hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_9002.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAB80140.1
Accession:      [none]
Description:    cper0 CPE0434 GIB00075CH01 "hypothetical protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050940  Acyl-CoA N-acyltransferases (Nat)               44.1      6e-14   1
0049032  Acyl-CoA N-acyltransferases (Nat)               48.3    1.1e-13   1
0051493  Acyl-CoA N-acyltransferases (Nat)               44.0    2.7e-13   1
0052829  Acyl-CoA N-acyltransferases (Nat)               43.1    7.5e-13   1
0052858  Acyl-CoA N-acyltransferases (Nat)               46.8    9.4e-13   1
0052040  Acyl-CoA N-acyltransferases (Nat)               46.5    9.8e-13   1
0046158  Acyl-CoA N-acyltransferases (Nat)               44.2    1.2e-12   1
0047280  Acyl-CoA N-acyltransferases (Nat)               46.3    1.7e-12   1
0048674  Acyl-CoA N-acyltransferases (Nat)               44.8    2.2e-12   1
0051420  Acyl-CoA N-acyltransferases (Nat)               42.3    2.6e-12   1
0051751  Acyl-CoA N-acyltransferases (Nat)               44.1    2.7e-12   1
0046177  Acyl-CoA N-acyltransferases (Nat)               41.2      3e-12   1
0051252  Acyl-CoA N-acyltransferases (Nat)               42.4    3.5e-12   1
0052713  Acyl-CoA N-acyltransferases (Nat)               42.7    3.6e-12   1
0050185  Acyl-CoA N-acyltransferases (Nat)               42.9    4.5e-12   1
0051915  Acyl-CoA N-acyltransferases (Nat)               39.6    7.8e-12   1
0048876  Acyl-CoA N-acyltransferases (Nat)               39.3    1.3e-11   1
0049031  Acyl-CoA N-acyltransferases (Nat)               43.6    1.4e-11   1
0051248  Acyl-CoA N-acyltransferases (Nat)               40.1    1.8e-11   1
0051377  Acyl-CoA N-acyltransferases (Nat)               38.0    1.9e-11   1
0051303  Acyl-CoA N-acyltransferases (Nat)               40.5    1.9e-11   1
0048084  Acyl-CoA N-acyltransferases (Nat)               39.7    2.2e-11   1
0051437  Acyl-CoA N-acyltransferases (Nat)               38.0    2.5e-11   1
0049641  Acyl-CoA N-acyltransferases (Nat)               40.5    3.2e-11   1
0050733  Acyl-CoA N-acyltransferases (Nat)               41.2    3.3e-11   1
0049804  Acyl-CoA N-acyltransferases (Nat)               39.2    4.5e-11   1
0050223  Acyl-CoA N-acyltransferases (Nat)               40.1    4.8e-11   1
0051830  Acyl-CoA N-acyltransferases (Nat)               43.7      5e-11   1
0052704  Acyl-CoA N-acyltransferases (Nat)               40.5    5.7e-11   1
0048174  Acyl-CoA N-acyltransferases (Nat)               40.0    8.4e-11   1
0052347  Acyl-CoA N-acyltransferases (Nat)               39.8    9.3e-11   1
0049884  Acyl-CoA N-acyltransferases (Nat)               41.6    1.1e-10   1
0049311  Acyl-CoA N-acyltransferases (Nat)               37.8    1.4e-10   1
0052874  Acyl-CoA N-acyltransferases (Nat)               40.0    1.7e-10   1
0043712  Acyl-CoA N-acyltransferases (Nat)               39.5      2e-10   1
0046988  Acyl-CoA N-acyltransferases (Nat)               35.5    2.8e-10   1
0053292  Acyl-CoA N-acyltransferases (Nat)               38.7    2.8e-10   1
0052522  Acyl-CoA N-acyltransferases (Nat)               38.0      4e-10   1
0051492  Acyl-CoA N-acyltransferases (Nat)               36.4    4.4e-10   1
0051232  Acyl-CoA N-acyltransferases (Nat)               36.9    8.5e-10   1
0052754  Acyl-CoA N-acyltransferases (Nat)               33.1      1e-09   1
0053076  Acyl-CoA N-acyltransferases (Nat)               36.2    1.6e-09   1
0045896  Acyl-CoA N-acyltransferases (Nat)               36.4    1.7e-09   1
0043128  Acyl-CoA N-acyltransferases (Nat)               37.1    1.8e-09   1
0051375  Acyl-CoA N-acyltransferases (Nat)               33.6    2.7e-09   1
0052701  Acyl-CoA N-acyltransferases (Nat)               34.8    2.7e-09   1
0051421  Acyl-CoA N-acyltransferases (Nat)               31.9    3.7e-09   1
0048433  Acyl-CoA N-acyltransferases (Nat)               33.4    5.5e-09   1
0045986  Acyl-CoA N-acyltransferases (Nat)               34.0    6.5e-09   1
0052664  Acyl-CoA N-acyltransferases (Nat)               35.5    7.8e-09   1
0052652  Acyl-CoA N-acyltransferases (Nat)               28.7    2.4e-08   1
0051777  Acyl-CoA N-acyltransferases (Nat)               31.0    2.8e-08   1
0049338  Acyl-CoA N-acyltransferases (Nat)               24.5    2.4e-06   1
0049219  Acyl-CoA N-acyltransferases (Nat)               23.5    2.7e-06   1
0051326  Acyl-CoA N-acyltransferases (Nat)               15.8    0.00088   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0048084    1/1      19   164 .]     1   181 []    39.7  2.2e-11
0051377    1/1      20   164 .]     1   183 []    38.0  1.9e-11
0052652    1/1      20   161 ..     1   178 []    28.7  2.4e-08
0046177    1/1      23   161 ..     1   163 []    41.2    3e-12
0046158    1/1      24   164 .]     1   166 []    44.2  1.2e-12
0047280    1/1      25   161 ..     1   157 []    46.3  1.7e-12
0051751    1/1      25   161 ..     1   161 []    44.1  2.7e-12
0048674    1/1      26   161 ..     1   308 []    44.8  2.2e-12
0050733    1/1      26   161 ..     1   157 []    41.2  3.3e-11
0051252    1/1      26   161 ..     1   140 []    42.4  3.5e-12
0052704    1/1      26   161 ..     1   156 []    40.5  5.7e-11
0052829    1/1      26   161 ..     1   137 []    43.1  7.5e-13
0052858    1/1      26   161 ..     1   182 []    46.8  9.4e-13
0049031    1/1      27   160 ..     1   139 [.    43.6  1.4e-11
0049311    1/1      27   161 ..     1   147 []    37.8  1.4e-10
0050223    1/1      27   161 ..     1   149 []    40.1  4.8e-11
0051493    1/1      27   161 ..     1   162 []    44.0  2.7e-13
0052713    1/1      27   161 ..     1   146 []    42.7  3.6e-12
0052874    1/1      27   163 ..     1   164 []    40.0  1.7e-10
0053076    1/1      27   161 ..     1   160 []    36.2  1.6e-09
0049641    1/1      28   161 ..     1   173 []    40.5  3.2e-11
0049884    1/1      28   161 ..     1   155 []    41.6  1.1e-10
0050185    1/1      28   164 .]     1   165 []    42.9  4.5e-12
0051830    1/1      28   161 ..     1   137 []    43.7    5e-11
0051915    1/1      28   161 ..     1   167 []    39.6  7.8e-12
0053292    1/1      28   161 ..     1   167 []    38.7  2.8e-10
0048174    1/1      29   161 ..     1   127 [.    40.0  8.4e-11
0048876    1/1      29   161 ..     1   140 []    39.3  1.3e-11
0050940    1/1      29   161 ..     1   149 []    44.1    6e-14
0051232    1/1      29   160 ..     1   133 []    36.9  8.5e-10
0051248    1/1      29   161 ..     1   152 []    40.1  1.8e-11
0052522    1/1      29   161 ..     1   153 []    38.0    4e-10
0045896    1/1      30   162 ..     1   181 []    36.4  1.7e-09
0045986    1/1      30   158 ..     1   137 []    34.0  6.5e-09
0049032    1/1      30   161 ..     1   160 []    48.3  1.1e-13
0051303    1/1      30   163 ..     1   164 []    40.5  1.9e-11
0051375    1/1      30   163 ..     1   163 []    33.6  2.7e-09
0051492    1/1      30   162 ..     1   150 []    36.4  4.4e-10
0052347    1/1      30   164 .]     1   174 []    39.8  9.3e-11
0052664    1/1      30   161 ..     1   156 []    35.5  7.8e-09
0051777    1/1      31   144 ..     1   118 []    31.0  2.8e-08
0051437    1/1      33   161 ..     1   151 []    38.0  2.5e-11
0049219    1/1      35   161 ..     1   161 [.    23.5  2.7e-06
0052040    1/1      35   161 ..     1   145 []    46.5  9.8e-13
0051420    1/1      39   161 ..     1   152 []    42.3  2.6e-12
0051421    1/1      40   163 ..     1   169 []    31.9  3.7e-09
0043712    1/1      41   161 ..   111   297 .]    39.5    2e-10
0048433    1/1      42   164 .]     1   180 []    33.4  5.5e-09
0052754    1/1      42   162 ..     1   164 []    33.1    1e-09
0049338    1/1      44   161 ..     1   174 []    24.5  2.4e-06
0052701    1/1      49   161 ..     1   157 []    34.8  2.7e-09
0046988    1/1      58   161 ..     1   145 [.    35.5  2.8e-10
0043128    1/1      66   161 ..     1   102 []    37.1  1.8e-09
0049804    1/1      76   161 ..    57   189 .]    39.2  4.5e-11
0051326    1/1      84   161 ..    90   198 .]    15.8  0.00088

Alignments of top-scoring domains:
0048084: domain 1 of 1, from 19 to 164: score 39.7, E = 2.2e-11
                   *->plpmmllmmditirpatpedldallallaaaf.pepfseafaeelld
                       +++++l++++++  ++ +d + ++ + + a +  ++ +a+++++ +
  BAB80140.1    19    KIYSTSLPDGYRFTDFRIGDENNWAYIQYSAGvFKDYQLAIRRIFKE 65   

                   g.........lvlvaed.dgrvvGfaallplrlliggrggrvgyiegvaV
                   ++  + + +++++ +e ++g+ +G+++++p  +       +v +i  +a 
  BAB80140.1    66 EnslkgnfknRCVFLENeNGERIGTIMIVPSLSE----EEGVQEIKYLAL 111  

                   hpdyRGqGlGsaLldaaeeeare..garrlvLev.naaarrfYerlGFvp
                   +p y+ qGlG+ L+++a +   +++ga+r+ Le++n+ ++ ++e+lGF++
  BAB80140.1   112 LPKYQEQGLGKLLISKAYKMVDDveGATRINLEAyNDKSIVLFENLGFER 161  

                   vgelvyyylgiphvnmrgedallmvkplspplplldllgldlregdlwMpptleterltlRpatpeDleallallaeapevlrylpplseeelle
                      +  t  ++ +++  ++++D   ++ +  +a        + + + +++
  BAB80140.1    20    IYSTSLPDGYRFTDFRIGDENNWAYIQYSAG------VFKDYQLAIR 60   

                   rlrellad....pgslflvaed.dgelvGfaglrpid.agegvaeigyla
                   r+ +  ++ + +   +++ +e+++ge +G+++++p   ++egv ei yla
  BAB80140.1    61 RIFKEENSlkgnFKNRCVFLENeNGERIGTIMIVPSLsEEEGVQEIKYLA 110  

                   vdpeyrGkGiGtallealleyafrelglrrlvlevdadNeaairlyeklG
                   ++p+y+ +G+G+ l+  + +   +  g++r+ le++ d  ++i l+e lG
  BAB80140.1   111 LLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYND--KSIVLFENLG 158  

                   FeevgelrdyyllpdgrlrdavlmsllleewlalkaalelelmlpmptleterliLrpltleDaeallell.sdpevlrylplrvpppl
                                   +   +l D   + ++++ d+  + y+ + ++ + 
  BAB80140.1    20    -------------IYSTSLPDGYRFTDFRiGDENNWAYIQYSAGVFK 53   

                   sleeareflerllalyasggalvfaiedkedgeliGfiglrridpen.gt
                   +++ a +++ +  +  + +   + +  ++e+ge iG+i++++   e +g+
  BAB80140.1    54 DYQLAIRRIFKEENSLKGNFKNRCVFLENENGERIGTIMIVPSLSEEeGV 103  

                   aeig.ywlapeyqgkGyatealkalldyafeelglhrieatvdpdNlaSi
                    ei +++l p+yq +G+++ ++  + + + ++ g++ri ++++ d  +Si
  BAB80140.1   104 QEIKyLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYND--KSI 151  

                   rvyeklGFrlegtlrdyllingrwrdtvlysllrkmiemrltirpatpeDleallellreafaefypelpplsleelrell
                      + ++ ++++  +++ D + ++ +   a ++  ++l  + +   ++ l
  BAB80140.1    23    TSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSL 69   

                   adp..galflvaeddgelvGfarlrpdgde..rvaeigrlaVdpeyrgkG
                   + + +++++++  ++ge +G+++++p  +e+++v ei +la++p+y+ +G
  BAB80140.1    70 KGNfkNRCVFLENENGERIGTIMIVPSLSEeeGVQEIKYLALLPKYQEQG 119  

                   iGraLleallelarer.glkrlvlevdne.airfYeklGFevvgelpdyy
                   +G+ L+ ++ +   + +g++r+ le+ n+++i ++e+lGFe+        
  BAB80140.1   120 LGKLLISKAYKMVDDVeGATRINLEAYNDkSIVLFENLGFER-------- 161  

                   llgylgdgedavlmvkllsdglpttmri.tirpatpeDleallallreafvelpldpplsledlrelle
                       ++++ +++  +++ D   ++ + ++a v+          ++r+ ++
  BAB80140.1    24    -SLPDGyRFTDFRIGDENNWAYIQYSAGVF-----KDYQLAIRRIFK 64   

                   dp.......galllvaed.dgelvGfarlrpldsllllllllllllpggd
                   + +  + +   +++ +e ++ge +G+++++p  s+            +++
  BAB80140.1    65 EEnslkgnfKNRCVFLENeNGERIGTIMIVPSLSE------------EEG 102  

                   vaeigrlavdpeyrgkGiGraLleallelarerlglrrlvlev.neaair
                   v ei +la++p+y+ +G+G+ L+ ++ +   +  g++r+ le++n+ +i 
  BAB80140.1   103 VQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAyNDKSIV 152  

                   fYeklGFevvgelryyldgedavlmekelmterltirpatpeDlpallallreafveeellpdleplsleelrall
                       ++++++  ++++D   ++ + ++a v     + +++l + ++ +  
  BAB80140.1    25    LPDGYRFTDFRIGDENNWAYIQYSAGV-----FKDYQLAIRRIFKEE 66   

                   eallalllldpgalflvaedeedgelvGfaglrplpdpvlglggvaeigd
                   ++l      +   +++ +e e +ge +G+++++p  ++ ++ +gv ei +
  BAB80140.1    67 NSLKG----NFKNRCVFLENE-NGERIGTIMIVP--SLSEE-EGVQEIKY 108  

                   lavdpeyrgkGiGraLleallelarel.glrrlvlev.neaairfYeklG
                   la++p+y+ +G+G+ L+ ++ +   + +g++r+ le++n+ +i ++e lG
  BAB80140.1   109 LALLPKYQEQGLGKLLISKAYKMVDDVeGATRINLEAyNDKSIVLFENLG 158  

                   FeevgelrlyygmtmditirpatpeDleallallneafaelylfllspesleallerll
                      +++++++  ++++D + ++ + ++a ++        +++ a+++ ++
  BAB80140.1    25    LPDGYRFTDFRIGDENNWAYIQYSAGVF-------KDYQLAIRRIFK 64   

                   .........pgalflvaeddgelvGfallspidslpgggtaeieglaVdp
                   +++  + + +++++++  ++ge +G+++++p  s++ +g+ ei  la++p
  BAB80140.1    65 eenslkgnfKNRCVFLENENGERIGTIMIVPSLSEE-EGVQEIKYLALLP 113  

                   eyrgkGiGsaLleallelare.lglkrlylevladNeaairfYeklGFve
                   +y+ +G+G+ L++++ ++  ++ g++r+ le++ d  ++i ++e+lGF++
  BAB80140.1   114 KYQEQGLGKLLISKAYKMVDDvEGATRINLEAYND--KSIVLFENLGFER 161  

                   vgelrdyyliggeyedavlmeklLmmeiirpltpadldallellaaagpadglavvellvllellgplldr
                                                                     
  BAB80140.1     -    ----------------------------------------------- -    

                   gtlfvalddgelvGfialipygepfafigllivhpdyrgrGigralleaa
                                                                     
  BAB80140.1     - -------------------------------------------------- -    

                   lerlpgrplvllpeanpallalleklgfrlarellrmqldlpplppplet
                                                                    +
  BAB80140.1    26 -------------------------------------------------P 26   

                   erltiRpatperDleallallaeafveeydppplsleelralleell...
                   +++++  ++   D   ++ + ++a v      + + + + +++ +  +  
  BAB80140.1    27 DGYRFTDFRIG-DENNWAYIQYSAGV------FKDYQLAIRRIFKEEnsl 69   

                   ..dpgglflvaedkedgdgdgeivGfaglrpdddgp.rvaeigylaVdpe
                   + +   +++ +e++     +ge +G+++++p  +++++v ei yla++p+
  BAB80140.1    70 kgNFKNRCVFLENE-----NGERIGTIMIVPSLSEEeGVQEIKYLALLPK 114  

                   yrGkGiGraLlrallveyare.lGlrrsllgslllgiylevdpdNeaair
                   y+ +G+G+ L+ ++  +   +++G++r         i le++  N  +i 
  BAB80140.1   115 YQEQGLGKLLISKAY-KMVDDvEGATR---------INLEAY--NDKSIV 152  

                   lYeklGFeevgelrdYaltmrltirpatpeDleallallreafaellallglpplseeeseeflr
                      ++++++  +++ D   ++ + ++a              + +++  +r
  BAB80140.1    26    PDGYRFTDFRIGDENNWAYIQYSA------------GVFKDYQLAIR 60   

                   ellad.......pgalllvaed.dgelvGfaglrpdddetgggrpvaeig
                   +++++++  + +   +++ +e ++ge +G+++++p   e++g     ei 
  BAB80140.1    61 RIFKEenslkgnFKNRCVFLENeNGERIGTIMIVPSLSEEEGV---QEIK 107  

                   ylavdpeyrgkGiGraLlealleyarel.g.rrlvlevladNeaairlYe
                   yla++p+y+ +G+G+ L+ ++ +   + +g++r+ le++  N  +i l+e
  BAB80140.1   108 YLALLPKYQEQGLGKLLISKAYKMVDDVeGaTRINLEAY--NDKSIVLFE 155  

                   klGFevvgelgdyydlllkQmmditirpatpedleallelllel..fpeeys..leelle.......
                      ++++++  ++++d + ++ + +++ +f +++ ++++ ++e++  + +
  BAB80140.1    26    PDGYRFTDFRIGDENNWAYIQYSAgvFKDYQLaiRRIFKEenslkgn 72   

                   lpgalllvaeddgeivGfallrplg....dvaeierlaVdpeyrgkGiGs
                    +++ +++  ++ge +G+++++p   ++++v ei +la +p+y+ +G+G+
  BAB80140.1    73 FKNRCVFLENENGERIGTIMIVPSLseeeGVQEIKYLALLPKYQEQGLGK 122  

                   aLlealeelaker.gcrrlllevlneaairfYeklGFeevgeiedyydge
                   +L+ ++ +   + +g++r+ le++n  +i ++e+lGFe+           
  BAB80140.1   123 LLISKAYKMVDDVeGATRINLEAYNDKSIVLFENLGFER----------- 161  

                   dallmekeLpmditirpatpeDlpallallraafretyalllsaeqlealldeaes
                      p+++++  ++++D + ++ + + a +   + l       a+ +    
  BAB80140.1    26    PDGYRFTDFRIGDENNWAYIQYSAGVFKDYQL-------AIRRIFKE 65   

                   lerlrellpgalvlvaeddgeivGfaal.......ggvaeierlyVhpdy
                   ++ l+  + ++ v++  ++ge +G+++++    +++gv ei +l+++p y
  BAB80140.1    66 ENSLKGNFKNRCVFLENENGERIGTIMIvpslseeEGVQEIKYLALLPKY 115  

                   rgrGiGraLlealeelarer.garrltlev.neaairfYeklGFvvvgel
                   + +G+G++L+  + ++  + +ga+r+ le++n+ +i ++e lGF++    
  BAB80140.1   116 QEQGLGKLLISKAYKMVDDVeGATRINLEAyNDKSIVLFENLGFER---- 161  

                   elyyggegldlvlmvkrLmmditirpatpedleallallaeafaeelallll.............
                      ++++++  ++ +d + ++ + ++a  +  + l    + ++++  + +
  BAB80140.1    26    PDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIrrifkeenslkgn 72   

                   .pgalllvaeddgeivGfalllpl....ggvayieslaVdpeyrgqGiGr
                    +++++++  ++ge +G+++++p   +++gv +i +la++p+y+ qG+G+
  BAB80140.1    73 fKNRCVFLENENGERIGTIMIVPSlseeEGVQEIKYLALLPKYQEQGLGK 122  

                   aLleaaeeearer.glkrlylevdnpaairlYeklGFevvgelplygggl
                    L+  a +   + +g++r+ le++n  +i l+e+lGFe+           
  BAB80140.1   123 LLISKAYKMVDDVeGATRINLEAYNDKSIVLFENLGFER----------- 161  

                   dallmekrLmmnitirpatpeDleailellreafrdtyafllspevlealgfdegl
                      ++++++  ++++D + ++ + ++a                 g + ++
  BAB80140.1    26    PDGYRFTDFRIGDENNWAYIQYSA-----------------GVFKDY 55   

                   plseaeslerlrelledpgglflvaedd.gkivGfialspdgvlllglll
                    l ++++ ++  +l  +   +++ +e+++g+ +G+i+++p          
  BAB80140.1    56 QLAIRRIFKEENSLKGNFKNRCVFLENEnGERIGTIMIVPS--------- 96   

                   llsllpggkvaeigrlaVdpeyrGkGiGsaLleaalerakel.Glkriyl
                      l ++++v ei +la +p+y+ +G+G+ L+ +a ++  + +G++ri l
  BAB80140.1    97 ---LSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVeGATRINL 143  

                   evdeNeaairfYeklGFeevgelelyygggeylmvkeerltirpatpeDleallallneafeallgllppptleellerlle..
                      +++++  ++++D   ++ + ++a         + + + +++r+++++
  BAB80140.1    27    DGYRFTDFRIGDENNWAYIQYSAG-------VFKDYQLAIRRIFKee 66   

                   ....adpgglllvaedkedgelvGfaglrpidslllgggvaeigylavdp
                   +  + +   +++ +e + +ge +G+++++p  s++  +gv ei yla++p
  BAB80140.1    67 nslkGNFKNRCVFLENE-NGERIGTIMIVPSLSEE--EGVQEIKYLALLP 113  

                   eyrgkGiGraLlealleyarel.glkrlvlevlpdNeaairlYeklGFe<
                   +y+ +G+G+ L+ ++ +   + +g++r+ le++ d   +i l+e+lGFe 
  BAB80140.1   114 KYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFE  160  

                   -*
                     
  BAB80140.1     -    -    

0049311: domain 1 of 1, from 27 to 161: score 37.8, E = 1.4e-10
                   *->mrltirpatpeDleallallaeafpelgeplsleelrellad.....
                      + +++  +++ D + ++ + + a  + ++ l + ++ +  ++ + + 
  BAB80140.1    27    DGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSlkgnf 73   

                   pgalllvaeddgelvGfaglslldslllgldgggvaeieglyVlpeyrgr
                   ++ ++++  ++ge +G++++++         ++gv ei  l++lp+y+ +
  BAB80140.1    74 KNRCVFLENENGERIGTIMIVPSL-----SEEEGVQEIKYLALLPKYQEQ 118  

                   GiGraLlaallewarer.GarrlvlevlpdNtaairlYeklGFeevgrle
                   G+G+ L++ + +   + +Ga+r+ le++ d   +i l+e+lGFe+     
  BAB80140.1   119 GLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER----- 161  

                   dyyldgm.itirpa.peDlpallallreafvellallllaplseelslerlre
                      + +++  + ++D   ++ + + a v         + +++l+++r+ +
  BAB80140.1    27    DgYRFTDFrIGDENNWAYIQYSAGV---------FKDYQLAIRRIFK 64   

                   llad....pgglllvaedddGelvGfaglrpdddlplgggvaeigdlavd
                     ++ + +   +++ +e ++Ge +G+++++p  +++   gv ei +la++
  BAB80140.1    65 EENSlkgnFKNRCVFLENENGERIGTIMIVPSLSEEE--GVQEIKYLALL 112  

                   peyrgkGiGraLleallelarel.glrrlvlevlpdNaairlYeklGFev
                   p+y+ +G+G+ L+ ++ +   + +g++r+ le++ d  +i l+e+lGFe+
  BAB80140.1   113 PKYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND-KSIVLFENLGFER 161  

                   vgelrlyygglmslmtmditirpatpeDleallellrevfpeelpplsleelrell
                             +++++  +++ D   ++ +  ++ ++  + l + ++ +  
  BAB80140.1    27    -------DGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEE 66   

                   ad.....pgalflvaeddgelvGfarlrplpdg..gvaeigrlaVdpeyr
                   ++ + +  ++++++  ++ge +G+++++p  ++++gv ei +la++p+y+
  BAB80140.1    67 NSlkgnfKNRCVFLENENGERIGTIMIVPSLSEeeGVQEIKYLALLPKYQ 116  

                   gkGiGraLleallelarel.glkrlvlevdne.airfYeklGFevvgelp
                    +G+G+ L+ ++ +   + +g++r+ le+ n ++i ++e+lGFe+     
  BAB80140.1   117 EQGLGKLLISKAYKMVDDVeGATRINLEAYNDkSIVLFENLGFER----- 161  

                   lyyllgllgdgedavlmvkllsererltirpatpeDleallellneafveeflplsleelrefled.....
                      +++++  ++++D + ++ + ++a v+        ++r+ +++++  +
  BAB80140.1    27    DGYRFTDFRIGDENNWAYIQYSAGVF---KDYQLAIRRIFKEenslk 70   

                   ...pgalllvaeddgelvGfaglslidp...gtaeigrlavdpeyrgkGi
                    + +++++++  ++ge +G++++++  ++++g+ ei +la++p+y+ +G+
  BAB80140.1    71 gnfKNRCVFLENENGERIGTIMIVPSLSeeeGVQEIKYLALLPKYQEQGL 120  

                   GkallealleyakerlglkrlylevledNeaairlYeklGFvevgelrdy
                   Gk l+ ++ +++ +  g++r+ le++ d  ++i l+e+lGF++       
  BAB80140.1   121 GKLLISKAYKMVDDVEGATRINLEAYND--KSIVLFENLGFER------- 161  

                   geyvdallmserltirpatpeDleallallndafveeylpalpeplsleelrayler
                      +++++  +++ D   ++ + ++a         + + +++ + +++ +
  BAB80140.1    27    DGYRFTDFRIGDENNWAYIQYSA---------GVFKDYQLAIRRIFK 64   

                   .....ladpgslflvaedd.gelvGfaglrpiddeplggvaei.glavdp
                   +++    +   +++ +e ++ge +G+++++p  +e++ gv ei++la++p
  BAB80140.1    65 eenslKGNFKNRCVFLENEnGERIGTIMIVPSLSEEE-GVQEIkYLALLP 113  

                   eyrgkGiGtallealleyarel.glkrivlevdpdNeaairlyeklGFee
                   +y+ +G+G+ l+ ++ +   + +g++ri le++ d  ++i l+e+lGFe+
  BAB80140.1   114 KYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER 161  

                   vgelrdyyldggrlvdavlmsklplmdltirpatpeDlpailallaeafaeelalllpeeplsleelaall.
                        +++  ++ +D   ++ + + a           + +++ ++++ ++
  BAB80140.1    27    DGYRFTDFRIGDENNWAYIQYSAG---------VFKDYQLAIRRIFk 64   

                   .......apgalllvaed.dgelvGfalllplds..gdvaelgdlaVape
                   +++  + +   +++ +e ++ge +G+++++p  s++++v e+  la++p+
  BAB80140.1    65 eenslkgNFKNRCVFLENeNGERIGTIMIVPSLSeeEGVQEIKYLALLPK 114  

                   arGrGiGraLlealeelarerlgarrlrlevledNaaaialYeklGFepv
                   ++ +G+G+ L+  + +   +  ga+r+ le+++d   +i l+e+lGFe+ 
  BAB80140.1   115 YQEQGLGKLLISKAYKMVDDVEGATRINLEAYND--KSIVLFENLGFER- 161  

                   gelpdyyldgrledavlmekllderltiRpatpeDleallalladafveeyalllpappldaellaersle
                      ++++  ++++D   ++ + ++           a+++++++la r + 
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYS-----------AGVFKDYQLAIRRIF 63   

                   rlrellad.ggalllvaed.dgelvGfaglrpldsllalpgggvaeigyl
                     ++ l+ +   +++ +e ++ge +G+++++p  s+    ++gv ei yl
  BAB80140.1    64 KEENSLKGnFKNRCVFLENeNGERIGTIMIVPSLSE----EEGVQEIKYL 109  

                   avdpeyrgkGiGraLlealleyare.lglrrlvlevdpdNeaairfYekl
                   a++p+y+ +G+G+ L+ ++ +   ++ g++r+ le++ d   +i ++e l
  BAB80140.1   110 ALLPKYQEQGLGKLLISKAYKMVDDvEGATRINLEAYND--KSIVLFENL 157  

                   GFeevgelrlyydgegldavlmekpLplerltirpatpeDleallallndafvelylglllllafelaplsleell
                      ++++  ++++D   ++ + ++           ++ f ++ l+++++ 
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYS-----------AGVFKDYQLAIRRIF 63   

                   erlrelladggalllvaed.dgeplvGfaglrpidsegggvaeigglavd
                   +   +l  +   +++ +e+++ge  +G+++++p  se++gv ei +la++
  BAB80140.1    64 KEENSLKGNFKNRCVFLENeNGE-RIGTIMIVPSLSEEEGVQEIKYLALL 112  

                   peyrgkGiGraLlealleyare.lglkrivlevlpdNeaairlyeklGFe
                   p+y+ +G+G+ L+ ++ +   ++ g++ri le++ d   +i l+e+lGFe
  BAB80140.1   113 PKYQEQGLGKLLISKAYKMVDDvEGATRINLEAYND--KSIVLFENLGFE 160  

                   evgelrdgegrltirpatpeDleallalladafaeelylgfpeplsleelralleel
                      ++++  ++++D   ++ +  +a        + +     ++r+ ++e 
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYSA--------GVFKDYQLAIRRIFKEE 66   

                   .....lpgglflvaededgelvGfaglrpiddgpagggvaei.glavdpe
                   +  + +   +++ +e+e+ge +G+++++p  +++   gv ei++la++p+
  BAB80140.1    67 nslkgNFKNRCVFLENENGERIGTIMIVPSLSEEE--GVQEIkYLALLPK 114  

                   yrgkGigtallealleyare.lglrrlvlevdpdNeaairlyeklGFelv
                   y+ +G+g+ l+ ++ + + ++ g++r+ le++ d   +i l+e+lGFe+ 
  BAB80140.1   115 YQEQGLGKLLISKAYKMVDDvEGATRINLEAYND--KSIVLFENLGFERS 162  

                   gelrdyyliggrlvdavlmskllsemitirpatpedleallellreafleelplseeelrerla........
                      ++++  ++++d + ++ + ++a+++    +++  ++r+ ++++  + 
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYSAGVFK---DYQLAIRRIFkeenslkg 71   

                   ..dgalllvaeddgelvGfarlvpd...gddvayigdlaVlpeyrgqGiG
                   + ++ ++++  ++ge +G++++vp   ++++v +i +la lp+y+ qG+G
  BAB80140.1    72 nfKNRCVFLENENGERIGTIMIVPSlseEEGVQEIKYLALLPKYQEQGLG 121  

                   kaLleaalelakel.gakriylev.neaaiafYeklGFevvgelelyygg
                   k L+ +a ++  + +ga+ri le++n+++i ++e+lGFe+          
  BAB80140.1   122 KLLISKAYKMVDDVeGATRINLEAyNDKSIVLFENLGFER---------- 161  

                   pgvllditirpatpeDleallellrelfletylfllepltleellellee..
                      ++++  +++ D + ++ + +++         ++ ++ ++++ ++e++
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYSAG-------VFKDYQLAIRRIFKEen 67   

                   ...llpgalvlvaedleelldkedgeivGfallrldystpggkvayiedl
                     + +   +++++e+       e+ge +G++++++  s  +++v +i  l
  BAB80140.1    68 slkGNFKNRCVFLEN-------ENGERIGTIMIVPSLSE-EEGVQEIKYL 109  

                   yVlpeyrgkGiGkaLlealeelaker.gckrlylevledNepairfYekl
                   ++lp+y+ +G+Gk L+ ++ ++  + +g++r+ le++ d   +i ++e+l
  BAB80140.1   110 ALLPKYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENL 157  

                   GFevvgelkgyyldggdallmekrLsrltirpatpeDleallallndafveeyaglppplsleelrellae..
                      ++++  ++++D   ++ +  +a v+  +          +r+ ++e++
  BAB80140.1    28    GYRFTDFRIGDENNWAYIQYSAGVFKDY-------QLAIRRIFKEen 67   

                   ...adpgalflvaedakedgepgepelvGfaglrpidspggggvaeigyl
                     + +   +++ +e+  e+ge      +G+++++p    +++gv ei yl
  BAB80140.1    68 slkGNFKNRCVFLEN--ENGE-----RIGTIMIVPS-LSEEEGVQEIKYL 109  

                   avdpeyrgkGiGraLlealleyarel.glkrivlevlpdNeaairlYekl
                   a++p+y+ +G+G+ L+ ++ +   + +g++ri le  + N  +i l+e+l
  BAB80140.1   110 ALLPKYQEQGLGKLLISKAYKMVDDVeGATRINLE--AYNDKSIVLFENL 157  

                   GFeevgelrdyyldlmekellldellyltirpatpeDleallallreafveppesledleelladppal....
                      y ++  +++ D   ++ + ++a v+  +   ++++ ++++++l+ + 
  BAB80140.1    29    Y-RFTDFRIGDENNWAYIQYSAGVF-KDYQLAIRRIFKEENSLkgnf 73   

                   ...llvaed.dgelvGfaglrpldde.grvaeigylavdpeyrgkGiGra
                   ++ ++ +e ++ge +G+++++p  +e+++v ei yla++p+y+ +G+G+ 
  BAB80140.1    74 knrCVFLENeNGERIGTIMIVPSLSEeEGVQEIKYLALLPKYQEQGLGKL 123  

                   Llealleyare.lglrrlvlevlpdNeaairlyeklGFevMiiirpatpedleailallrevf.peelplsleelrdlld......p
                       + +  +++ d + ++ + + + ++ +++l ++++ +  +  + + +
  BAB80140.1    29    -YRFTDFRIGDENNWAYIQYSAGvFKDYQLAIRRIFKEENslkgnfK 74   

                   galllvaeddgelvGfarllp....ggdvaeigrlaVdpeyrgkGiGraL
                   ++++++  ++ge +G+++++p   ++++v ei +la +p+y+ +G+G++L
  BAB80140.1    75 NRCVFLENENGERIGTIMIVPslseEEGVQEIKYLALLPKYQEQGLGKLL 124  

                   leallelarel.glkrlvlev.neaairfYeklGFevvgelplyydgida
                   + ++ +   + +g++r+ le++n+ +i ++e+lGFe+             
  BAB80140.1   125 ISKAYKMVDDVeGATRINLEAyNDKSIVLFENLGFER------------- 161  

                   llmvkemmdmsditirpatpeDleallallrea.fpeeeplsledlralled.
                            +++  +++ D   ++ + ++a  + +++l + ++ +  ++ 
  BAB80140.1    29    ------YRFTDFRIGDENNWAYIQYSAgVFKDYQLAIRRIFKEENSl 69   

                   ...pgalflvaed.dgelvGfarlrpdddlp.dvaeigrlaVdpeyrgkG
                   + +   +++ +e+++ge +G+++++p  ++ ++v ei +la++p+y+ +G
  BAB80140.1    70 kgnFKNRCVFLENeNGERIGTIMIVPSLSEEeGVQEIKYLALLPKYQEQG 119  

                   iGraLleallelarerlglrrlvlev.npaairfYeklGFevvgevyled
                   +G+ L+ ++ +   +  g++r+ le++n+ +i ++e+lGFe+        
  BAB80140.1   120 LGKLLISKAYKMVDDVEGATRINLEAyNDKSIVLFENLGFER-------- 161  

                   gidavlmvkpitirpatpedleallelllevfpe.pyseelledlld........ps
                       ++  ++++d + ++ + +++++ ++y +++ + + +++  + + ++
  BAB80140.1    29    YRFTDFRIGDENNWAYIQYSAGVFkDYQLAIRRIFKEenslkgnfKN 75   

                   alvlvaeddgelvGfarlipdg...gdvaeigdlaVlpeyrgkGiGsaLl
                   ++v++  ++ge +G+++++p   ++++v ei  la lp+y+ +G+G++L+
  BAB80140.1    76 RCVFLENENGERIGTIMIVPSLseeEGVQEIKYLALLPKYQEQGLGKLLI 125  

                   ealleyakel.glkriylevladnpaiklYeklGFvpvgelklyygigg<
                    ++ +++ + +g++ri le++ d ++i l+e+lGF+              
  BAB80140.1   126 SKAYKMVDDVeGATRINLEAYND-KSIVLFENLGFE-------------  160  

                   -*
                     
  BAB80140.1     -    -    

0051248: domain 1 of 1, from 29 to 161: score 40.1, E = 1.8e-11
                   *->itirpatpeDleallallrea..flseeelrall...........pg
                       ++  ++++D + ++ + ++a +f +++   +++ ++++  + + ++
  BAB80140.1    29    YRFTDFRIGDENNWAYIQYSAgvFKDYQLAIRRIfkeenslkgnfKN 75   

                   glllvaeddgeivGfaallpld...pdvaeigrlaVapeyrgkGiGkaLl
                   +++++  ++ge +G+++++p   ++++v ei +la++p+y+ +G+Gk L+
  BAB80140.1    76 RCVFLENENGERIGTIMIVPSLseeEGVQEIKYLALLPKYQEQGLGKLLI 125  

                   eallelarel.glkrlvlevladntaaialYeklGFevvgeledyygdge
                    ++ ++  + +g++r+ le++ d  ++i l+e+lGFe+            
  BAB80140.1   126 SKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER------------ 161  

                   dalvmekdlrlldlvlmallldltIrpatpeDleallellrelfaelglllpepeslelllellad...
                       ++  +++ D + ++ + + +         + + + ++++++++++ 
  BAB80140.1    29    YRFTDFRIGDENNWAYIQYSAG-------VFKDYQLAIRRIFKEens 68   

                   .....pgalllvavdeedgelvGfaalslldstlagrdvaeiedlyVape
                    + + +++++++    e+ge +G++++++  s    ++v ei+ l+++p+
  BAB80140.1    69 lkgnfKNRCVFLE--NENGERIGTIMIVPSLS--EEEGVQEIKYLALLPK 114  

                   yrgqGiGkaLleallelarer.gakrlrlevladNeaAirlYeklGFeev
                   y+ qG+Gk L+ ++ ++  + +ga+r+ le + d   +i l+e+lGFe+ 
  BAB80140.1   115 YQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER- 161  

                   gelknyyldgggyldMtirpatpeDpllleallallrea..fpeelp....eeseellrell
                       ++  ++  D      ++ + ++a +f ++++++   + ee   +  
  BAB80140.1    30    -RFTDFRIGD---ENNWAYIQYSAgvFKDYQLairrIFKEENSLKGN 72   

                   adpelflvaed.dgelvGfarlrpl..pggdvaeigrlaVdpeyRGkGiG
                   ++++ ++ +e+++ge +G+++++p   ++++v ei +la +p+y+ +G+G
  BAB80140.1    73 FKNR-CVFLENeNGERIGTIMIVPSlsEEEGVQEIKYLALLPKYQEQGLG 121  

                   raLlealleearer.glkriylevledNeaadeslirfYekl.Feevgel
                   + L+ ++ +   + +g++ri le++ d   +    i ++e+l Fe+    
  BAB80140.1   122 KLLISKAYKMVDDVeGATRINLEAYND--KS----IVLFENLgFERS--- 162  

                   pdydgidgvfmdkvlmqlllglglllllskplllllkellekleegtirpatlspeDleallallneafveefgllppldeeeslellrell
                       ++  ++  ++D   ++ + ++a       + + d++ +++++ +  
  BAB80140.1    30    -RFTDFR--IGDENNWAYIQYSA-------GVFKDYQLAIRRIFKEE 66   

                   ad.....pgalllvaeddgelvGfaglrplddlplgldvaeigdlavdpe
                   ++ + +  ++++++  ++ge +G+++++p  +++   +v ei +la++p+
  BAB80140.1    67 NSlkgnfKNRCVFLENENGERIGTIMIVPSLSEEE--GVQEIKYLALLPK 114  

                   yrgkGiGraLleallelarel.glkrlvlevladNeaairlYeklGmtirpatpeDleallallneafvellgelpplsleellelllddpga
                       ++  +++ D   ++ +  +a v+  ++l  + +   ++ l  +   
  BAB80140.1    30    -RFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLKGNFKN 75   

                   lflvaedd.gelvGfarlrpl..pggdvaeigrlavdpeyrgkGiGraLl
                   +++ +e ++ge +G+++++p   ++++v ei +la++p+y+ +G+G+ L+
  BAB80140.1    76 RCVFLENEnGERIGTIMIVPSlsEEEGVQEIKYLALLPKYQEQGLGKLLI 125  

                   ealleeare.lglkrlvlev.neaairfYeklGFeevgelplyygighig
                    ++ +   ++ g++r+ le++n+ +i ++e+lGFe+              
  BAB80140.1   126 SKAYKMVDDvEGATRINLEAyNDKSIVLFENLGFER-------------- 161  

                   myedallmvklllpdldlmltirpatpeDleallallreafavlgaelpppsleellerllddpg
                        ++  +++ D   ++ +   a ++  ++l    +    + l  +  
  BAB80140.1    30    --RFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLKGNFK 74   

                   llflvae.ddgelvGfarlrp..dgdepvaeigrlaVdpeyrgkGiGraL
                    +++ +e+++ge +G+++++p   ++e+v ei +la++p+y+ +G+G+ L
  BAB80140.1    75 NRCVFLEnENGERIGTIMIVPslSEEEGVQEIKYLALLPKYQEQGLGKLL 124  

                   lealleyareelglrrlvlevdne.airfYeklGFeevgelpdyyllgyl
                   + ++ +   ++ g++r+ le+ n ++i ++e+lGFe+             
  BAB80140.1   125 ISKAYKMVDDVEGATRINLEAYNDkSIVLFENLGFERSX----------- 163  

                   gdyedailmvklllelldllddltirpatpeDleallalladafveeylllfppplsleelralleel
                        ++  ++++D   ++ + ++a        + +     ++r+ ++e 
  BAB80140.1    30    --RFTDFRIGDENNWAYIQYSA--------GVFKDYQLAIRRIFKEE 66   

                   la.....pgslllvaeddgelvGfaglrpiddepgggvaeigglavdpey
                    + + + +++++++  ++ge +G+++++p  +e   gv ei +la++p+y
  BAB80140.1    67 NSlkgnfKNRCVFLENENGERIGTIMIVPSLSEEE-GVQEIKYLALLPKY 115  

                   rgkGigtallealleyare.lglrrlvlevdpdNeaairlyeklGFelvg
                   + +G+g+ l+ ++ +   ++ g++r+ le++ d   +i l+e+lGFe+  
  BAB80140.1   116 QEQGLGKLLISKAYKMVDDvEGATRINLEAYND--KSIVLFENLGFERSX 163  

                   elrdyyliggrlvdavlmekilHltirpatpeDleallallndafveeylllppplteeeslerlrell
                        ++  ++++D   ++ + ++a             + +++ ++r+++
  BAB80140.1    30    --RFTDFRIGDENNWAYIQYSA-----------GVFKDYQLAIRRIF 63   

                   adp........gslllvaeddgelvGfaglrpldslllpgggvaeiggla
                   ++++  + + +++++++  ++ge +G+++++p  s    ++gv ei  la
  BAB80140.1    64 KEEnslkgnfkNRCVFLENENGERIGTIMIVPSLSE---EEGVQEIKYLA 110  

                   vdpeyrgkGiGraLlealleyarel.glrrlvlevlpdNeaairlyeklG
                   ++p+y+ +G+G+ L+ ++ +   + +g++r+ le++ d   +i l+e+lG
  BAB80140.1   111 LLPKYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLG 158  

                   FeasedglklllltiRpatpeDlpallalladafpevyafllgtppldalaeeeslerl
                       ++  ++++D   ++ +  +a                  + +++  +
  BAB80140.1    30    -RFTDFRIGDENNWAYIQYSAGV----------------FKDYQLAI 59   

                   eelladgdale.....lflvaeddggelvGfaglrpiddgpggklvaeig
                   ++ ++++++l  + +++++ +e+++ge +G+++++p  ++++g  v ei 
  BAB80140.1    60 RRIFKEENSLKgnfknRCVFLENENGERIGTIMIVPSLSEEEG--VQEIK 107  

                   glavdpeyrGkGiGtaLlealleyarer.glrrlvlevdpdNeaairlYe
                    la++p+y+ +G+G+ L+ ++ +   + +g++r+ le++ d   +i l+e
  BAB80140.1   108 YLALLPKYQEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFE 155  

                   klGFeevgelrlyldgrkldevlmekdlsaaalltirpatpeDleallallaeafaelylglppplsleellallaell.
                       ++  ++++D   ++ + ++a         ++ + + +++++++  +
  BAB80140.1    30    -RFTDFRIGDENNWAYIQYSAG--------VFKDYQLAIRRIFKEEn 67   

                   .....pgglflvaedd.gelvGfaglrpldslllgggvaeigglavdpey
                     + +   +++ +e ++ge +G+++++p  s++  +gv ei  la++p+y
  BAB80140.1    68 slkgnFKNRCVFLENEnGERIGTIMIVPSLSEE--EGVQEIKYLALLPKY 115  

                   rgkGiGraLlealleyarer.glrrlvlevlpdNeaairlYeklGFevvg
                   + +G+G+ L+ ++ +   + +g++r+ le++ d   +i l+e+lGFe+  
  BAB80140.1   116 QEQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER-- 161  

                   elrlyyldggllldllEIRpatpeDleailelilelfeeealllpellalpldeeellelleel
                         ++++D + ++ +++ +  +  +         l + ++ ++  +l
  BAB80140.1    31    FTDFRIGDENNWAYIQYSAGVFKDY--------QLAIRRIFKEENSL 69   

                   lenpnslllvaed.dgeivGfillylefs..gdvaeiellyVdpeyRgqG
                     n++ ++++ e+++ge +G i+++++ s++++v ei +l+ +p+y+ qG
  BAB80140.1    70 KGNFKNRCVFLENeNGERIGTIMIVPSLSeeEGVQEIKYLALLPKYQEQG 119  

                   igtaLlealeewakel.gakrlvLeMeirirpadledllallreafveefallppplsledlrelledpgal
                       ++ri +++  +++++ + +f +++  +   + +e  ++  ++ +++
  BAB80140.1    33    -DFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLKGNFK-NRC 77   

                   flvaeddgelvGfaalrpld...ggvaeigrlavdpeyrgkGiGraLlea
                   +++  ++ge +G+++++p   +++gv ei +la++p+y+ +G+G+ L+ +
  BAB80140.1    78 VFLENENGERIGTIMIVPSLseeEGVQEIKYLALLPKYQEQGLGKLLISK 127  

                   llelarer.glrrlvlevlvlpdNeaairlyeklGFevvgelplyygipg
                   + +   + +g++r+ le+     N  +i l+e+lGFe+            
  BAB80140.1   128 AYKMVDDVeGATRINLEA----YNDKSIVLFENLGFER------------ 161  

                   eylmeklltmmmleiflvrlaltpeeleealrlRyevFveelgwdlgvpdglelD
                       +   e  +++++ ++  + +++   +++F ee              
  BAB80140.1    35    -RIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENS------------ 68   

                   efDalathllvadd.dgevvGtvRllpttgplmlgdlysellfdlllplg
                      ++   +++++ ++ge +Gt+ ++p                      +
  BAB80140.1    69 LKGNFKNRCVFLENeNGERIGTIMIVPSLS------------------EE 100  

                   pdvaeigRlaVdpeyrgkgglpligrlLlaalieyarel.girrlvlva.
                   ++v ei  la +p+y+ +g    +g+lL+  ++ ++ + +g++r+ l+a+
  BAB80140.1   101 EGVQEIKYLALLPKYQEQG----LGKLLISKAYKMVDDVeGATRINLEAy 146  

                   sprairfyrrlGflfevIRatpedleallellreafpeeylllllelllell.....pgalflv
                       R+  e+  a+++  + +f +++l+++  + +e   + +  ++++++
  BAB80140.1    35    -RIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSlkgnfKNRCVFL 80   

                   aeddgelvGfarlrpldsllllgggvaeigrlavdpeyrgkGiGraLlea
                     ++ge +G+++++p  s    ++gv ei +la++p+y+ +G+G+ L+ +
  BAB80140.1    81 ENENGERIGTIMIVPSLS---EEEGVQEIKYLALLPKYQEQGLGKLLISK 127  

                   llelarel.glkrlvlev.npaairfYeklGFevvgelplyydgedavlm
                   + +   + +g++r+ le++n+ +i ++e+lGFe+                
  BAB80140.1   128 AYKMVDDVeGATRINLEAyNDKSIVLFENLGFER---------------- 161  

                   ekeLTPedleallallrelfeaplseeeseelleelledg...lflvaedd.
                       e+ +a+++  + +f +++   + +   e+ l+++ +++++ +e ++
  BAB80140.1    39    -ENNWAYIQYSAGVFKDYQLAIRRIFKEENSLKGNfknRCVFLENEn 84   

                   gelvGfaglrpdd...ggvaeigrlavdpeyrgkGiGraLlealleyare
                   ge +G+++++p   +++gv ei +la++p+y+ +G+G+ L+ ++ +   +
  BAB80140.1    85 GERIGTIMIVPSLseeEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDD 134  

                   .lglrrlvlevladNeaairfYeklGFevvgelpdyyldgidallmekll
                   + g++r+ le++  N+ +i ++e+lGFe+                     
  BAB80140.1   135 vEGATRINLEAY--NDKSIVLFENLGFER--------------------- 161  

                   ldldllllllelltiRpatpeDleallallndafveeyllpfppplsleeleerlrella
                                              +++  +++   ++++  +r++++
  BAB80140.1    40    ----------------------NNWAYIQYSAGVFKDYQLAIRRIFK 64   

                   d........gdg.llvaeddtgelvGfaglrpiddgplglgvaei.glav
                   +++  + +  ++ +++  ++ ge +G+++++p  ++++  gv ei+ la+
  BAB80140.1    65 EenslkgnfKNRcVFLENEN-GERIGTIMIVPSLSEEE--GVQEIkYLAL 111  

                   dpeyrgkGiGtaLlealleyare.lglrrlvlevdpdNeaairlyeklGF
                   +p+y+ +G+G+ L+ ++ + + ++ g++r+ le++  N  +i l+e lGF
  BAB80140.1   112 LPKYQEQGLGKLLISKAYKMVDDvEGATRINLEAY--NDKSIVLFENLGF 159  

                   eevgelrdyylidgelrdavlmskllsewesgpdwsqgllisslnlrlievikelaaskglkvellratlllvlprelaf
                      +w ++ +  ++ ++++ +i++++++                      
  BAB80140.1    41    NWAYIQYSAGVFKDYQLAIRRIFKE---------------------- 65   

                   llelpevpdgfrlrpldvddaalvnelwphggpeslefleellrdp.psl
                                                          e+ l+++ +++
  BAB80140.1    66 ---------------------------------------ENSLKGNfKNR 76   

                   vlvaed.dgelvGfaglspg.......aelgalyVlPeyrgrGlGraLla
                   ++++e ++ge +G++++ p   +++ + e+  l++lP+y+ +GlG++L++
  BAB80140.1    77 CVFLENeNGERIGTIMIVPSlseeegvQEIKYLALLPKYQEQGLGKLLIS 126  

                   allerarar.GarrltlevladNeaaialYeklGFepvgelpwyyggggi
                    + +   + +Ga+r+ le+  d  ++i l+e lGFe+             
  BAB80140.1   127 KAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER------------- 161  

                   gmpptleterltlRpatpeDaeallallreadpevarllpflgppls
                                                              +++  +s
  BAB80140.1    42    ----------------------------------------WAYIQYS 48   

                   leelraflerllaaea.......ldpgglflvaeddgelvGfaglrpidd
                      ++++  ++++ +++++  + +  ++++++  ++ge +G+++++p  +
  BAB80140.1    49 AGVFKDYQLAIRRIFKeenslkgNFKNRCVFLENENGERIGTIMIVPSLS 98   

                   e.ggvaei.glavapeyrGkGiGtellralleyafrelglrrlvlevlad
                   e++gv ei+ la++p+y+ +G+G+ l+  + +   +  g++r+ le++ d
  BAB80140.1    99 EeEGVQEIkYLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYND 148  

                   NeaairlyeklGFeeegelrdyylidgrlrdavlmslllsewplptleterltlRpatpeDleallallndaevellggplspedleef
                                                       ++   +s   ++++
  BAB80140.1    42    ---------------------------------WAYIQYSAGVFKDY 55   

                   lerllerlad........pgalllvaedkedgelvGfvglrp.id.eggv
                   + ++++ +++++  + + +++++++  +  +ge +G+++++p +++e+gv
  BAB80140.1    56 QLAIRRIFKEenslkgnfKNRCVFLENE--NGERIGTIMIVPsLSeEEGV 103  

                   aeig.lavapeyrGkGigtellealleyafellglrrlvlevladNeaai
                    ei +la++p+y+ +G+g+ l+  + +   +  g++r+ le++ d  ++i
  BAB80140.1   104 QEIKyLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYND--KSI 151  

                   rlyeklGFelegelrdyyliggryrdlqpptleterliLrpltleDaeallellndpealvarylpwlpsplsle
                                                        +y   +   + l+
  BAB80140.1    44    --------------------------------YIQYSAGVFKDYQLA 58   

                   earaflerllalyadggalvfvied...dgelvGfiglrridpen.gtae
                     r f e+      +g++    +++++++ge +G+i++++   e +g+ e
  BAB80140.1    59 IRRIFKEENSL---KGNFKNRCVFLeneNGERIGTIMIVPSLSEEeGVQE 105  

                   ig.ywvdpsyrGkGiatealkalldyafeelglrrieatvladNeaSirl
                   i ++++ p+y+ +G+++ ++  + + + +  g+ ri ++++ d  +Si l
  BAB80140.1   106 IKyLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYND--KSIVL 153  

                   yeklGFvleGtlrdyllingryrDtvlysllkltlrpltpedaeallallndafvalyllgpppplsleelrerleedl
                                                    + + + + +++r+ +  
  BAB80140.1    49    -----------------------------AGVFKDYQLAIRRIFKEE 66   

                   .......gggllfvaeddgelvGfvgl..rpdpdggvaeigylavlpdyr
                   +  + + ++ ++f+  ++ge +G+++++ +  +++gv ei yla+lp+y+
  BAB80140.1    67 nslkgnfKNRCVFLENENGERIGTIMIvpSLSEEEGVQEIKYLALLPKYQ 116  

                   gkGigtellralleyarel.glkrlvatvdpdNtasirlyeklGFelvge
                    +G+g+ l+ ++ + + + +g++r+ ++++ d   si l+e+lGFe+   
  BAB80140.1   117 EQGLGKLLISKAYKMVDDVeGATRINLEAYND--KSIVLFENLGFER--- 161  

                   lrlpingewldlvlmeklldmtiRpatpeDlpelldallallrdafaellalllpeplseeeleell
                                      a+++++++                       
  BAB80140.1    58    ----------------AIRRIFKEENSL------------------- 69   

                   erlledladpgalflvaed.dgelvGfaglrpdddepggpvaeigylavd
                           +   +++ +e ++ge +G+++++p  +e +++v ei yla++
  BAB80140.1    70 ------KGNFKNRCVFLENeNGERIGTIMIVPSLSE-EEGVQEIKYLALL 112  

                   peyrgkGiGraLlealleyarel.glkrivlevladNe.airlYeklGFe
                   p+y+ +G+G+ L+ ++ +   + +g++ri le+   N ++i l+e+lGFe
  BAB80140.1   113 PKYQEQGLGKLLISKAYKMVDDVeGATRINLEA--YNDkSIVLFENLGFE 160  

                   eellelldlpgslffvaeddgeivGfarlrpldd...dvaeieslaVd
                      e+    + +++++f+  ++ge +G+++++p  +++++v ei +la +
  BAB80140.1    66    ENSLKGNFKNRCVFLENENGERIGTIMIVPSLSeeeGVQEIKYLALL 112  

                   peyrgqGiGkkLlealleyarel.glkrill...npaaikfyeklGFevv
                   p+y+ qG+Gk L+ ++ +   + +g++ri l+++n ++i ++e+lGFe  
  BAB80140.1   113 PKYQEQGLGKLLISKAYKMVDDVeGATRINLeayNDKSIVLFENLGFER- 161  

                   gelklyygingelflvaedd.geivGfaglrpddsglagdllgllllglllllglllll
                      +++ +e ++ge +G+++++p  s+                       
  BAB80140.1    76    RCVFLENEnGERIGTIMIVPSLSE----------------------- 99   

                   llllpgggvaeigrlaVdpeyrGkGiGraLlealleyarer.glrrlvle
                        ++gv ei +la++p+y+ +G+G+ L+ ++ +   + +g++r+ le
  BAB80140.1   100 -----EEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVeGATRINLE 144  

                   vladNeaairfYeklGFeevgelrgdgedavlmekevadgepvGyvelywvkedelgyyydaepgdrgihlligdpdyrgkGlgt
                      +ge +G +++        ++ ++ e+g+  i +l+  p+y+ +Glg+
  BAB80140.1    84    NGERIGTIMI--------VPSLSEEEGVQEIKYLALLPKYQEQGLGK 122  

                   allraliaylflddpgarrivlepdadNtaairlyekaGFrregevdlph
                   +l++ + + +  d  ga+ri le    N ++i l+e++GF+r        
  BAB80140.1   123 LLISKAYKMVD-DVEGATRINLEA--YNDKSIVLFENLGFER-------- 161  

                   kdaalmfllRer