hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_9006.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAB80503.1
Accession:      [none]
Description:    cper0 CPE0797 GIB00075CH01 "conserved hypothetical protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0036249  Acid phosphatase/Vanadium-dependent halopero    99.5    4.5e-29   1
0042804  Acid phosphatase/Vanadium-dependent halopero    77.2    9.3e-23   1
0044900  Acid phosphatase/Vanadium-dependent halopero    57.0    9.6e-17   1
0042785  Acid phosphatase/Vanadium-dependent halopero    24.2    2.1e-07   1
0044476  Acid phosphatase/Vanadium-dependent halopero    14.2    0.00052   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0036249    1/1       2   176 ..    37   224 .]    99.5  4.5e-29
0042804    1/1      12   176 ..     1   555 []    77.2  9.3e-23
0044900    1/1      70   158 ..   343   504 ..    57.0  9.6e-17
0042785    1/1      78   158 ..   398   595 .]    24.2  2.1e-07
0044476    1/1     102   158 ..   480   563 ..    14.2  0.00052

Alignments of top-scoring domains:
0036249: domain 1 of 1, from 2 to 176: score 99.5, E = 4.5e-29
                   *->aldlalflainal..rnplldrlavfltalgdgavllllaaalll.l
                      ++  ++f  in+l+ +n+lld ++ f ++   +++++++++++l+ +
  BAB80503.1     2    NFWNDIFNSINGLagKNHLLDSIMLFSSKRLPYILFATVIVVYLIgI 48   

                   lllrrrlrlaalllllalalallltlllKllfgrpRPfllllegictvdp
                   ++++++ r  a+  ++ ++++l+l++++ ++f  pRPf+ ++    +  +
  BAB80503.1    49 ISKNKKARGIAVDTIVFTGINLILAVIVGHFFYAPRPFVNDP----NAKL 94   

                   llvlaggySFPSGHaaaafalalalalllprrgilllllallvglSRvyl
                   l ++  ++SFPSGH++ ++++al l  + +++g ++++l++l+g+SRvy+
  BAB80503.1    95 LYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGISRVYV 144  

                   gvHypsDVlaGallGaavalllllllarlrllaaarleleeeletvagiflsydgpnpiprldealavrlafialelkvdlvlidlnnnee
                                                                     
  BAB80503.1     -    ----------------------------------------------- -    

                   dfianftkglnhdlfvainaaaaelllearlndglddiepvppgvaplgp
                                                                     
  BAB80503.1     - -------------------------------------------------- -    

                   vwglvnpfaglaidlvlpsalaltppppPaldslelaadlaevywlallr
                                                                     
  BAB80503.1     - -------------------------------------------------- -    

                   dtprtlaqtddaifaaaavlallpgfagldaalinlggevvnvsklfrgi
                                                                     
  BAB80503.1     - -------------------------------------------------- -    

                   tigvetgpfisqllilsipigsitveplvrtaapgldyltafqewldvqn
                                                                     
  BAB80503.1     - -------------------------------------------------- -    

                   nahlvgpalldplmvfittlgdlatlflldalltaalaaalillgggllf
                   n+ +++  lld++m+f ++   +            a +++++l+g+    
  BAB80503.1    12 NGLAGKNHLLDSIMLFSSKRLPYILF---------ATVIVVYLIGI---- 48   

                   flgllgpyfdldrqagfverrrrllallllaallaalllnvllKylfrrp
                                  ++ ++++r +a+ +++ + + l+l v++ ++f  p
  BAB80503.1    49 ---------------ISKNKKARGIAVDTIVFTGINLILAVIVGHFFYAP 83   

                   RPftaiglvhpliaggllgeldlsvlrlaellkrptdgnpgteadplwty
                   RPf+  +++ +l +                                    
  BAB80503.1    84 RPFVNDPNAKLLYP------------------------------------ 97   

                   llpmalgegtpphpSFPSGHataafafatvLallfprrlggfaltnpsvp
                            + p++SFPSGH++ + ++a+ L ++ +              
  BAB80503.1    98 ---------HKPDSSFPSGHSVGSMSIALGLNRYNKA------------- 125  

                   ileglglvrvrlkwltlgilllalAllvalSRvylGvHypsDvlaGallG
                                   lg ++++l++l+++SRvy+G Hyp  v+a++l+ 
  BAB80503.1   126 ----------------LGTICVILSILMGISRVYVGHHYPQHVVASFLI- 158  

                   aavaalvlrlvlrtyleksllafrlfsgtvkkvendllfrtdgllarpav
                       +++l++  + +l+ks  +                            
  BAB80503.1   159 ----VIILNVLYMKFLSKSVQK---------------------------- 176  

                   lgatellpglaawllKllygrpRPfvairdgnlngeadptwltlgsfllnvapll
                      +++a++  +++  pRPfv ++                    n  +l 
  BAB80503.1    70    LILAVIVGHFFYAPRPFVNDP--------------------NAKLLY 96   

                   ptpphpSfPSGHatfsfavagvLallfprrlltfsdtsgdliavelgpse
                   p+ p++SfPSGH++ s+ +a+ L +++ +                     
  BAB80503.1    97 PHKPDSSFPSGHSVGSMSIALGLNRYNKALGT------------------ 128  

                   elnivspdlvvpyddglelleqkgtlrtrlllawalllilallvalSRvy
                                                      +++il++l+++SRvy
  BAB80503.1   129 -----------------------------------ICVILSILMGISRVY 143  

                   lGvHwpsDvlaGallflvhgrlRPetaiglvgllvtgglsldillvefdpsvlensglldrv
                      +++   +RP+   + +                               
  BAB80503.1    78    HFF-YAPRPFVNDPNA------------------------------- 92   

                   ailndtdgnegtvvdpgwtpLlpqaategtPphpsYPSGHAtfagaaatv
                                     + L p        p +s+PSGH++ + ++a  
  BAB80503.1    93 ------------------KLLYP------HKPDSSFPSGHSVGSMSIALG 118  

                   LkalfggdklgpnvtepdleglsligyslpdvltlaglllklAanvaisR
                   L +                               l+     l+++++isR
  BAB80503.1   119 LNRYNK---------------------------ALGTICVILSILMGISR 141  

                   vyaGvHypsDvlaGlllGeliallileifalvlkeafgfafrlfdgtvir
                   vy+G Hyp  v+a  l+                                 
  BAB80503.1   142 VYVGHHYPQHVVASFLI--------------------------------- 158  

                   ipsYPSGHAtfagAlatvLkalfg..ggavtpilfevdsdglelilst
                      +s+PSGH++ + ++a  L ++  + g  ++                 
  BAB80503.1   102    SSFPSGHSVGSMSIALGLNRYNKalGTICVI---------------- 132  

                   lpdvlrvaglllklaaevaisRvyaGvHypsDvlaGllL