        88       2      36 ..      95     129 ..      94     144 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.042
     PF07485   2 aeieeilgrkgkvsegvlkvsiprkdlkvtvdgvk 36 
                 +eie++ g++ k++++ ++v+i r++ k  + + +
  BAB81560.1  95 KEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEE 129
                 789*********************99777666555 PP

>> PF02058  Guanylin precursor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.046        97      25      62 ..      79     116 ..      64     159 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.046
                 EE----EE-SHHHHTTTT--S..S--------T---SS CS
     PF02058  25 vkegdfsfsLesvkkLkdLeeqdaqsprlqkqsvapav 62 
                 v +  +  sL+s+k Lk++e+   ++++++++ +++++
  BAB81560.1  79 VDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNI 116
                 455566779***********998888888888766665 PP

>> PF08609  Nucleotide exchange factor Fes1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.5     0.023        49      65      96 ..     115     147 ..      92     149 .. 0.78

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.023
     PF08609  65 eeatledkliaf.dnfeqLiEnlDNANnleeLk 96 
                 +   +e+k   + +++++LiE ++  Nn++ L+
  BAB81560.1 115 NIGREEQKYGILeEELDELIEAIEACNNVNVLG 147
                 5556677766552579*************9997 PP

>> PF06417  Protein of unknown function (DUF1077)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.035        75      13      40 ..     167     194 ..     156     197 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.035
     PF06417  13 klkkaweialapakslpMnlfmmYmsGn 40 
                 ++k   e+  + +k++ M ++ m msG 
  BAB81560.1 167 THKLFCELKEKKFKNIKMDILSMGMSGD 194
                 567778999999**************95 PP

>> PF10815  ComZ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.096   2.1e+02      44      52 ..      32      40 ..      28      43 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.096
     PF10815 44 mnEAYELGk 52
                m+EAYE G 
  BAB81560.1 32 MEEAYEFGI 40
                9******95 PP

>> PF11827  Protein of unknown function (DUF3347)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.099   2.1e+02      74     132 ..      82     140 ..      69     146 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.099
     PF11827  74 kklaealeavdakklskeeakelkktaekakekdiekqReaFkkLSeeviellkkagas 132
                  +l ++l++++  k +++   +++k+a+  ++ +i  + +++ +L ee+ el++ ++a 
  BAB81560.1  82 VHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEELDELIEAIEAC 140
                 56677788888888888888889999988888899999999999999999999987654 PP

>> PF00550  Phosphopantetheine attachment site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0      0.11   2.3e+02      30      47 ..      86     103 ..      84     115 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.11
     PF00550  30 DSllaveliarleeefgv 47 
                  Sl++++l+ ++e+ +g 
  BAB81560.1  86 QSLDSIKLLKEIEKVYGK 103
                 7*************9985 PP

>> PF05225  helix-turn-helix, Psq domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0       0.1   2.2e+02       3      14 ..     131     142 ..     130     147 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.1
                 HHHHHHHHHHH- CS
     PF05225   3 ealaeAleavrn 14 
                 ++l+eA+ea++n
  BAB81560.1 131 DELIEAIEACNN 142
                 789*******97 PP

>> PF01606  Arterivirus envelope protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0       0.1   2.1e+02      58     106 ..     155     203 ..     142     210 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.1
     PF01606  58 lvseaaaeilepgkslfcrigddrceesdsdeldlsvpdgvdllklegy 106
                 ++ e++++ +   ++lfc + + + ++ + d l++ +  +++  + eg 
  BAB81560.1 155 GTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGMSGDYEIATEEGS 203
                 67788888899999***************************99988886 PP

>> PF09618  CRISPR-associated protein (Cas_Csy4)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.19     4e+02      84     139 ..      11      66 ..       6      80 .. 0.76

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.19
     PF09618  84 vkaVPedvsyvvvkrkqaksskerllrrlvkraeeteeeakkrlpkskekrlklpf 139
                  +++P++v+ ++v++ ++++++e  ++  +++ +e++ +   r+ ++ +++++ + 
  BAB81560.1  11 TEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHL 66 
                 579*****************999999988888766665555555555555655555 PP

>> PF02629  CoA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.24   5.2e+02      50      88 ..       3      41 ..       1      43 [. 0.85

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.24
                EESSHHHHHHHCT-SEEEE-S-HHHHHHHHHHHHH---- CS
     PF02629 50 vyksvdeleekvdvdvavitvPaeeaqeaidelveagik 88
                +++++ +  ek++ +v++i+v++ +  e ++e+ e gi+
  BAB81560.1  3 IKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIR 41
                5667788888889*******************9998875 PP

>> PF11332  Protein of unknown function (DUF3134)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.2      0.16   3.5e+02      32      59 ..     109     136 ..     106     143 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.16
     PF11332  32 GRLiareeselqeesteeeeeiseLige 59 
                 + Li+ +   +++++   eee++eLi+ 
  BAB81560.1 109 NTLIQVNIGREEQKYGILEEELDELIEA 136
                 567878888877889999********86 PP

>> PF05814  Baculovirus protein of unknown function (DUF843)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1      0.15   3.1e+02      54      76 ..      69      91 ..      65      96 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.15
     PF05814 54 dlytekakkikKkrdledafDai 76
                +l+t+k+k i  k +l + +D+i
  BAB81560.1 69 HLQTNKVKYIVDKVHLIQSLDSI 91
                79*******************98 PP

>> PF01595  Domain of unknown function DUF21
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.21   4.5e+02     141     176 ..     105     140 ..     104     145 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.21
     PF01595 141 skllnlllrllgvkpeeepavteeelralveeseee 176
                 +k++n l++++  ++e++  + eeel++l+e+ e  
  BAB81560.1 105 NKIANTLIQVNIGREEQKYGILEEELDELIEAIEAC 140
                 68999999999999999999**********988765 PP

>> PF11680  Protein of unknown function (DUF3276)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.6     0.054   1.2e+02      64     122 ..       4      62 ..       3      64 .. 0.69

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.054
     PF11680  64 kedfekFeealeeaieyikkekgeeviserhekdekkeekekeeeeekskedeekktdv 122
                 ke+++kF+e++   ++ i  +k++++++ +   ++  ++  +++ +e  ++ +e ++dv
  BAB81560.1   4 KENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDV 62 
                 8******************9988877776666666555554444444445555555555 PP

>> PF00486  Transcriptional regulatory protein, C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.43   9.1e+02      31      52 ..      97     118 ..      94     124 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.43
                 HHHHHTT-SSSHCHHHHHHHHH CS
     PF00486  31 leevwgeefevddntvdvhisr 52 
                 +e+v+g++ + +++ ++v+i r
  BAB81560.1  97 IEKVYGKHNKIANTLIQVNIGR 118
                 699*****************87 PP

>> PF03188  Eukaryotic cytochrome b561
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.39   8.3e+02      88     114 ..     145     171 ..     137     174 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.39
     PF03188  88 llGfvlflapklskkirslllplHvll 114
                 +lG+++++ +++++++r+ ++++H l+
  BAB81560.1 145 VLGIMTIIPKGTEEECRKYFSKTHKLF 171
                 789*****999*************987 PP

>> PF11637  ATP-dependant DNA helicase UvsW
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.071   1.5e+02      10      22 ..      94     106 ..      85     113 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.071
     PF11637  10 leElEkyYekrkK 22 
                 l+E+Ek Y k  K
  BAB81560.1  94 LKEIEKVYGKHNK 106
                 89*******9988 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (219 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       717  (0.0601914); expected 238.2 (0.02)
Passed bias filter:                      384  (0.0322364); expected 238.2 (0.02)
Passed Vit filter:                        47  (0.0039456); expected 11.9 (0.001)
Passed Fwd filter:                        47  (0.0039456); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              47  [number of targets reported over threshold]
# CPU time: 0.24u 0.06s 00:00:00.30 Elapsed: 00:00:01
# Mc/sec: 1970.00
//