hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_9014.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAB81382.1
Accession:      [none]
Description:    cper0 spoIIIE GIB00075CH01 "stage III sporulation protein E"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0036857  P-loop containing nucleoside triphosphate hy   187.4      2e-59   1
0053153  "Winged helix" DNA-binding domain               87.6    2.7e-24   1
0053154  "Winged helix" DNA-binding domain               86.3    2.2e-23   1
0043798  P-loop containing nucleoside triphosphate hy    69.7    8.5e-20   1
0043792  P-loop containing nucleoside triphosphate hy    58.2    9.4e-17   1
0043001  Nucleic acid-binding proteins                   31.1    2.5e-08   1
0050356  P-loop containing nucleoside triphosphate hy    20.3    3.8e-06   1
0052726  P-loop containing nucleoside triphosphate hy    22.9      6e-06   1
0043794  P-loop containing nucleoside triphosphate hy    18.2    0.00013   1
0047420  P-loop containing nucleoside triphosphate hy    14.0     0.0004   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043792    1/1     100   734 ..     1   224 []    58.2  9.4e-17
0050356    1/1     220   616 ..     1   359 []    20.3  3.8e-06
0036857    1/1     403   697 ..     1   433 []   187.4    2e-59
0052726    1/1     422   623 ..     1   181 [.    22.9    6e-06
0047420    1/1     429   638 ..     1   160 [.    14.0   0.0004
0043798    1/1     452   728 ..     1   252 []    69.7  8.5e-20
0043794    1/1     453   623 ..     1   227 []    18.2  0.00013
0043001    1/1     636   741 ..     1   114 []    31.1  2.5e-08
0053153    1/1     724   793 ..     1    70 []    87.6  2.7e-24
0053154    1/1     724   792 ..     1    69 []    86.3  2.2e-23

Alignments of top-scoring domains:
0043792: domain 1 of 1, from 100 to 734: score 58.2, E = 9.4e-17
                   *->lglllveklrpkllddvvgqeealerlllalkagk............
                        +  v  +  ++++d++ q  +   ++ ++ +  + +  ++   ++
  BAB81382.1   100    ALITSVLLIQTVNINDYYVQGSIWGSIKTIWHSQSewhggvvgfliv 146  

                   ..................................................
                      ++ + ++   ++ ++ + +  + + +++ + + +     ++++ +++
  BAB81382.1   147 lplyklvgkiglfvifvtlylissmlifdynlvsirnffggfkekaskvk 196  

                   ..................................................
                    ++++++++++++ ++++ + + +++ +++++ ++++++++ + +++   
  BAB81382.1   197 fvdkkyekddyinlkkkdgasegnkeskkddisednnkikildfmknssl 246  

                   ..................................................
                   +++++++++++++ ++++++++ +++ ++  +   +++++++   + +++
  BAB81382.1   247 ndiednkkekdnqlkdnikindfkqeskmprdlsldntiieqrgfnseka 296  

                   ..................................................
                   ++++ +++++ ++++ +   + + +++ +++  + +++++ +++++++  
  BAB81382.1   297 keeesidkeisnniaskgssvgasyvapnadllnlnnnneldkddkkall 346  

                   ..................................................
                   +++++ +++ +   +++++ ++++   ++  + + ++ +++ ++++ +++
  BAB81382.1   347 anaakleetlmsfgveakilqvtkgpsvtrfelqpkagikvskivnladd 396  

                   ..................................................
                   ++   +++ + +++ +  + ++ +++ +++++ +   ++++ ++  +++ 
  BAB81382.1   397 ialglaakgvrieapipgksaigievpnkeqtpvffreiveskefldnkf 446  

                   .....................lphlllvGppGvGKTtlaralarll..lg
                   +++ +  ++++ ++++++  ++ph+l++G +G+GK+ ++++l+ ++ ++ 
  BAB81382.1   447 kvacalgkditgkavvtdlskMPHVLIAGATGSGKSVCINTLIVSIlyKY 496  

                   sgggvdvielda....................sdlrgvddlreligevlq
                   s+ +v+++++d+++++ ++++ + +  + ++++   ++++l+  ++e+ +
  BAB81382.1   497 SPDEVKLLMIDPkvvelnvyngiphllipvvtDPKKAAAALNWAVNEMTR 546  

                   alglllgg.....................kpdvlllDEi.drl...dpda
                   ++ l++++ + +++ +++ +++ ++ ++ +++v+++DE++d +++ + d+
  BAB81382.1   547 RYKLFADNgvrniesynalynkgevpeklPYIVIIVDELaDLMmacPHDV 596  

                   qnallklleel.pagvtlilttnrle..ellpallsrfd.iiefkplsee
                   ++ + +l ++  +ag++l+++t+r++++++++ ++ +++ +i f + s+ 
  BAB81382.1   597 EDYICRLAQMArAAGMHLVIATQRPSvdVITGVIKANIPsRISFAVSSQI 646  

                   elleilkrilee.....................egvklsdealealaels
                   ++++il+   +e+     ++  + + + + + ++g ++s+e +e++++++
  BAB81382.1   647 DSRTILDSAGAEkllgrgdmlfypvgeskpqrvQGAFISEEEVEHVVSFI 696  

                   ...ggdpraalnlleraaa...grelitledvkellgekPydrLldivgigfltaddialalgiagdsperlllalallsellge
                                                                     
  BAB81382.1     -    ----------------------------------------------- -    

                   ghlylplddlveellklleldelllelieleellkelleeilvellkedl
                                  +++++++++ e ++++++l++ +++ l +++++++
  BAB81382.1   220 ---------------NKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKK 254  

                   elvlderrlyleeleldelglaellkelleeleideklldkilddle...
                   e++ + +++   +++++e+++ ++l+     +e   +  +k +++  +++
  BAB81382.1   255 EKDNQLKDNIKINDFKQESKMPRDLSLDNTIIEQRGFNSEKAKEEESidk 304  

                   ..................................................
                   ++ +++  +   +   ++  + +  + +++++ ++++++    +  + ++
  BAB81382.1   305 eisnniaskgssvgasyvapnadllnlnnnneldkddkkallanaaklee 354  

                   ..................................................
                   +     ++ ++ ++++   ++  + + +  +++ ++++  +++      +
  BAB81382.1   355 tlmsfgveakilqvtkgpsvtrfelqpkagikvskivnladdialglaak 404  

                   .............................................gilpl
                    + ++  +  +  + +++ +++++ +   ++++ ++  +++ ++   l  
  BAB81382.1   405 gvrieapipgksaigievpnkeqtpvffreiveskefldnkfkvaCALGK 454  

                   npeQkeaieailkgrvvliqGppGtGKTtlalaliaellkelkgkgkril
                   +   k+++  + k ++vli G +G+GK++ +  li  +l+++  +  + l
  BAB81382.1   455 DITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIVSILYKYSPDEVKLL 504  

                   vlaptraaaeqlaerlkkllgklvlllvlalllgvevgtlh.........
                   ++                               +++v +l +++ + +  
  BAB81382.1   505 MI-------------------------------DPKVVELNvyngiphll 523  

                   ......................rllkelldga..........llrserlr
                   + ++ + ++++++ + ++++  r  k + d+ + +++ +++  +  e  +
  BAB81382.1   524 ipvvtdpkkaaaalnwavnemtRRYKLFADNGvrniesynalYNKGEVPE 573  

                   llkfdliiiDEahdls.......epqllallkllr.ggkklvlvGDpkQL
                   +l++ +ii+DE  dl ++  +++e+ +  l +++r+ g +lv+       
  BAB81382.1   574 KLPYIVIIVDELADLMmacphdvEDYICRLAQMARaAGMHLVI------- 616  

                   ppiyfggllvslferlkkrmhpdiaeflselfygklplargrvlgaladp
                                                                     
  BAB81382.1     - -------------------------------------------------- -    

                   vvrLtknyRllgvrllpplppklagllplagladgd.................glg
                       +gvr+++p+p+k a+++++++ +  ++   ++++ ++  +++ +  
  BAB81382.1   403    AKGVRIEAPIPGKSAIGIEVPNKEQTPvffreiveskefldnkfKVA 449  

                   vllGklldgvpvtldlgelgrhllivGptGsGKStllrllaglllpd...
                    +lGk+++g+ v+ dl+++ +h+li+G+tGsGKS+ +++l+ ++l+++  
  BAB81382.1   450 CALGKDITGKAVVTDLSKM-PHVLIAGATGSGKSVCINTLIVSILYKysp 498  

                   .ggrviviDpkgeyaglarglgvvildpgdgrsvrlnplaliddeedaae
                   +++++++iDpk            v+l++++g++++l p+  ++d+++aa 
  BAB81382.1   499 dEVKLLMIDPKV-----------VELNVYNGIPHLLIPV--VTDPKKAAA 535  

                   llralvsemgrgeddfftpaarallralilalaeepeptldellellsel
                   +l++ v em r                               +++l+++ 
  BAB81382.1   536 ALNWAVNEMTR-------------------------------RYKLFADN 554  

                   glrdladrleklvagglagllegaektaasilellrkllallldlggpaf
                   g+r+++ +++ + +g++ + l                             
  BAB81382.1   555 GVRNIESYNALYNKGEVPEKL----------------------------- 575  

                   dlrdllslgeglivlillslggekqrvalarallsllfeallelggrlkp
                                                                    p
  BAB81382.1   576 -------------------------------------------------P 576  

                   pillllDEptslld......lellerllrelrklGvtlvlvtqdpsdldk
                   +i++++DE++ l+ +  +++++++ rl++++r++G++lv++tq+ps +d+
  BAB81382.1   577 YIVIIVDELADLMMacphdvEDYICRLAQMARAAGMHLVIATQRPS-VDV 625  

                   iyGseladailsncntriilrlsafdpedaelilellgltevevksvsls
                   i+G      i++n+++ri +++s  ++ d+++il+++g            
  BAB81382.1   626 ITG-----VIKANIPSRISFAVS--SQIDSRTILDSAG------------ 656  

                   tgllgsvslsiseeerpllladelaslpkgealvllpggrppvrvkvpyv
                                       a+ l  l++g++l++  g ++p rv+++++
  BAB81382.1   657 --------------------AEKL--LGRGDMLFYPVGESKPQRVQGAFI 684  

                   sdpevkavvdlvknpfilgpkvdledfigreeelkeleeal.................p.
                       p    ++v + +++  +e l++  +   +  ++++ ++++++  ++
  BAB81382.1   422    VPNKEQTPVFFREIVESKEFLDNKFKVAcalgkditgkavvtdlsKm 468  

                   kivlltGprGsGKTtllkalakel.......gkpviyidlselsskgyvd
                   ++vl+ G++GsGK+  ++ l+  + +++  ++++++ id + +       
  BAB81382.1   469 PHVLIAGATGSGKSVCINTLIVSIlykyspdEVKLLMIDPKVV------- 511  

                   leellrelaeelgellellkkllkklsellglsilglelilglsggdlee
                     + ++ + + l++ +++ kk++ +l++ ++++   ++l+ + +++++e+
  BAB81382.1   512 ELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIES 561  

                   lleelaellkk.lgkpvililDEiqslldvsskelleaLlrlldegk..n
                   +     +    ++  ++++i+DE+  l+     ++ +++ rl ++ ++++
  BAB81382.1   562 YNALYNKGEVPeKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARaaG 611  

                   vtiiltgsdlgldeelelleklslllveklrpvllddlvgqeeakeallealr......
                                         pv ++++v  +e ++   + +++  +++
  BAB81382.1   429    -------------------PVFFREIVESKEFLDNKFKVACalgkdi 456  

                   ........agrpghvllvGppGtGKT.....tlaralanelprs....lp
                   + ++++++  +++hvl+ G +G+GK++ ++++++ +l++++p++++  + 
  BAB81382.1   457 tgkavvtdLSKMPHVLIAGATGSGKSvcintLIVSILYKYSPDEvkllMI 506  

                   glpfvrvnasdltdvglleellgkllgaat....................
                   + ++v++n+ + ++ +ll   + + ++aa + + ++++++  ++  +++ 
  BAB81382.1   507 DPKVVELNVYNGIP-HLLIPVVTDPKKAAAalnwavnemtrryklfadng 555  

                   ................fllakpgvlflDEidkl....dpdvqnaLlrlle
                   + +++ +++ +++ ++ ++ ++ v+++DE+  l+++ + dv + + rl +
  BAB81382.1   556 vrniesynalynkgevPEKLPYIVIIVDELADLmmacPHDVEDYICRLAQ 605  

                   .elpsnvrviattnrpl......eldpallsRflveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKt
                               l+k i ++ ++ dls      ++ph +l++G +GsGK+
  BAB81382.1   452    ---------LGKDITGKAVVTDLS------KMPH-VLIAGATGSGKS 482  

                   tlaralagll....gpdsgkilldgkdi.....rrgiglvfqliglfphl
                    +++ l+ ++ +++ pd++k+l++++++++ ++++gi++++  ++++p+ 
  BAB81382.1   483 VCINTLIVSIlykySPDEVKLLMIDPKVvelnvYNGIPHLLIPVVTDPK- 531  

                   tvlelvalglggilveevrellkel..............lsgGqkqrvai
                         a+ ++++ v e+ +++k+++++ + +++ +++ ++ G+      
  BAB81382.1   532 -----KAAAALNWAVNEMTRRYKLFadngvrniesynalYNKGEV----- 571  

                   aralagdpkvlllDEptaldpdaqnaLlklleelak.....gvtvilath
                     +   +++v+++DE+ +l+++  + + + + +la+++ ++g+++++at+
  BAB81382.1   572 --PEKLPYIVIIVDELADLMMACPHDVEDYICRLAQmaraaGMHLVIATQ 619  

                   dls..ellpallsrcq.virfpplseeelleildril.............
                   ++s++++++ ++ +++ +i f + s+ + ++ild + +++     ++  +
  BAB81382.1   620 RPSvdVITGVIKANIPsRISFAVSSQIDSRTILDSAGaekllgrgdmlfy 669  

                   .......vleggklvedgaleelael...sggdprkalnlldraaalarl
                    + + +  +++g +++++++e++++++++s++d+ +  ++l+ + +  + 
  BAB81382.1   670 pvgeskpQRVQGAFISEEEVEHVVSFikeSQRDAQYEEDILEHINSATIA 719  

                   ellslvleilrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtG
                       ++++ k+ + +l+++                   +h+l+ G +G+G
  BAB81382.1   453    GKDITGKAVVTDLSKM-------------------PHVLIAGATGSG 480  

                   KT....tlakalaglllptsggvrvlgidaselld...............
                   K++ ++tl+  ++  + p+  +v++l id+  +  ++++ + +  + +++
  BAB81382.1   481 KSvcinTLIVSILYKYSPD--EVKLLMIDPKVVELnvyngiphllipvvt 528  

                   ...........................pselsggerqrvliaralladpk
                   + ++++++ + ++++++  ++  +++ +  +++++ ++   +   + ++ 
  BAB81382.1   529 dpkkaaaalnwavnemtrryklfadngVRNIESYNALYNKGEVPEKLPYI 578  

                   vlllDEi.dal...dpeaqnaLlklleelpk.gvtvilttnrleeldpal
                   v+++DE++d +++   ++ + + +l +  +++g++++++t+r++      
  BAB81382.1   579 VIIVDELaDLMmacPHDVEDYICRLAQMARAaGMHLVIATQRPSV----- 623  

                   lsRfdviefpppdeeelleilklilkkeglklddealellaelsggsprd
                                                                     
  BAB81382.1     - -------------------------------------------------- -    

                   alnlldraavlaagriveegtpedllealekevmelpspringsllaqfvgktVrivgkvtklrgtgnvlilvdgdgk
                             +ri++++++q++++t+++  +++kl g+g++l+++ g++k
  BAB81382.1   636    -------SRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESK 675  

                   nvtirllepldlevggvvevi......Gkvspd.ltiraltyiefgedga
                   + ++++++ + +ev++vv +i++ + +++ ++d+l  +    i   ++g+
  BAB81382.1   676 PQRVQGAFISEEEVEHVVSFIkesqrdAQYEEDiLEHINSATIASEGNGD 725  

                   efdlelynelvelvaefpqlfplgddeeedelydeavelvlesgkasisllqrrlriGynrAarlieqlee
                      +d+++del+dea+e+v+esg+as+s+lqrrlriG+nrAar+ie+lee
  BAB81382.1   724    GDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE 770  

                   egivgpaegskpRevlvseedledddeedelydeavelvleegkasvsllqrrlriGynrAarlieqlee
                      +d+++del+dea+e+v+e+g+as+s+lqrrlriG+nrAar+ie+lee
  BAB81382.1   724    GDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE 770  

                   egivgpaegskpRevlvseedl