RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAB80734.1 cper0 CPE1028 GIB00075CH01 "conserved hypothetical
protein"
         (113 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2dclC [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503                      64   3e-13
2dclA [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503                      56   4e-11
2dclB [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503                      45   1e-07

>2dclC [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
          Length = 97

 Score = 63.6 bits (155), Expect = 3e-13
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 10/104 (9%)

Query: 3   NEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIE 62
             +    L+I+I E+DK+ G PLY  I++ L++  I GATV RGI G             
Sbjct: 4   EHWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKIR-------- 55

Query: 63  ILARNLPXXXXXXXXXXXXXXXXXXXXPMIETGTITVIDNIQVI 106
            L+ +LP                    PMI+ G ITV +   V+
Sbjct: 56  -LSTDLPIIVEVVDRGHNIEKVVNVIKPMIKDGMITV-EPTIVL 97


>2dclA [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
          Length = 99

 Score = 56.4 bits (136), Expect = 4e-11
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 1  MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDF 60
          +   +    L+I+I E+DK+ G PLY  I++ L++  I GATV RGI G  +   I  + 
Sbjct: 3  VE-HWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGTDLPIIVEV 61

Query: 61 IEILAR 66
          ++    
Sbjct: 62 VDRGHN 67


>2dclB [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
          Length = 98

 Score = 44.8 bits (106), Expect = 1e-07
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 3  NEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEG 49
            +    L+I+I E+DK+ G PLY  I++ L++  I GATV RGI G
Sbjct: 4  EHWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYG 50


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.328    0.143    0.405 

Gapped
Lambda     K      H
   0.267   0.0455    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 22,535,445
Number of extensions: 1405121
Number of successful extensions: 17176
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7348
Number of HSP's successfully gapped: 647
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)