RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAB80292.1 cper0 fruR GIB00075CH01 "probable transcriptional
regulator"
         (248 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3bxgA [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR                       106   8e-26
3dlxB [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1        105   1e-25
3dlxA [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1        100   8e-24
3bxeA [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR                        98   2e-23
3bxfB [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR                        98   3e-23
3ecsC [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             97   5e-23
3efbC [x.x.x] PROBABLE SOR-OPERON REGULATOR                            97   6e-23
3dlxC [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1         97   6e-23
3cdkB [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE           93   9e-22
3cdkD [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE           91   5e-21
2bjqA [x.x.x] MFP2A                                                    85   3e-19
3eh7A [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE                        84   4e-19
3bxeB [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR                        84   5e-19
3dlxD [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1         83   7e-19
3ecsG [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             80   6e-18
2ahuA [x.x.x] PUTATIVE ENZYME YDIF                                     77   4e-17
3ecsB [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             70   7e-15
3ecsD [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             66   8e-14
1b4aA [a.4.5 - d.74.2] ARGININE REPRESSOR                              59   1e-11
2ahvA [x.x.x] PUTATIVE ENZYME YDIF                                     58   4e-11
3by6E [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      57   6e-11
3ecsF [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             56   9e-11
3by6B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      53   7e-10
2e1cA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR              51   5e-09
3by6C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      49   2e-08
3ecsH [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             49   2e-08
3by6A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      48   3e-08
2cfxA [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC                  47   7e-08
3edpB [x.x.x] LIN2111 PROTEIN                                          46   1e-07
3by6D [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      45   2e-07
2efqA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL                  44   6e-07
2e7wA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL                  43   8e-07
2efoA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL                  42   2e-06
2ek5B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     42   2e-06
2cyyA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR              41   3e-06
2dbbB [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR              41   5e-06
3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 40   6e-06
2ek5A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     39   2e-05
3edpA [x.x.x] LIN2111 PROTEIN                                          37   6e-05
2du9A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     37   6e-05
3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 36   9e-05
2d45B [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI           36   1e-04
3ecsA [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT             35   2e-04
2ek5C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     35   3e-04
2d45A [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI           34   5e-04
3efbB [x.x.x] PROBABLE SOR-OPERON REGULATOR                            34   7e-04

>3bxgA [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
          Length = 247

 Score =  106 bits (265), Expect = 8e-26
 Identities = 16/184 (8%), Positives = 41/184 (22%), Gaps = 15/184 (8%)

Query: 65  ELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLS 124
               ++         RA            + + V  GTT   + + +             
Sbjct: 22  SGDSDQSPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRE----- 76

Query: 125 HIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPD 184
                    +      G +    K            K       +   G     G  +  
Sbjct: 77  ---------LLFVPARGGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSI 126

Query: 185 TEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPKDNTYDKKTDIK 244
            EE  +KE        + ++    +   ++  + + +     I +       +    +  
Sbjct: 127 IEEPSVKEVLNTIKSASMLVHGIGEAKTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNAD 186

Query: 245 VVDI 248
              +
Sbjct: 187 GEVV 190


>3dlxB [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
          Length = 465

 Score =  105 bits (263), Expect = 1e-25
 Identities = 32/229 (13%), Positives = 63/229 (27%), Gaps = 22/229 (9%)

Query: 39  DLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFV 98
           D+      ++        + L    K     E+ S     +  I K AA   EDG    +
Sbjct: 211 DIGAFAPEDIHIPQIYVHR-LIKGEKYEKRIERLSIRDDVRERIIKRAALEFEDGMYANL 269

Query: 99  DAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKN-------IKCYVIGGNIKISTKAIT 151
             G              + + S           +        I        I       +
Sbjct: 270 GIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFS 329

Query: 152 GCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDT----EEAILKECAINNSRKAYVLA-- 205
             ++   +     D   +GA  V     L         +        +++++   V+   
Sbjct: 330 SDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKVKGMGGAMDLVSSAKTKVVVTME 389

Query: 206 -----DDSKFGEISTIKFSDINK-CVIITNEKPKDNTYDKKTDIKVVDI 248
                +  K  E  T+  +       IIT +   D   DKK  + ++++
Sbjct: 390 HSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFD--VDKKKGLTLIEL 436


>3dlxA [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
          Length = 470

 Score = 99.8 bits (247), Expect = 8e-24
 Identities = 22/155 (14%), Positives = 35/155 (22%), Gaps = 13/155 (8%)

Query: 77  HEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQ----- 131
             +  I K AA   EDG    +  G              + + S                
Sbjct: 251 DVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEA 310

Query: 132 --KNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAI 189
               I        I       +  ++   +     D   +GA  V     L        +
Sbjct: 311 DADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKM 370

Query: 190 LKEC------AINNSRKAYVLADDSKFGEISTIKF 218
           +K          +   K  V  + S  G    I  
Sbjct: 371 VKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIME 405


>3bxeA [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
          Length = 248

 Score = 98.3 bits (244), Expect = 2e-23
 Identities = 16/184 (8%), Positives = 42/184 (22%), Gaps = 15/184 (8%)

Query: 65  ELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLS 124
               ++         RA            + + V  GTT   + + +             
Sbjct: 22  SGDSDQSPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMM------------- 68

Query: 125 HIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPD 184
                  + +      G +    K            K       +   G     G  +  
Sbjct: 69  -TPDSKNRELLFVPARGGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSI 126

Query: 185 TEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPKDNTYDKKTDIK 244
            EE  +KE        + ++    +   ++  + + +     I +       +    +  
Sbjct: 127 IEEPSVKEVLNTIKSASMLVHGIGEAKTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNAD 186

Query: 245 VVDI 248
              +
Sbjct: 187 GEVV 190


>3bxfB [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
          Length = 245

 Score = 97.8 bits (243), Expect = 3e-23
 Identities = 16/184 (8%), Positives = 41/184 (22%), Gaps = 15/184 (8%)

Query: 65  ELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLS 124
               ++         RA            + + V  GTT   + + +             
Sbjct: 21  SGDSDQSPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRE----- 75

Query: 125 HIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPD 184
                    +      G +    K            K       +   G     G  +  
Sbjct: 76  ---------LLFVPARGGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQ-GAYSSI 125

Query: 185 TEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPKDNTYDKKTDIK 244
            EE  +KE        + ++    +   ++  + + +     I +       +    +  
Sbjct: 126 IEEPSVKEVLNTIKSASMLVHGIGEAKTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNAD 185

Query: 245 VVDI 248
              +
Sbjct: 186 GEVV 189


>3ecsC [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 287

 Score = 97.0 bits (241), Expect = 5e-23
 Identities = 33/213 (15%), Positives = 62/213 (29%), Gaps = 31/213 (14%)

Query: 48  LLKRVHGGAKSLANVSKELSYN--EKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTY 105
           L  R    A    +  K++         +    +  IA    + I+DG  I   A +   
Sbjct: 68  LFLRFISLASLEYSKCKKIIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRV- 126

Query: 106 ELIDYLE-----GKDILVVSNGL------SHIDTLIQKNIKCYVIGGNIKISTKAITGCD 154
            ++  LE      K   V                L   N+   V+               
Sbjct: 127 -VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAKALCHLNVPVTVVLDA------------ 173

Query: 155 ALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKFGEIS 214
                   + D   +GA GV    G+            CA   ++  YV+A+  KF  + 
Sbjct: 174 --AVGYIEKADLVIVGAEGVVENGGIINK--IGTNQAVCAKAQNKPFYVVAESFKFVRLF 229

Query: 215 TIKFSDINKCVIITNEKPKDNTYDKKTDIKVVD 247
            +   D+        +  +++ +   T   ++ 
Sbjct: 230 PLNQQDVPDKFKYKQDLKEEHPWVDYTAPSLIT 262


>3efbC [x.x.x] PROBABLE SOR-OPERON REGULATOR
          Length = 226

 Score = 96.7 bits (240), Expect = 6e-23
 Identities = 28/226 (12%), Positives = 60/226 (26%), Gaps = 43/226 (19%)

Query: 43  LESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGT 102
           L     LK+  G           +S N++  ++       A+    L+E GD +    G 
Sbjct: 3   LWLEQQLKQKFGLK-----DVVVVSGNDEDEETQLAGLHGAQLLDRLLEPGDIVGFSWGR 57

Query: 103 TTYELIDYLEGK------DILVVSNGLSHIDT------------LIQKNIK---CYVIGG 141
               L++ L           + +  G S                  +   +         
Sbjct: 58  AVSALVENLPQAGQSRQLICVPIIGGPSGKLESRYHVNTLTYSAAAKLKGESHLADFPAL 117

Query: 142 NIKISTKAITGCDALMCL--SKFRFDKCFIGANGVHHTYGL------------TTPDTEE 187
                 +          +       D   +G                         ++E+
Sbjct: 118 LDNPLIRNGIQSQHFKTISAYWDNLDIALVGIGSPARQVAGDICSRFFDIHGAVETNSEK 177

Query: 188 AILKECAINNSRKAYVLADDSKFG-EISTIKFSDINKCVIITNEKP 232
            +  E  +  +R +  +A + K+   I  ++   IN   ++TN   
Sbjct: 178 TLSIENKLKQARYSIGIASEEKYSGIIGALRGKYIN--CLVTNSST 221


>3dlxC [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
          Length = 467

 Score = 96.7 bits (239), Expect = 6e-23
 Identities = 27/193 (13%), Positives = 45/193 (23%), Gaps = 14/193 (7%)

Query: 39  DLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFV 98
           D+      ++        + L    K     E+ S     +  I K AA   EDG    +
Sbjct: 211 DIGAFAPEDIHIPQIYVHR-LIKGEKYEKRIERLSIRDDVRERIIKRAALEFEDGMYANL 269

Query: 99  DAGTTTYELIDYLEGKDILVVSNGL-------SHIDTLIQKNIKCYVIGGNIKISTKAIT 151
             G              + + S                    I        I       +
Sbjct: 270 GIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFS 329

Query: 152 GCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKEC------AINNSRKAYVLA 205
             ++   +     D   +GA  V     L        ++K          +   K  V  
Sbjct: 330 SDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTM 389

Query: 206 DDSKFGEISTIKF 218
           + S  G    I  
Sbjct: 390 EHSAKGNAHKIME 402


>3cdkB [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
          Length = 212

 Score = 92.9 bits (230), Expect = 9e-22
 Identities = 18/152 (11%), Positives = 43/152 (28%), Gaps = 11/152 (7%)

Query: 78  EKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQ----KN 133
            ++ + K A   I+DG  + +  G  T    +  +G  +++ S               ++
Sbjct: 4   ARKRMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVHVMLQSENGLLGIGPYPLEGTED 63

Query: 134 IKCYVIGG---NIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTP----DTE 186
                 G                ++   +     D   +G   V     L         +
Sbjct: 64  ADLINAGKETITEVTGASYFDSAESFAMIRGGHIDLAILGGMEVSEQGDLANWMIPGKVK 123

Query: 187 EAILKECAINNSRKAYVLADDSKFGEISTIKF 218
                   +N +++  V+ +       S +K 
Sbjct: 124 GMGGAMDLVNGAKRIVVIMEHVNKHGESKVKK 155


>3cdkD [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
          Length = 200

 Score = 90.5 bits (224), Expect = 5e-21
 Identities = 22/187 (11%), Positives = 58/187 (31%), Gaps = 16/187 (8%)

Query: 78  EKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQ----KN 133
            ++ + K A   I+DG  + +  G  T    +  +G  +++ S               ++
Sbjct: 3   ARKRMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVHVMLQSENGLLGIGPYPLEGTED 62

Query: 134 IKCYVIGG---NIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTT----PDTE 186
                 G                ++   +     D   +G   V     L         +
Sbjct: 63  ADLINAGKETITEVTGASYFDSAESFAMIRGGHIDLAILGGMEVSEQGDLANWMIPGMVK 122

Query: 187 EAILKECAINNSRKAYVLAD--DSKFGEISTIKFSDINKC-VIITNEKPKDNTYD--KKT 241
                   +N +++  V+ +  +SK  +  ++  +       +IT+    D        T
Sbjct: 123 GMGGAMDLVNGAKRIVVIMEHVNSKVKKTCSLPLTGQKVVHRLITDLAVFDFVNGRMTLT 182

Query: 242 DIKVVDI 248
           ++ + ++
Sbjct: 183 ELTIEEV 189


>2bjqA [x.x.x] MFP2A
          Length = 340

 Score = 84.6 bits (208), Expect = 3e-19
 Identities = 18/231 (7%), Positives = 44/231 (19%), Gaps = 21/231 (9%)

Query: 3   SEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANV 62
           S        +   L G++                +     ++ + +L R          +
Sbjct: 115 STPVIMKTKDGKDLLGYIDMSTEVAAVGVSGKSEQVAGGPIQDMLVLFRNVKAPPKGIKI 174

Query: 63  SKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNG 122
                  + +   +  +         +   G  +  D GT  ++ +         V    
Sbjct: 175 Y------DDTWLDLKYRDPFPAARNPIAAGGRKVKSDDGTEMFQYVALWYEHGQPVFGRA 228

Query: 123 LSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTT 182
                     +      G   + +  A  G            D   +G       Y    
Sbjct: 229 YPD-----SADKTLANFGWGGQENAGAEIGSFQ----MLVVPDPDILGFEYKWIPYKEAK 279

Query: 183 PDTEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPK 233
                  L              A+ ++      +                 
Sbjct: 280 AGGPFKPLHVGECTPCLL--KDANGTERLGNLHMGMEKA----TAGLAGKD 324


>3eh7A [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
          Length = 389

 Score = 84.0 bits (207), Expect = 4e-19
 Identities = 14/143 (9%), Positives = 34/143 (23%), Gaps = 17/143 (11%)

Query: 70  EKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTT-YELIDYLEGKDILVVSNGLSHIDT 128
           +        +   A+ A   I++G+ + +          +D L  +  L V         
Sbjct: 2   KDVLAEYASRIVSAEEAVKHIKNGERVALSHAAGVPQSCVDALVQQADLFV--------- 52

Query: 129 LIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEA 188
                I    +G                +       D   +  +   +  G  +      
Sbjct: 53  ----EIYHLCLGEGRADFIPVFFYEVPSIRKDILHIDVAIVQLSPDEN--GYCSFGVSCD 106

Query: 189 ILKECAINNSRKAYVLADDSKFG 211
             K  A  ++       +   + 
Sbjct: 107 YSKP-AAESAHLVIGEINRQPYV 128


>3bxeB [x.x.x] CENTRAL GLYCOLYTIC GENE REGULATOR
          Length = 253

 Score = 83.6 bits (206), Expect = 5e-19
 Identities = 16/165 (9%), Positives = 34/165 (20%), Gaps = 14/165 (8%)

Query: 65  ELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYL-EGKDILVVSN-- 121
               ++         RA            + + V  GTT   + + +        +    
Sbjct: 29  SGDSDQSPWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRELLFVP 88

Query: 122 --GLSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMC------LSKFRFDKCFIGANG 173
             G    D   Q N  C  +      + + +     L        + +    +       
Sbjct: 89  ARGGLGEDVKNQANTICAHMAEKASGTYRLLFVPGQLSQGAYSSIIEEPSVKEVLNTIKS 148

Query: 174 VHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKFGEISTIKF 218
                         A   +           + D+    E     F
Sbjct: 149 ASMLVHGIGEAKTMA---QRRNTPLEDLKKIDDNDAVTEAFGYYF 190


>3dlxD [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
          Length = 459

 Score = 83.3 bits (205), Expect = 7e-19
 Identities = 20/148 (13%), Positives = 40/148 (27%), Gaps = 12/148 (8%)

Query: 75  SIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQ--- 131
           SI ++  I K AA   EDG    +  G              + + S              
Sbjct: 243 SIRKRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQH 302

Query: 132 -KNIKCYVIGG---NIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEE 187
             +      G     I       +  ++   +     D   +GA  V     L       
Sbjct: 303 EADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPG 362

Query: 188 AILKECA-----INNSRKAYVLADDSKF 210
            ++K        +++++   V+  +   
Sbjct: 363 KMVKGMGGAMDLVSSAKTKVVVTMEHSA 390



 Score = 60.2 bits (145), Expect = 6e-12
 Identities = 18/158 (11%), Positives = 33/158 (20%), Gaps = 19/158 (12%)

Query: 78  EKRAIAKYAASLIEDGDCIFVDAGTTT---YELIDYL---EGKDILVVSNGLS----HID 127
           +       A   I DG  + V           LID L     K +  VSN        + 
Sbjct: 2   KFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLG 61

Query: 128 TLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTY---GLTTPD 184
            L++      ++   +  +                  +        +       G   P 
Sbjct: 62  LLLRSKQIKRMVSSYVGENA-----EFERQ-YLSGELEVELTPQGTLAERIRAGGAGVPA 115

Query: 185 TEEAILKECAINNSRKAYVLADDSKFGEISTIKFSDIN 222
                     +            S        +  + N
Sbjct: 116 FYTPTGYGTLVQEGGSPIKYNKGSVAIASKPREVREFN 153


>3ecsG [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 277

 Score = 80.1 bits (197), Expect = 6e-18
 Identities = 35/208 (16%), Positives = 61/208 (29%), Gaps = 42/208 (20%)

Query: 36  IRRDLSYLESIN----------LLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKY 85
           +   +  L  ++          L  R    AK    + +   +  + S S   +  IA  
Sbjct: 44  LTSAIETLCGVDSSVAVSSGGELFLRFISLAKCKKIIERGELFLRRISLS---RNKIADL 100

Query: 86  AASLIEDGDCIFVDAGTTTYELIDYLE-----GKDILVVSNGLS------HIDTLIQKNI 134
             + I+DG  I   A +    ++  LE      K   V                L   N+
Sbjct: 101 CHTFIKDGATILTHAYSRV--VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAKALCHLNV 158

Query: 135 KCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECA 194
              V+                       + D   +GA GV    G+            CA
Sbjct: 159 PVTVVLDAAVGYI--------------EKADLVIVGAEGVVENGGIINKI--GTNQAVCA 202

Query: 195 INNSRKAYVLADDSKFGEISTIKFSDIN 222
              ++  YV+A+  KF  +  +   D+ 
Sbjct: 203 KAQNKPFYVVAESFKFVRLFPLNQQDVP 230


>2ahuA [x.x.x] PUTATIVE ENZYME YDIF
          Length = 505

 Score = 77.3 bits (189), Expect = 4e-17
 Identities = 19/183 (10%), Positives = 36/183 (19%), Gaps = 21/183 (11%)

Query: 77  HEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKC 136
             +R +    A     G    V  G      +   E                L  +    
Sbjct: 272 LNQRKLVARRALFERKGAVGNVGVGIADGIGLVAREEGCADDF--------ILTVETGPI 323

Query: 137 YVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGL---TTPDTEEAILKEC 193
             I     ++T+AI              D C++    V     +                
Sbjct: 324 GGITSGANVNTRAILDTSQFDFYHGGGLDVCYLSFAEVDQHGNVGVHKFNGKIGTGGFID 383

Query: 194 AINNSRKAYVLADDSKFGEISTIKF--------SDINKCVIITNEKPKDNTYDKKTDIKV 245
               S+K       +     + I            + K   I        +     +  +
Sbjct: 384 ISATSKKIIFCGTLTAGSLKTEIADGKLNIVQEGRVKK--FIRELPEITFSGKIALERGL 441

Query: 246 VDI 248
              
Sbjct: 442 DVR 444


>3ecsB [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 274

 Score = 69.9 bits (171), Expect = 7e-15
 Identities = 30/155 (19%), Positives = 49/155 (31%), Gaps = 29/155 (18%)

Query: 79  KRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE-----GKDILVV------SNGLSHID 127
           +  IA    + I+DG  I   A +    ++  LE      K   V               
Sbjct: 91  RNKIADLCHTFIKDGATILTHAYSRV--VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAK 148

Query: 128 TLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEE 187
            L   N+   V+              DA +     + D   +GA GV    G+       
Sbjct: 149 ALCHLNVPVTVV-------------LDAAVGY-IEKADLVIVGAEGVVENGGIINK--IG 192

Query: 188 AILKECAINNSRKAYVLADDSKFGEISTIKFSDIN 222
                CA   ++  YV+A+  KF  +  +   D+ 
Sbjct: 193 TNQAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVP 227


>3ecsD [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 284

 Score = 66.4 bits (162), Expect = 8e-14
 Identities = 33/205 (16%), Positives = 61/205 (29%), Gaps = 36/205 (17%)

Query: 56  AKSLANVSKELSYNEKSSKSIHEK-----RAIAKYAASLIEDGDCIFVDAGTTTYELIDY 110
                ++  +     +  +    +       IA    + I+DG  I   A +    ++  
Sbjct: 67  FLRFISLYSKCKKIIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRV--VLRV 124

Query: 111 LE-----GKDILVV------SNGLSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCL 159
           LE      K   V                L   N+   V+              DA +  
Sbjct: 125 LEAAVAAKKRFSVYVTESQPDLSGKKAKALCHLNVPVTVV-------------LDAAVGY 171

Query: 160 SKFRFDKCFIGANGVHHTYGLTTP-DTEEAILKECAINNSRKAYVLADDSKFGEISTIKF 218
            + + D   +GA GV    G+     T +A+   CA   ++  YV+A+  KF  +  +  
Sbjct: 172 IE-KADLVIVGAEGVVENGGIINKIGTNQAV---CAKAQNKPFYVVAESFKFVRLFPLNQ 227

Query: 219 SDINKCVIITNEKPKDNTYDKKTDI 243
            D+        +           D 
Sbjct: 228 QDVPDKFKYKADGQDLKEEHPWVDY 252


>1b4aA [a.4.5 - d.74.2] ARGININE REPRESSOR
          Length = 146

 Score = 59.0 bits (142), Expect = 1e-11
 Identities = 10/140 (7%), Positives = 30/140 (21%), Gaps = 12/140 (8%)

Query: 5   KRHEIILNLLKLKGFVXXXXXXXXXXXXXXX-----IRRDLSYLESINLLKRVHGGAKSL 59
           +RH  I  ++                          + RD+  ++ + +         SL
Sbjct: 2   QRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYKYSL 61

Query: 60  ANVS------KELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYL-E 112
            +        K           +     +               +       E++  +  
Sbjct: 62  PSDQRFNPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICG 121

Query: 113 GKDILVVSNGLSHIDTLIQK 132
               L++         +  +
Sbjct: 122 DDTCLIICRTPKDAKKVSNQ 141


>2ahvA [x.x.x] PUTATIVE ENZYME YDIF
          Length = 512

 Score = 57.5 bits (137), Expect = 4e-11
 Identities = 15/150 (10%), Positives = 34/150 (22%), Gaps = 15/150 (10%)

Query: 77  HEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYL-EGKDILVVSNGLSHIDTLIQKNIK 135
           ++++ +A+ A   +  G    V  G      +    EG     +    +     I  N+ 
Sbjct: 276 NQRKLVARRALFEMRKGAVGNVGVGIADGIGLVAREEGCADDFILTVETGPIGGITANVN 335

Query: 136 CYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTT----PDTEEAILK 191
                         +              D C++    V     +               
Sbjct: 336 T----------RAILDMTSQFDFYHGGGLDVCYLSFAEVDQHGNVGVHKFNGKIMGTGGF 385

Query: 192 ECAINNSRKAYVLADDSKFGEISTIKFSDI 221
                 S+K       +     + I    +
Sbjct: 386 IDISATSKKIIFCGTLTAGSLKTEIADGKL 415


>3by6E [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 124

 Score = 56.9 bits (137), Expect = 6e-11
 Identities = 6/72 (8%), Positives = 25/72 (34%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           + +    LE+  +++ + G    +   +  +  + ++       + IA+   S ++    
Sbjct: 51  VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERI 110

Query: 96  IFVDAGTTTYEL 107
             +       + 
Sbjct: 111 KKIVNDILGGKN 122


>3ecsF [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 280

 Score = 56.4 bits (136), Expect = 9e-11
 Identities = 32/171 (18%), Positives = 53/171 (30%), Gaps = 31/171 (18%)

Query: 80  RAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE-----GKDILVV------SNGLSHIDT 128
             IA    + I+DG  I   A +    ++  LE      K   V                
Sbjct: 95  NKIADLCHTFIKDGATILTHAYSRV--VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAKA 152

Query: 129 LIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTP-DTEE 187
           L   N+   V+                +      + D   +GA GV    G+     T +
Sbjct: 153 LCHLNVPVTVV---------LDAAVGYIE-----KADLVIVGAEGVVENGGIINKIGTNQ 198

Query: 188 AILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKPKDNTYD 238
           A+   CA   ++  YV+A+  KF  +  +   D+         K +    D
Sbjct: 199 AV---CAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKALKEEHPWVD 246


>3by6B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 118

 Score = 53.5 bits (128), Expect = 7e-10
 Identities = 6/65 (9%), Positives = 24/65 (36%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           + +    LE+  +++ + G    +   +  +  + ++       + IA+   S ++    
Sbjct: 50  VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERI 109

Query: 96  IFVDA 100
             +  
Sbjct: 110 KKIVN 114


>2e1cA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
          Length = 147

 Score = 50.5 bits (120), Expect = 5e-09
 Identities = 13/139 (9%), Positives = 40/139 (28%), Gaps = 5/139 (3%)

Query: 10  ILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKELSYN 69
           I+ +L+  G                 I   +  L    ++K+        A     L++ 
Sbjct: 9   IIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFI 68

Query: 70  EKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEG-KDILVVSNGLSHIDT 128
               K+       +    +   +   ++   G     +    +  +++    + +  I  
Sbjct: 69  LVKVKAGKYSEVAS--NLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPG 126

Query: 129 LIQKNIKCYVIGGNIKIST 147
           +  +     ++    K +T
Sbjct: 127 V--EGTHTMIVLKTHKETT 143


>3by6C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 120

 Score = 48.9 bits (116), Expect = 2e-08
 Identities = 6/65 (9%), Positives = 24/65 (36%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           + +    LE+  +++ + G    +   +  +  + ++       + IA+   S ++    
Sbjct: 52  VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERI 111

Query: 96  IFVDA 100
             +  
Sbjct: 112 KKIVN 116


>3ecsH [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 278

 Score = 48.7 bits (116), Expect = 2e-08
 Identities = 34/165 (20%), Positives = 55/165 (33%), Gaps = 31/165 (18%)

Query: 80  RAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE-----GKDILVV------SNGLSHIDT 128
             IA    + I+DG  I   A +    ++  LE      K   V                
Sbjct: 97  NKIADLCHTFIKDGATILTHAYSRV--VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAKA 154

Query: 129 LIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTP-DTEE 187
           L   N+   V+              DA +   + + D   +GA GV    G+     T +
Sbjct: 155 LCHLNVPVTVV-------------LDAAVGYIE-KADLVIVGAEGVVENGGIINKIGTNQ 200

Query: 188 AILKECAINNSRKAYVLADDSKFGEISTIKFSDINKCVIITNEKP 232
           A+   CA   ++  YV+A+  KF  +  +   D+        E P
Sbjct: 201 AV---CAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKEEHP 242


>3by6A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 119

 Score = 48.1 bits (114), Expect = 3e-08
 Identities = 6/65 (9%), Positives = 24/65 (36%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           + +    LE+  +++ + G    +   +  +  + ++       + IA+   S ++    
Sbjct: 51  VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERI 110

Query: 96  IFVDA 100
             +  
Sbjct: 111 KKIVN 115


>2cfxA [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
          Length = 140

 Score = 46.7 bits (110), Expect = 7e-08
 Identities = 19/145 (13%), Positives = 37/145 (25%), Gaps = 8/145 (5%)

Query: 1   MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLA 60
           M  ++    I+  LK    +               +   +  LES  ++K+         
Sbjct: 1   MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVD--Q 58

Query: 61  NVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEG-KDILVV 119
                       +   +      K     + + +  +  AG   Y L    E  + +   
Sbjct: 59  KKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDF 118

Query: 120 SNGLSHIDTLIQKNIKCYVIGGNIK 144
            N  S            +VI   I 
Sbjct: 119 INKTSPY-----AQTVTHVIFSEID 138


>3edpB [x.x.x] LIN2111 PROTEIN
          Length = 214

 Score = 46.0 bits (108), Expect = 1e-07
 Identities = 11/92 (11%), Positives = 24/92 (26%), Gaps = 3/92 (3%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           IRR +  L    L+ R +G    +       +  E        K    + A     +   
Sbjct: 40  IRRAVDLLVEEGLVVRKNGVGLYVQPKLTAQNILETGVLKKDIKDFYIRKAGKFYAEIF- 98

Query: 96  IFVDAGTTTYELIDYLEGKDILVVSNGLSHID 127
                    Y +    + +    +   +  + 
Sbjct: 99  --GKENELVYSIKFVQKSEHGATLDRLILPLG 128


>3by6D [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 121

 Score = 45.0 bits (106), Expect = 2e-07
 Identities = 6/59 (10%), Positives = 23/59 (38%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGD 94
           + +    LE+  +++ + G    +   +  +  + ++       + IA+   S ++   
Sbjct: 51  VAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGER 109


>2efqA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
          Length = 150

 Score = 43.6 bits (102), Expect = 6e-07
 Identities = 14/147 (9%), Positives = 38/147 (25%), Gaps = 3/147 (2%)

Query: 2   LSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLAN 61
           + E    I L +L+                    +   +  LE   ++K  +      + 
Sbjct: 1   MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASL 59

Query: 62  VSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEG-KDILVVS 120
               +      +K             + I     ++   G   + ++   +  ++ +   
Sbjct: 60  NLDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKF 119

Query: 121 NGLSHIDTLIQKNIKCYVIGGNIKIST 147
                    ++      V+   IK S 
Sbjct: 120 LERVMSIPEVE-RTSAQVVVKIIKESP 145


>2e7wA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
          Length = 150

 Score = 43.2 bits (101), Expect = 8e-07
 Identities = 14/147 (9%), Positives = 38/147 (25%), Gaps = 3/147 (2%)

Query: 2   LSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLAN 61
           + E    I L +L+                    +   +  LE   ++K  +      + 
Sbjct: 1   MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASL 59

Query: 62  VSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEG-KDILVVS 120
               +      +K             + I     ++   G   + ++   +  ++ +   
Sbjct: 60  NLDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKF 119

Query: 121 NGLSHIDTLIQKNIKCYVIGGNIKIST 147
                    ++      V+   IK S 
Sbjct: 120 LERVMSIPEVE-RTSTQVVVKIIKESP 145


>2efoA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
          Length = 150

 Score = 42.1 bits (98), Expect = 2e-06
 Identities = 14/147 (9%), Positives = 38/147 (25%), Gaps = 3/147 (2%)

Query: 2   LSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLAN 61
           + E    I L +L+                    +   +  LE   ++K  +      + 
Sbjct: 1   MDEIDLRI-LKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASL 59

Query: 62  VSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEG-KDILVVS 120
               +      +K             + I     ++   G   + ++   +  ++ +   
Sbjct: 60  NLDYIVITSVKAKYGKNAHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKF 119

Query: 121 NGLSHIDTLIQKNIKCYVIGGNIKIST 147
                    ++      V+   IK S 
Sbjct: 120 LERVMSIPEVE-RTSTQVVVKIIKESP 145


>2ek5B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 108

 Score = 41.9 bits (98), Expect = 2e-06
 Identities = 8/101 (7%), Positives = 22/101 (21%), Gaps = 3/101 (2%)

Query: 3   SEKRHEIILNLLKLKG--FVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLA 60
           +    + I++                          R  L+ L    +L +  G     A
Sbjct: 1   ASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSA 60

Query: 61  NVSKELSY-NEKSSKSIHEKRAIAKYAASLIEDGDCIFVDA 100
                +    + +  + +    I +             +  
Sbjct: 61  QAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLD 101


>2cyyA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
          Length = 147

 Score = 41.3 bits (96), Expect = 3e-06
 Identities = 19/140 (13%), Positives = 39/140 (27%), Gaps = 7/140 (5%)

Query: 1   MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLA 60
           +  ++  + I+ +L+  G                 I   +  L    ++K+        A
Sbjct: 2   VPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEA 61

Query: 61  -----NVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKD 115
                          K S+         +        GD   V   T   E ++     D
Sbjct: 62  LGYSLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDVVKIRTKNSEELNNF--LD 119

Query: 116 ILVVSNGLSHIDTLIQKNIK 135
           ++    G+    T++ K  K
Sbjct: 120 LIGSIPGVEGTHTIVLKTHK 139


>2dbbB [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
          Length = 148

 Score = 40.6 bits (94), Expect = 5e-06
 Identities = 16/149 (10%), Positives = 42/149 (28%), Gaps = 5/149 (3%)

Query: 1   MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLA 60
              ++    ++ +L     +               I R +  L+ + ++++         
Sbjct: 2   RKLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDK 61

Query: 61  NVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYL--EGKDILV 118
                     KS       + I++ +   IE    +    G     +   L  + KD   
Sbjct: 62  LGYMYAIVLIKSKVPSDADKVISEISD--IEYVKSVEKGVGRYNIIVRLLLPKDIKDAEN 119

Query: 119 VSNGLSHIDTLIQKNIKCYVIGGNIKIST 147
           + +         + N++  +I    K   
Sbjct: 120 LISEFLQRIKNAE-NVEVILISEVRKFEI 147


>3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 222

 Score = 40.3 bits (93), Expect = 6e-06
 Identities = 10/105 (9%), Positives = 27/105 (25%)

Query: 6   RHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKE 65
              I  + L+    +               I + L  LE    + +V G    +    ++
Sbjct: 10  ETYIEEHQLQQGDKLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRK 69

Query: 66  LSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDY 110
              +  S +  +    + +             ++ G      +  
Sbjct: 70  GYISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKR 114


>2ek5A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 114

 Score = 38.9 bits (90), Expect = 2e-05
 Identities = 8/66 (12%), Positives = 18/66 (27%), Gaps = 1/66 (1%)

Query: 36  IRRDLSYLESINLLKRVHG-GAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGD 94
            R  L+ L    +L +  G G  S    +      + +  + +    I +          
Sbjct: 43  ARNGLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRAR 102

Query: 95  CIFVDA 100
              +  
Sbjct: 103 IHALLD 108


>3edpA [x.x.x] LIN2111 PROTEIN
          Length = 217

 Score = 37.1 bits (85), Expect = 6e-05
 Identities = 12/77 (15%), Positives = 22/77 (28%), Gaps = 1/77 (1%)

Query: 36  IRRDLSYLESINLLKRVHGGAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDC 95
           IRR +  L    L+ R +G    +           ++     +K     Y     +    
Sbjct: 41  IRRAVDLLVEEGLVVRKNGVGLYVQPKLTA-QNILETGVKNLKKDIKDFYIRKAGKFYAE 99

Query: 96  IFVDAGTTTYELIDYLE 112
           IF       Y +    +
Sbjct: 100 IFGKENELVYSIKFVQK 116


>2du9A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 115

 Score = 37.0 bits (85), Expect = 6e-05
 Identities = 8/66 (12%), Positives = 18/66 (27%), Gaps = 1/66 (1%)

Query: 36  IRRDLSYLESINLLKRVHG-GAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGD 94
            R  L+ L    +L +  G G  S    +      + +  + +    I +          
Sbjct: 43  ARNGLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRAR 102

Query: 95  CIFVDA 100
              +  
Sbjct: 103 IHALLD 108


>3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 225

 Score = 36.5 bits (83), Expect = 9e-05
 Identities = 9/113 (7%), Positives = 29/113 (25%), Gaps = 3/113 (2%)

Query: 6   RHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKE 65
              I  + L+    +               I + L  LE    + +V G    +    ++
Sbjct: 11  ETYIEEHQLQQGDKLPVLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRK 70

Query: 66  ---LSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKD 115
                 + +  +  +    + +             ++ G      +  +   +
Sbjct: 71  GYISLLSNQDLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYIN 123


>2d45B [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
          Length = 116

 Score = 36.2 bits (83), Expect = 1e-04
 Identities = 17/111 (15%), Positives = 27/111 (24%), Gaps = 4/111 (3%)

Query: 2   LSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLAN 61
           +S    E+ +   K                    IR  ++ L     + R          
Sbjct: 6   ISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYY 65

Query: 62  VSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE 112
              E    E   K    K  I K            FV+    + + I+ L 
Sbjct: 66  SLVE----ESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELR 112


>3ecsA [x.x.x] TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT
          Length = 272

 Score = 35.1 bits (81), Expect = 2e-04
 Identities = 35/167 (20%), Positives = 59/167 (35%), Gaps = 32/167 (19%)

Query: 79  KRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE-----GKDILVV------SNGLSHID 127
           +  IA    + I+DG  I   A +    ++  LE      K   V               
Sbjct: 89  RNKIADLCHTFIKDGATILTHAYSRV--VLRVLEAAVAAKKRFSVYVTESQPDLSGKKAK 146

Query: 128 TLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTP-DTE 186
            L   N+   V+              DA +   + + D   +GA GV    G+     T 
Sbjct: 147 ALCHLNVPVTVV-------------LDAAVGYIE-KADLVIVGAEGVVENGGIINKIGTN 192

Query: 187 EAILKECAINNSRKAYVLADDSKFGEISTIKFSDI-NKCVIITNEKP 232
           +A+   CA   ++  YV+A+  KF  +  +   D+ +K   +  E P
Sbjct: 193 QAV---CAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHP 236


>2ek5C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 117

 Score = 34.7 bits (79), Expect = 3e-04
 Identities = 8/66 (12%), Positives = 18/66 (27%), Gaps = 1/66 (1%)

Query: 36  IRRDLSYLESINLLKRVHG-GAKSLANVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGD 94
            R  L+ L    +L +  G G  S    +      + +  + +    I +          
Sbjct: 43  ARNGLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRAR 102

Query: 95  CIFVDA 100
              +  
Sbjct: 103 IHALLD 108


>2d45A [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
          Length = 114

 Score = 33.9 bits (77), Expect = 5e-04
 Identities = 17/111 (15%), Positives = 27/111 (24%), Gaps = 4/111 (3%)

Query: 2   LSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLAN 61
           +S    E+ +   K                    IR  ++ L     + R          
Sbjct: 4   ISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYY 63

Query: 62  VSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLE 112
              E    E   K    K  I K            FV+    + + I+ L 
Sbjct: 64  SLVE----ESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELR 110


>3efbB [x.x.x] PROBABLE SOR-OPERON REGULATOR
          Length = 228

 Score = 33.5 bits (76), Expect = 7e-04
 Identities = 12/122 (9%), Positives = 30/122 (24%), Gaps = 23/122 (18%)

Query: 79  KRAIAKYAASLIEDGDCIFVDAGTTTYELIDYL----EGKDILVVSNGLSHID------- 127
               A+    L+E GD +    G     L++ L    + + ++ V               
Sbjct: 30  GLHGAQLLDRLLEPGDIVGFSWGRAVSALVENLPQAGQSRQLICVPIIGGPSGKLESRYH 89

Query: 128 ------TLIQK-NIKCYVIGGNIKIS---TKAITGCDAL--MCLSKFRFDKCFIGANGVH 175
                 +   K   + ++      +     +          +       D   +G    +
Sbjct: 90  VNTLTYSAAAKLKGESHLADFPALLDNPLIRNGIQSQHFKTISAYWDNLDIALVGIGSPN 149

Query: 176 HT 177
             
Sbjct: 150 WH 151


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0533    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,813,466
Number of extensions: 1362297
Number of successful extensions: 14568
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5773
Number of HSP's successfully gapped: 224
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)