RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAB81146.1 cper0 asrA.1 GIB00075CH01 "anaerobic sulfite
reductase subunit A"
         (338 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1b0tA [d.58.1] PROTEIN (FERREDOXIN I)                                  44   5e-07
1d3wA [d.58.1] FERREDOXIN 1                                            37   6e-05
2bs2B [d.15.4 - a.1.2 (1e7pB)] QUINOL-FUMARATE REDUCTASE IRON-SU...    34   7e-04

>1b0tA [d.58.1] PROTEIN (FERREDOXIN I)
          Length = 106

 Score = 44.4 bits (103), Expect = 5e-07
 Identities = 12/111 (10%), Positives = 23/111 (20%), Gaps = 15/111 (13%)

Query: 221 ERCIACGR--CNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRK 278
           + CI C    C  VCP    +   +      +   +       C                
Sbjct: 6   DNCIKCKYTKCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSE-------- 57

Query: 279 DKGQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKD 329
                       + +         +        D  P+   +     KL+ 
Sbjct: 58  -----DEVPEDMQEFIQLNAELAEVWPNITEDKDPLPDAEDWDGVKGKLQH 103


>1d3wA [d.58.1] FERREDOXIN 1
          Length = 106

 Score = 37.4 bits (85), Expect = 6e-05
 Identities = 11/97 (11%), Positives = 22/97 (22%), Gaps = 17/97 (17%)

Query: 221 ERCIACGR--CNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRK 278
           + CI C    C  VCP    +   +      +   +       C                
Sbjct: 6   DNCIKCKYTECVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIF---------- 55

Query: 279 DKGQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICP 315
                   +V   + ++ +       V     +   P
Sbjct: 56  -----SEDEVPEDMQEFIQLNAELAEVWPNITEKKDP 87


>2bs2B [d.15.4 - a.1.2 (1e7pB)] QUINOL-FUMARATE REDUCTASE
           IRON-SULFUR SUBUNIT B
          Length = 239

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 8/55 (14%), Positives = 14/55 (25%)

Query: 274 HSFRKDKGQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLK 328
              R                      G   C+    C D+CP+ +     +  L+
Sbjct: 178 RVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLR 232


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.136    0.368 

Gapped
Lambda     K      H
   0.267   0.0452    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,604,330
Number of extensions: 1585306
Number of successful extensions: 17701
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8428
Number of HSP's successfully gapped: 379
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)