hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_9001.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAB80033.1
Accession:      [none]
Description:    cper0 lacB GIB00075CH01 "galactose-6-phosphate isomerase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0044504  Ribose/Galactose isomerase RpiB/AlsB           161.6    2.4e-51   1
0041667  Ribose/Galactose isomerase RpiB/AlsB           149.8    2.6e-44   1
0041466  Ribose/Galactose isomerase RpiB/AlsB           155.9    5.1e-44   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0041466    1/1       1   146 [.     1   159 []   155.9  5.1e-44
0041667    1/1       1   144 [.     1   145 []   149.8  2.6e-44
0044504    1/1       1   155 [.     1   157 []   161.6  2.4e-51

Alignments of top-scoring domains:
0041466: domain 1 of 1, from 1 to 146: score 155.9, E = 5.1e-44
                   *->eleeelleeelellmkiaigsdhaglelkellleyLeekgyevidlG
                                    mkiaig+dh+ ++ k ++ ++L++kgy+v+d+G
  BAB80033.1     1    --------------MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVG 33   

                   tlsdesvdYpdlalavaeavasgeadlgilicgtGiGvsiaankvkgirA
                   t++ ++++Yp ++++v+eavasgeadlg++icgtG+G+  a+nkv+gir+
  BAB80033.1    34 TYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRS 83   

                   AlvldelsAllarehnnanvlalggrvvglelaleivdafletefeg.gr
                   Alv d+++A++a+e  nanv+ +gg ++g  l+++i++af+++++ +++ 
  BAB80033.1    84 ALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIEnEE 133  

                   harrvdkisklekllmkiaigsdhaglelkelllelLkekgyevidlGtlsdesvdYpdl
                        mkiaig+dh+ ++ k ++ ++Lk+kgy+v+d+Gt++ ++++Yp +
  BAB80033.1     1    --MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIF 45   

                   alavaeavasgeadlgilicgtGiGvsiaankvkgirAAlvldelsAlla
                   +++v+eavasgeadlg++icgtG+G+  a+nkv+gir+Alv d+++A++a
  BAB80033.1    46 GKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYA 95   

                   rehnnanvlalggrvvglelaleivdafletefeg.grhaervdkldel<
                   +e  nanv+ +gg ++g  l+++i++af+++++ +++ +++ ++k+++l 
  BAB80033.1    96 KEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIEnEENKKIINKINSL  144  

                   -*
                     
  BAB80033.1     -    -    

0044504: domain 1 of 1, from 1 to 155: score 161.6, E = 2.4e-51
                   *->lmkiaigsdhaglelkelllelLkekgyevidlGtlsedasvdYpdl
                       mkiaig+dh+ ++ k ++ ++Lk+kgy+v+d+Gt++ + +++Yp +
  BAB80033.1     1    -MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFT-RTHYPIF 45   

                   alavaeavasgeadlgilicgtGiGvsiaankvkgirAAlvldelsAlla
                   +++v+eavasgeadlg++icgtG+G+  a+nkv+gir+Alv d+++A++a
  BAB80033.1    46 GKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYA 95   

                   rehnnanvlalgarvvglelalnivdafletefseggrharrvdkisele
                   +e  nanv+++g++++g  l+++i++af+++++ e++++ + ++ki++le
  BAB80033.1    96 KEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINKINSLE 145  

                   naglleelke