RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAB81882.1 cper0 nagA GIB00075CH01
"N-acetylglucosamine-6-phosphate deacetylase"
         (378 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3egjA [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE             172   1e-45
3dugC [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE                  172   2e-45
3dugA [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE                  163   8e-43
3be7B [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE                  162   1e-42
3be7C [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE                  161   2e-42
3dc8B [x.x.x] DIHYDROPYRIMIDINASE                                     157   6e-41
2aqvB [x.x.x] ISOASPARTYL DIPEPTIDASE                                 155   2e-40
2aqoA [x.x.x] ISOASPARTYL DIPEPTIDASE                                 151   2e-39
1e9yB [b.92.1 - c.1.9] UREASE BETA SUBUNIT                            151   3e-39
3egjB [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE             150   5e-39
3be7A [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE                  149   1e-38
1a5kC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)                         147   5e-38
3dc8A [x.x.x] DIHYDROPYRIMIDINASE                                     146   1e-37
1ejsC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           146   1e-37
1ejxC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           143   8e-37
1ejtC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           142   1e-36
1ejwC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           142   2e-36
2bb0A [x.x.x] IMIDAZOLONEPROPIONASE                                   142   2e-36
1ejrC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           142   2e-36
2aqvA [x.x.x] ISOASPARTYL DIPEPTIDASE                                 142   2e-36
1a5oC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)                         141   4e-36
1ejuC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT                           140   9e-36
2aqoB [x.x.x] ISOASPARTYL DIPEPTIDASE                                 138   4e-35
1a5nC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)                         135   3e-34
3e0lA [x.x.x] GUANINE DEAMINASE                                       134   5e-34
3e74B [x.x.x] ALLANTOINASE                                            133   8e-34
3e74A [x.x.x] ALLANTOINASE                                            130   7e-33
1e9zB [b.92.1 - c.1.9] UREASE BETA SUBUNIT                            127   4e-32
1a5mC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)                         122   2e-30
3e74C [x.x.x] ALLANTOINASE                                            119   2e-29
3d6nA [x.x.x] DIHYDROOROTASE                                          118   2e-29
2amxB [x.x.x] ADENOSINE DEAMINASE                                      91   6e-21
1cr5C [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)                     83   1e-18
1cr5A [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)                     83   2e-18
1cr5B [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)                     79   2e-17
3c86A [x.x.x] PHOSPHOTRIESTERASE                                       70   1e-14
2d2gA [x.x.x] PHOSPHOTRIESTERASE                                       69   2e-14
1a4mA [c.1.9] ADENOSINE DEAMINASE                                      66   2e-13
3e3hA [x.x.x] PARATHION HYDROLASE                                      66   2e-13
1a5lC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)                          64   8e-13
2a3lA [x.x.x] AMP DEAMINASE                                            62   3e-12
2amxA [x.x.x] ADENOSINE DEAMINASE                                      61   7e-12
3e2vB [x.x.x] 3'-5'-EXONUCLEASE                                        59   2e-11
2eg6B [x.x.x] DIHYDROOROTASE                                           55   3e-10
3e2vA [x.x.x] 3'-5'-EXONUCLEASE                                        53   2e-09
1bf6A [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN                      47   8e-08
1dpmA [c.1.9] PHOSPHOTRIESTERASE                                       39   2e-05

>3egjA [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
          Length = 379

 Score =  172 bits (436), Expect = 1e-45
 Identities = 128/377 (33%), Positives = 199/377 (52%), Gaps = 8/377 (2%)

Query: 2   LIKNCNIVYLDK-IEKGNILIENGKIKAINPKEEC--DCEVIDGEGLFLSPGFIDVHIHG 58
            + NC I   +  + K  ++I   KI+A+ P E    +  V+D  G  LSPGFID+ ++G
Sbjct: 5   ALTNCKIYTGNDVLVKHAVIINGDKIEAVCPIESLPSEMNVVDLNGANLSPGFIDLQLNG 64

Query: 59  AGGHDTMDGTYEAINE-ISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
            GG    D       + + K  +K G TSFLPT +T + E++ +++ A  + + +     
Sbjct: 65  CGGVMFNDEITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKY--PN 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
             LG HLEGP+++    G  + DF+ P         +  + D +  +TLAPE     E  
Sbjct: 123 QSLGLHLEGPYLNVMKKGIHSVDFIRPSDDT-MIDTICANSDVIAKVTLAPENNKP-EHI 180

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEIT 237
           + L + GIVVS+GHT ATY EA +  + G + ATHLFNAMTP   REPGVVGA++D+   
Sbjct: 181 EKLVKAGIVVSIGHTNATYSEARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDTPEV 240

Query: 238 TETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARL 297
              I         +      +   +K++L+TDA          +   G+ V  ++G    
Sbjct: 241 YAGIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVD 300

Query: 298 LSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLI 357
            +G+L GS LT+  AV+N  ++    L+E ++MAT   AK   VD+K G IK+G  A+L 
Sbjct: 301 ENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANLT 360

Query: 358 LFDDNIDIKYVIVNGKL 374
           +FD + ++K  +VNG+ 
Sbjct: 361 VFDRDFNVKATVVNGQY 377


>3dugC [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
          Length = 394

 Score =  172 bits (435), Expect = 2e-45
 Identities = 65/395 (16%), Positives = 119/395 (30%), Gaps = 21/395 (5%)

Query: 1   MLIKNCNIVYLD--KIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHG 58
            LIK+   + +   +I K ++LI NGKI  I      D  VI    L L PG +D H+H 
Sbjct: 3   FLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHI 62

Query: 59  AGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGAN 118
            G     + +    + +  V         L    T        +   +  +  +  +   
Sbjct: 63  VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADV--SVRDAIERGV 120

Query: 119 VLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLV--------GEHEDDVVSITLAPEV 170
           + G  +     +    G      L+PP      + V             +          
Sbjct: 121 INGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIFC 180

Query: 171 EGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGA 230
                +++         ++   KA  +EA        +HA  L             V  A
Sbjct: 181 ATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHA 240

Query: 231 VFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEV 290
            F  + T +       +    + V+    G      I +  +      G           
Sbjct: 241 SFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGKKQRENFMNAH 300

Query: 291 KNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE 350
           + GA               +               E I+ +T   A    +++  G IKE
Sbjct: 301 RRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE 359

Query: 351 GYDADLILFDDN--------IDIKYVIVNGKLVHK 377
           G+DAD++   +N         ++ +V+  GK+  +
Sbjct: 360 GFDADIVGVIENPLANIRTLEEVAFVMKEGKVYKR 394


>3dugA [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
          Length = 393

 Score =  163 bits (412), Expect = 8e-43
 Identities = 64/395 (16%), Positives = 119/395 (30%), Gaps = 21/395 (5%)

Query: 1   MLIKNCNIVYLD--KIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHG 58
            LIK+   + +   +I K ++LI NGKI  I      D  VI    L L PG +D H+H 
Sbjct: 2   FLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHI 61

Query: 59  AGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGAN 118
            G     + +    + +  V         L    T        +      +  +  +   
Sbjct: 62  VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVG--AANYADVSVRDAIERGV 119

Query: 119 VLGAHLEGPFISTSAIGAQNPDFLIPPTKE--------NFYKLVGEHEDDVVSITLAPEV 170
           + G  +     +    G      L+PP           + ++       +          
Sbjct: 120 INGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIFC 179

Query: 171 EGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGA 230
                +++         ++   KA  +EA        +HA  L             V  A
Sbjct: 180 ATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHA 239

Query: 231 VFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEV 290
            F  + T +       +    + V+    G      I +  +      G           
Sbjct: 240 SFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGKKQRENFMNAH 299

Query: 291 KNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE 350
           + GA               +               E I+ +T   A    +++  G IKE
Sbjct: 300 RRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE 358

Query: 351 GYDADLILFDDN--------IDIKYVIVNGKLVHK 377
           G+DAD++   +N         ++ +V+  GK+  +
Sbjct: 359 GFDADIVGVIENPLANIRTLEEVAFVMKEGKVYKR 393


>3be7B [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
          Length = 395

 Score =  162 bits (410), Expect = 1e-42
 Identities = 67/396 (16%), Positives = 120/396 (30%), Gaps = 22/396 (5%)

Query: 1   MLIKNCNIVYLD--KIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHG 58
            LIK+   + +   +I K ++LI NGKI  I      D  VI    L L PG +D H+H 
Sbjct: 3   FLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHI 62

Query: 59  AGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGAN 118
            G     + +    + +  V         L    T               +  +  +   
Sbjct: 63  VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGA--ANYADVSVRDAIERGV 120

Query: 119 VLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTK 178
           + G  +     +    G      L+PP      + V +   +   +       GA  +  
Sbjct: 121 INGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIKF 180

Query: 179 FLSE---------KGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVG 229
             +               ++   KA  +EA        +HA  L             V  
Sbjct: 181 CATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEH 240

Query: 230 AVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVE 289
           A F  + T +       +    + V+    G      I +  +      G          
Sbjct: 241 ASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGKKQRENFMNA 300

Query: 290 VKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIK 349
            + GA               +               E I+ +T   A    +++  G IK
Sbjct: 301 HRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIK 359

Query: 350 EGYDADLILFDDN--------IDIKYVIVNGKLVHK 377
           EG+DAD++   +N         ++ +V+  GK+  +
Sbjct: 360 EGFDADIVGVIENPLANIRTLEEVAFVMKEGKVYKR 395


>3be7C [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
          Length = 394

 Score =  161 bits (408), Expect = 2e-42
 Identities = 57/401 (14%), Positives = 116/401 (28%), Gaps = 32/401 (7%)

Query: 1   MLIKNCNIVYLD--KIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHG 58
            LIK+   + +   +I K ++LI NGKI  I      D  VI    L L PG +D H+H 
Sbjct: 2   FLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHI 61

Query: 59  AGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGAN 118
            G     + +    + +  V         L    T               +  +  +   
Sbjct: 62  VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAA--NYADVSVRDAIERGV 119

Query: 119 VLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTK 178
           + G  +     +    G      L+PP      +                 V   ++   
Sbjct: 120 INGPTMLVSGPALGITGGHCDHNLLPPEFNYSSE-----GVVDSPWEARKMVRKNRKYGA 174

Query: 179 FLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEITT 238
            L +      +             ++   +      N          G++G     +   
Sbjct: 175 DLIKFCATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGV 234

Query: 239 ETISDGIHIAYPSL-RVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEV------- 290
           +++     I   ++             + ++D ++      G+         +       
Sbjct: 235 DSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGKKQRE 294

Query: 291 ------KNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDK 344
                 + GA               +               E I+ +T   A    +++ 
Sbjct: 295 NFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN- 353

Query: 345 KGLIKEGYDADLILFDDN--------IDIKYVIVNGKLVHK 377
            G IKEG+DAD++   +N         ++ +V+  GK+  +
Sbjct: 354 IGQIKEGFDADIVGVIENPLANIRTLEEVAFVMKEGKVYKR 394


>3dc8B [x.x.x] DIHYDROPYRIMIDINASE
          Length = 474

 Score =  157 bits (396), Expect = 6e-41
 Identities = 60/433 (13%), Positives = 113/433 (26%), Gaps = 59/433 (13%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGG 61
           +IK   IV  D   K ++ +E G+I  I P      E +D  G ++ PG ID H H    
Sbjct: 3   VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA-ETLDATGCYVMPGGIDPHTHLEMP 61

Query: 62  HDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLG 121
                   +     ++  +  GTT  +   +      +       +K+     D +  + 
Sbjct: 62  FMGTYS-SDDFESGTRAALAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMA 120

Query: 122 AHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSI------------TLAPE 169
               G  +            +       +   +   +D++ S               A  
Sbjct: 121 ITWWGEQVFNEMETIVKDKGINTFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHAEN 180

Query: 170 VEGAKELTKFLSEKGIVVSMGHTKATYEEAME----------GIKCGCSHATHLFNAMTP 219
            +   +L   L  +G      H  +   E              +     +  H       
Sbjct: 181 GDVVAQLQAKLLAEGNSGPEAHAYSRPAEVEGEAANRAIMIADMAGCPVYIVHTSCEQAH 240

Query: 220 FTHREPGVVGAVFDSEIT-TETISDGIHIAYP--SLRVAYKQKGTDKVLLITDAMMACCM 276
              R     G     E        D                     +  L  D++ A   
Sbjct: 241 EAIRRARAKGMRVFGEPLIQHLTLDETEYFDKDWDHAARRVMSPPFRNKLHQDSLWAGLA 300

Query: 277 PDGMYSLGGQDVE-------VKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIK 329
              +  +                G    +     G    + +            +NE + 
Sbjct: 301 SGSLQVVATDHCAFTTEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGVATGRITMNEFVA 360

Query: 330 MATYNGAKHCKVDDKKGLIKEGYDADLILFDDNI-------------------------D 364
           + + N AK   +  KKG I  G DADL+++D                             
Sbjct: 361 VTSTNIAKILNIYPKKGAILVGADADLVVWDPKRSKTISAKTQQSAIDYNVFEGKTVTGL 420

Query: 365 IKYVIVNGKLVHK 377
            ++ +  G +  +
Sbjct: 421 PRFTLTRGVVSIE 433


>2aqvB [x.x.x] ISOASPARTYL DIPEPTIDASE
          Length = 374

 Score =  155 bits (391), Expect = 2e-40
 Identities = 58/380 (15%), Positives = 116/380 (30%), Gaps = 32/380 (8%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAI----NPKEECDCEVIDGEGLFLSPGFIDVHIH 57
           L++  ++   +     ++L+ NGKI A+          +C V+D  G  L PGFID H+H
Sbjct: 11  LLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVH 70

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
             GG      T          + + G TS +    T +     +S+ A  +A        
Sbjct: 71  LIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA-------- 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
                              +        T                 + +   V G   ++
Sbjct: 123 -----------------LNEEGISAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAIS 165

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEIT 237
              S    V  + +  A                 H+ ++          +          
Sbjct: 166 DHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKL 225

Query: 238 TETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARL 297
             T  +     +       ++     + + +         +G+       + +       
Sbjct: 226 LPTHVNRNVPLFEQALEFARKG--GTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSS 283

Query: 298 LSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLI 357
                     TL   V+ + K+ ++ +++ ++  T + A    +  K G I  G DADL+
Sbjct: 284 DGNGSVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILPGNDADLL 342

Query: 358 LFDDNIDIKYVIVNGKLVHK 377
           +    + I+ V   GKL+ K
Sbjct: 343 VMTPELRIEQVYARGKLMVK 362


>2aqoA [x.x.x] ISOASPARTYL DIPEPTIDASE
          Length = 377

 Score =  151 bits (382), Expect = 2e-39
 Identities = 67/381 (17%), Positives = 123/381 (32%), Gaps = 31/381 (8%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAI----NPKEECDCEVIDGEGLFLSPGFIDVHIH 57
           L++  ++   +     ++L+ NGKI A+          +C V+D  G  L PGFID H+H
Sbjct: 11  LLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVH 70

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
             GG      T          + + G TS +    T +     +S+ A  +A        
Sbjct: 71  LIGGGGQAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA-------- 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
                + EG            P   I  + E    ++                       
Sbjct: 123 ----LNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRS--------- 169

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVV-GAVFDSEI 236
                   V  + +  A                 H+ ++          +    V  S++
Sbjct: 170 ----AAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKL 225

Query: 237 TTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAAR 296
               ++  + +   +L  A K    D    I + +            G     V   +  
Sbjct: 226 LPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDG 285

Query: 297 LLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADL 356
             S        TL   V+ + K+ ++ +++ ++  T + A    +   KG I  G DADL
Sbjct: 286 NGSQIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNL-TGKGEILPGNDADL 344

Query: 357 ILFDDNIDIKYVIVNGKLVHK 377
           ++    + I+ V   GKL+ K
Sbjct: 345 LVMTPELRIEQVYARGKLMVK 365


>1e9yB [b.92.1 - c.1.9] UREASE BETA SUBUNIT
          Length = 568

 Score =  151 bits (382), Expect = 3e-39
 Identities = 57/415 (13%), Positives = 103/415 (24%), Gaps = 46/415 (11%)

Query: 1   MLIKNCNIVYLDKIEK----------------GNILIENGKIKAINPKEECDCEVIDGEG 44
           ++I N  IV    I K                GN  +++G    ++       E + GEG
Sbjct: 68  LIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGP--ATEALAGEG 125

Query: 45  LFLSPGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSME 104
           L ++ G ID HIH              +  +              TT+T    ++   + 
Sbjct: 126 LIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGT-GPADGTNATTITPGRRNLKWMLR 184

Query: 105 AIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKL--VGEHEDDVV 162
           A  +        A    ++         A            T         V +  D  V
Sbjct: 185 AAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFIHEDWGTTPSAINHALDVADKYDVQV 244

Query: 163 SITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTH 222
           +I      E         +  G  +   HT+         I         L  +  P   
Sbjct: 245 AIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIP 304

Query: 223 REPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYS 282
                     D  +    +      +          +   + +   D +          S
Sbjct: 305 FTVNTEAEHMDMLM----VCHHKDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSITSS 360

Query: 283 LGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVD 342
                  V     R    +   +        +    N N+ +   +   T N A    + 
Sbjct: 361 DSQAMGRVGEVITRTWQTA-DKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGIS 419

Query: 343 DKKGLIKEGYDADLILFDDN--------------------IDIKYVIVNGKLVHK 377
           +  G ++ G  ADL+L+                        D    I   + V+ 
Sbjct: 420 EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYY 474


>3egjB [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
          Length = 361

 Score =  150 bits (379), Expect = 5e-39
 Identities = 130/381 (34%), Positives = 194/381 (50%), Gaps = 29/381 (7%)

Query: 2   LIKNCNIVYLDK-IEKGNILIENGKIKAINPKEEC--DCEVIDGEGLFLSPGFIDVHIHG 58
            + NC I   +  + K  ++I   KI+A+ P E    +  V+D  G  LSPGFID+ ++G
Sbjct: 5   ALTNCKIYTGNDVLVKHAVIINGDKIEAVCPIESLPSEMNVVDLNGANLSPGFIDLQLNG 64

Query: 59  AGGHDTMDGTY-EAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
            GG    D    E I+ + K  +K G TSFLPT +T + E++ +++ A  + + +     
Sbjct: 65  CGGVMFNDEITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKY--PN 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
             LG HLEGP  +       N D +   T           E  V                
Sbjct: 123 QSLGLHLEGPDDTMIDTICANSDVIAKVTLAPENNKPEHIEKLVK--------------- 167

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVF-DSEI 236
                 GIVVS+GHT ATY EA +  + G + ATHLFNAMTP   REPGVVGA++   E+
Sbjct: 168 -----AGIVVSIGHTNATYSEARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDTPEV 222

Query: 237 TTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAAR 296
               I+DG H+ Y ++R+A+K KG   VL+   A          +   G+ V  ++G   
Sbjct: 223 YAGIIADGFHVDYANIRIAHKIKGEKLVLVTD-ATAPAGAEMDYFIFVGKKVYYRDGKCV 281

Query: 297 LLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADL 356
             +G+L GS LT+  AV+N  ++    L+E ++MAT   AK   VD+K G IK+G  A+L
Sbjct: 282 DENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANL 341

Query: 357 ILFDDNIDIKYVIVNGKLVHK 377
            +FD + ++K  +VNG+   +
Sbjct: 342 TVFDRDFNVKATVVNGQ-YEQ 361


>3be7A [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
          Length = 398

 Score =  149 bits (376), Expect = 1e-38
 Identities = 64/397 (16%), Positives = 121/397 (30%), Gaps = 26/397 (6%)

Query: 2   LIKNCNIVYLD--KIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGA 59
           LIK+   + +   +I K ++LI NGKI  I      D  VI    L L PG +D H+H  
Sbjct: 5   LIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIV 64

Query: 60  GGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANV 119
           G     + +    + +  V         L    T        +   +     +  +   +
Sbjct: 65  GNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVR--DAIERGVI 122

Query: 120 LGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKF 179
            G  +     +    G      L+PP      +     +    +  +  +          
Sbjct: 123 NGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEG--VVDSPWEARKMVRKNRKYGADLIK 180

Query: 180 LSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFD----SE 235
               G V+S        +  +E +K     A +    +    H   G+  A+       E
Sbjct: 181 FCATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVE 240

Query: 236 ITTETISDGIH-------IAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDV 288
             +    + I        +    + V+    G      I +  +      G         
Sbjct: 241 HASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGKKQRENFMN 300

Query: 289 EVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLI 348
             + GA               +               E I+ +T   A    +++  G I
Sbjct: 301 AHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQI 359

Query: 349 KEGYDADLILFDDN--------IDIKYVIVNGKLVHK 377
           KEG+DAD++   +N         ++ +V+  GK+  +
Sbjct: 360 KEGFDADIVGVIENPLANIRTLEEVAFVMKEGKVYKR 396


>1a5kC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
          Length = 566

 Score =  147 bits (371), Expect = 5e-38
 Identities = 56/406 (13%), Positives = 104/406 (25%), Gaps = 51/406 (12%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKE---------NFYKL 153
              I           NV         ++   IG +  +                      
Sbjct: 187 PVNIG-----LLGKGNVSQPDALREQVAAGVIGLEIHEDWGATPAAIDCALTVADEMDIQ 241

Query: 154 VGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHL 213
           V  H D +       +   A       +        GH                S    L
Sbjct: 242 VALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTL 301

Query: 214 FNAMTPFTHREPGVVGAVFDSE-ITTETISDGIHIAYPSLRVAYK-QKGTDKVLLITDAM 271
              +         ++        I  +       I   ++             L  +D+ 
Sbjct: 302 PYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSDSQ 361

Query: 272 MACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMA 331
               + + +                          +      +    N N+ +   I   
Sbjct: 362 AMGRVGEVILRTWQ---------------VAHRMKVQRGALAEETGDNDNFRVKRYIAKY 406

Query: 332 TYNGAKHCKVDDKKGLIKEGYDADLILFDDN--IDIKYVIVNGKLV 375
           T N A    +  + G I+ G  ADL+++           ++ G ++
Sbjct: 407 TINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMI 452


>3dc8A [x.x.x] DIHYDROPYRIMIDINASE
          Length = 482

 Score =  146 bits (368), Expect = 1e-37
 Identities = 59/433 (13%), Positives = 115/433 (26%), Gaps = 59/433 (13%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGG 61
           +IK   IV  D   K ++ +E G+I  I P      E +D  G ++ PG ID H H    
Sbjct: 3   VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA-ETLDATGCYVMPGGIDPHTHLEMP 61

Query: 62  HDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLG 121
                   +     ++  +  GTT  +   +      +       +K+     D +  + 
Sbjct: 62  FMGTYS-SDDFESGTRAALAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMA 120

Query: 122 AHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHED------------DVVSITLAPE 169
               G  +            +       +   +   +D              + +  A  
Sbjct: 121 ITWWGEQVFNEMETIVKDKGINTFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHAEN 180

Query: 170 VEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTH------- 222
            +   +L   L  +G      H  +   E              +        H       
Sbjct: 181 GDVVAQLQAKLLAEGNSGPEAHAYSRPAEVEGEAANRAIMIADMAGCPVYIVHTSCEQAH 240

Query: 223 ---REPGVVGAVFDSEITTE-TISDGIHIAYPSLRVAYKQKGTDKVLL--ITDAMMACCM 276
              R     G     E   +    D           A ++  +         D++ A   
Sbjct: 241 EAIRRARAKGMRVFGEPLIQHLTLDETEYFDKDWDHAARRVMSPPFRNKLHQDSLWAGLA 300

Query: 277 PDGMYSLG-------GQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIK 329
              +  +         +      G    +     G    + +            +NE + 
Sbjct: 301 SGSLQVVATDHCAFTTEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGVATGRITMNEFVA 360

Query: 330 MATYNGAKHCKVDDKKGLIKEGYDADLILFDDNI-------------------------D 364
           + + N AK   +  KKG I  G DADL+++D                             
Sbjct: 361 VTSTNIAKILNIYPKKGAILVGADADLVVWDPKRSKTISAKTQQSAIDYNVFEGKTVTGL 420

Query: 365 IKYVIVNGKLVHK 377
            ++ +  G +  +
Sbjct: 421 PRFTLTRGVVSIE 433


>1ejsC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 565

 Score =  146 bits (368), Expect = 1e-37
 Identities = 57/408 (13%), Positives = 100/408 (24%), Gaps = 45/408 (11%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKE---NFYKLVGEHED 159
              I           + L   +    I             I             V  H D
Sbjct: 187 PVNIGLLGKGNVSQPDALREQVAAGVIGLINEDWGATPAAIDCALTVADEMDIQVALHSD 246

Query: 160 DVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTP 219
            +       +   A       +        GH                S    L   +  
Sbjct: 247 TLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPYTLNT 306

Query: 220 FTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDG 279
                  ++                  +A+   R+  +       +   D +        
Sbjct: 307 IDEHLDMLMVCHHL------DPDIAEDVAFAESRIRRET------IAAEDVLHDLGAFSL 354

Query: 280 MYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHC 339
             S       V     R          +      +    N N+ +   I   T N A   
Sbjct: 355 TSSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTH 413

Query: 340 KVDDKKGLIKEGYDADLILFDDNID-----------IKYVIVNGKLVH 376
            +  + G I+ G  ADL+++                +  +   G +  
Sbjct: 414 GIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 461


>1ejxC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 555

 Score =  143 bits (361), Expect = 8e-37
 Identities = 58/404 (14%), Positives = 110/404 (27%), Gaps = 47/404 (11%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHK 108
            G ID HIH        +     +      +V  GT     T  T            +  
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVT----TMVGGGTGPAAGTHATTCTPGPWYISRMLQA 182

Query: 109 AKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAP 168
           A +   +   +   ++  P      + A     +                       +  
Sbjct: 183 ADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLIHEDW---------GATPAA----IDC 229

Query: 169 EVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVV 228
            +  A E+   ++     ++          A+ G      H         P         
Sbjct: 230 ALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHP 289

Query: 229 GAVFDSE-----ITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSL 283
             +  S       T  TI + + +    +  A  +   + +    D +          S 
Sbjct: 290 NILPSSTNPTLPYTLNTIDEHLDMLMVCVAFAESRIRRETIAAE-DVLHDLGAFSLTSSD 348

Query: 284 GGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDD 343
                 V     R    +     +      +    N N+ +   I   T N A    +  
Sbjct: 349 SQAMGRVGEVILRTWQVA-HRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAH 407

Query: 344 KKGLIKEGYDADLILFDDNID-----------IKYVIVNGKLVH 376
           + G I+ G  ADL+++                +  +   G +  
Sbjct: 408 EVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 451


>1ejtC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 565

 Score =  142 bits (359), Expect = 1e-36
 Identities = 57/412 (13%), Positives = 101/412 (24%), Gaps = 53/412 (12%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHK 108
            G ID HIH        +     +      +V  GT     T  T            +  
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVT----TMVGGGTGPAAGTHATTCTPGPWYISRMLQA 182

Query: 109 AKTEGTDGA---NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKL----------VG 155
           A +   +         +  +      +A            T                 V 
Sbjct: 183 ADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLIQEDWGATPAAIDCALTVADEMDIQVA 242

Query: 156 EHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFN 215
            H D +       +   A       +        GH                S    L  
Sbjct: 243 LHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPY 302

Query: 216 AMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACC 275
            +         ++                  +A+   R+  +       +   D +    
Sbjct: 303 TLNTIDEHLDMLMVCHHLDPDIA------EDVAFAESRIRRET------IAAEDVLHDLG 350

Query: 276 MPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNG 335
                 S       V     R          +      +    N N+ +   I   T N 
Sbjct: 351 AFSLTSSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINP 409

Query: 336 AKHCKVDDKKGLIKEGYDADLILFDDN-----------IDIKYVIVNGKLVH 376
           A    +  + G I+ G  ADL+++                +  +   G +  
Sbjct: 410 ALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 461


>1ejwC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 565

 Score =  142 bits (358), Expect = 2e-36
 Identities = 57/408 (13%), Positives = 99/408 (24%), Gaps = 45/408 (11%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKE---NFYKLVGEHED 159
              I           + L   +    I             I             V  H D
Sbjct: 187 PVNIGLLGKGNVSQPDALREQVAAGVIGLIHEDWGATPAAIDCALTVADEMDIQVALHSD 246

Query: 160 DVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTP 219
            +       +   A       +        GH                S    L   +  
Sbjct: 247 TLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPYTLNT 306

Query: 220 FTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDG 279
                  ++                  +A+   R+  +           D +        
Sbjct: 307 IDEHLDMLMVCHHLDP------DIAEDVAFAESRIRRETIA------AEDVLHDLGAFSL 354

Query: 280 MYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHC 339
             S       V     R          +      +    N N+ +   I   T N A   
Sbjct: 355 TSSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTH 413

Query: 340 KVDDKKGLIKEGYDADLILFDDNID-----------IKYVIVNGKLVH 376
            +  + G I+ G  ADL+++                +  +   G +  
Sbjct: 414 GIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 461


>2bb0A [x.x.x] IMIDAZOLONEPROPIONASE
          Length = 413

 Score =  142 bits (357), Expect = 2e-36
 Identities = 49/395 (12%), Positives = 97/395 (24%), Gaps = 22/395 (5%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAI----NPKEECDCEVIDGEGLFLSPGFIDVHIH 57
                ++  L  IE   + I   KI               E+ID  G  ++PG +D H H
Sbjct: 21  PRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTH 80

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDG- 116
              G          +  IS + +       L T     A    + ++  H          
Sbjct: 81  LVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYG 140

Query: 117 -ANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLV-GEHEDDVVSITLAPEVEGAK 174
                     G    T     +    L      +      G H           +     
Sbjct: 141 TTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQM 200

Query: 175 ELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVG-AVFD 233
                  ++  + S                                   E   +G A   
Sbjct: 201 LSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELA 260

Query: 234 SEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNG 293
            ++   +    +  +   ++   +      +L  T   +         ++  + V V   
Sbjct: 261 GKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLA 320

Query: 294 AARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYD 353
                    +     + + +     +      E+    T N A      ++ G +K G  
Sbjct: 321 TDF---NPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRS 377

Query: 354 ADLILFDDN-----------IDIKYVIVNGKLVHK 377
           ADL+++                +  V+ NG +V  
Sbjct: 378 ADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVN 412


>1ejrC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 552

 Score =  142 bits (358), Expect = 2e-36
 Identities = 62/416 (14%), Positives = 109/416 (26%), Gaps = 56/416 (13%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHK 108
            G ID HIH        +     +      +V  GT     T  T            I +
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVT----TMVGGGTGPAAGTHATTCTP----GPWYISR 178

Query: 109 AKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAP 168
                      +G   +G      A+  Q    +I    E +               +  
Sbjct: 179 MLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLIHEAWGATPAA---------IDC 229

Query: 169 EVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVV 228
            +  A E+   ++     ++          A+ G      H         P         
Sbjct: 230 ALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHP 289

Query: 229 GAVFDSEI-TTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQD 287
             +  S   T     + I      L    + +   + +   D +          S     
Sbjct: 290 NILPSSTNPTLPYTLNTIDEHLDMLMAFAESRIRRETIAAEDVLHDLGAFSLTSSDSQAM 349

Query: 288 VEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGL 347
             V     R          +      +    N N+ +   I   T N A    +  + G 
Sbjct: 350 GRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGS 408

Query: 348 IKEGYDADLILFDDNID-------------------------IKYVIVNGKLVHKA 378
           I+ G  ADL+++                                   V+ + +  A
Sbjct: 409 IEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGA 464


>2aqvA [x.x.x] ISOASPARTYL DIPEPTIDASE
          Length = 374

 Score =  142 bits (357), Expect = 2e-36
 Identities = 62/380 (16%), Positives = 119/380 (31%), Gaps = 32/380 (8%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAI----NPKEECDCEVIDGEGLFLSPGFIDVHIH 57
           L++  ++   +     ++L+ NGKI A+          +C V+D  G  L PGFID H+H
Sbjct: 11  LLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVH 70

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
             GG      T          + + G TS +    T +     +S+ A  +A  E     
Sbjct: 71  LIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNE----E 126

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
            +    L G F   S                               + +   V G   ++
Sbjct: 127 GISAWMLTGAFHVPSR---------------------TITGSVEKDVAIIDRVIGVCAIS 165

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEIT 237
              S    V  + +  A                 H+ ++          +          
Sbjct: 166 DHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKL 225

Query: 238 TETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARL 297
             T  +     +         +    + + +         +G+       + +       
Sbjct: 226 LPTHVNRNVPLFEQAL--EFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSS 283

Query: 298 LSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLI 357
                     TL   V+ + K+ ++ +++ ++  T + A    +  K G I  G DADL+
Sbjct: 284 DGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILPGNDADLL 342

Query: 358 LFDDNIDIKYVIVNGKLVHK 377
           +    + I+ V   GKL+ K
Sbjct: 343 VMTPELRIEQVYARGKLMVK 362


>1a5oC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
          Length = 566

 Score =  141 bits (355), Expect = 4e-36
 Identities = 58/415 (13%), Positives = 100/415 (24%), Gaps = 58/415 (13%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKE---------NFYKL 153
              I           NV         ++   IG    +                      
Sbjct: 187 PVNIG-----LLGKGNVSQPDALREQVAAGVIGLCIHEDWGATPAAIDCALTVADEMDIQ 241

Query: 154 VGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHL 213
           V  H D +       +   A       +        GH                S    L
Sbjct: 242 VALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTL 301

Query: 214 FNAMTPFTHREPGVVGAVFDSE-ITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMM 272
              +         ++        I  +       I   ++                D + 
Sbjct: 302 PYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAE-------------DVLH 348

Query: 273 ACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMAT 332
                    S       V     R          +      +    N N+ +   I   T
Sbjct: 349 DLGAFSLTSSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYT 407

Query: 333 YNGAKHCKVDDKKGLIKEGYDADLILFDDNID-----------IKYVIVNGKLVH 376
            N A    +  + G I+ G  ADL+++                +  +   G +  
Sbjct: 408 INPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 462


>1ejuC [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
          Length = 552

 Score =  140 bits (352), Expect = 9e-36
 Identities = 60/406 (14%), Positives = 108/406 (26%), Gaps = 54/406 (13%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVV 162
              I           NV         ++   IG  + D+   P                 
Sbjct: 187 PVNIG-----LLGKGNVSQPDALREQVAAGVIGLIHEDWGATPA---------------- 225

Query: 163 SITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTH 222
              +   +  A E+   ++     ++          A+ G      H         P   
Sbjct: 226 --AIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDII 283

Query: 223 REPGVVGAVFDSEI-TTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMY 281
                   +  S   T     + I      L    + +   + +   D +          
Sbjct: 284 TACAHPNILPSSTNPTLPYTLNTIDEHLDMLMAFAESRIRRETIAAEDVLHDLGAFSLTS 343

Query: 282 SLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKV 341
           S       V     R          +      +    N N+ +   I   T N A    +
Sbjct: 344 SDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGI 402

Query: 342 DDKKGLIKEGYDADLILFDDN-----------IDIKYVIVNGKLVH 376
             + G I+ G  ADL+++                +  +   G +  
Sbjct: 403 AHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 448


>2aqoB [x.x.x] ISOASPARTYL DIPEPTIDASE
          Length = 374

 Score =  138 bits (346), Expect = 4e-35
 Identities = 57/380 (15%), Positives = 117/380 (30%), Gaps = 32/380 (8%)

Query: 2   LIKNCNIVYLDKIEKGNILIENGKIKAI----NPKEECDCEVIDGEGLFLSPGFIDVHIH 57
           L++  ++   +     ++L+ NGKI A+          +C V+D  G  L PGFID H+H
Sbjct: 11  LLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVH 70

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGA 117
             GG      T          + + G TS +    T +     +S+ A  +A        
Sbjct: 71  LIGGGGQAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA-------- 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELT 177
                                  +++        +           + +   V G   ++
Sbjct: 123 ---------------LNEEGISAWMLTGAYHVPSR--TITGSVEKDVAIIDRVIGVCAIS 165

Query: 178 KFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEIT 237
              S    V  + +  A                 H+ ++          +          
Sbjct: 166 DHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKL 225

Query: 238 TETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARL 297
             T  +     +         +    + + +         +G+       + +       
Sbjct: 226 LPTHVNRNVPLFEQ--ALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSS 283

Query: 298 LSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLI 357
                     TL   V+ + K+ ++ +++ ++  T + A    +  K G I  G DADL+
Sbjct: 284 DGNGSVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILPGNDADLL 342

Query: 358 LFDDNIDIKYVIVNGKLVHK 377
           +    + I+ V   GKL+ K
Sbjct: 343 VMTPELRIEQVYARGKLMVK 362


>1a5nC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
          Length = 551

 Score =  135 bits (339), Expect = 3e-34
 Identities = 60/399 (15%), Positives = 110/399 (27%), Gaps = 41/399 (10%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECD------------CEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI      D             EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHK 108
            G ID HIH        +     +      +V  GT     T  T            I +
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVT----TMVGGGTGPAAGTHATTCTP----GPWYISR 178

Query: 109 AKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAP 168
                      +G   +G      A+  Q    +I       +       D  +++    
Sbjct: 179 MLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLAIHEDWGATPAAIDCALTV---- 234

Query: 169 EVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVV 228
               A E+   ++     ++          A+ G      H         P         
Sbjct: 235 ----ADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHP 290

Query: 229 GAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDV 288
             +  S   T   +      +  +  A  +   + +    D +          S      
Sbjct: 291 NILPSSTNPTLPYTLNTIDEHLDMAFAESRIRRETIAAE-DVLHDLGAFSLTSSDSQAMG 349

Query: 289 EVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLI 348
            V     R    +     +      +    N N+ +   I   T N A    +  + G I
Sbjct: 350 RVGEVILRTWQVA-HRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSI 408

Query: 349 KEGYDADLILFDDNID-----------IKYVIVNGKLVH 376
           + G  ADL+++                +  +   G +  
Sbjct: 409 EVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 447


>3e0lA [x.x.x] GUANINE DEAMINASE
          Length = 442

 Score =  134 bits (336), Expect = 5e-34
 Identities = 48/450 (10%), Positives = 112/450 (24%), Gaps = 90/450 (20%)

Query: 2   LIKNCNIVYLDKIEKG------NILIENGKIKAINPKEECD-----------CEVIDGEG 44
           + +   +                 + ++GKI  +    + +                   
Sbjct: 5   IFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSHH 64

Query: 45  LFLSPGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSME 104
            F  PG +D HIH +            + E            F                 
Sbjct: 65  EFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTR----V 120

Query: 105 AIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHED----- 159
                K   T        H +   +             +     +      E+++     
Sbjct: 121 VRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEES 180

Query: 160 --------------------DVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEA 199
                                +V+           EL      + + +    ++   E  
Sbjct: 181 IKETERFVSEMLQKNYSRVKPIVTPGNGVSETLMGELGNIAKTRDLHIQSHISENRDEVE 240

Query: 200 M-EGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAY-PSLRVAYK 257
             + +     + T +++     T++     G    +E        G  IA+ P+  ++  
Sbjct: 241 AVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS 300

Query: 258 QKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIF 317
               + + ++   +      D                      ++  +++  ++ + N  
Sbjct: 301 SGFLNVLEVLKHEVKIGLGTDVAGGYSYSM-----------LDAIRRAVMVSNILLINKV 349

Query: 318 KNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLILFDDN--------------- 362
              +  L EV ++AT  G++   +D + G  + G + D IL +                 
Sbjct: 350 NEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFG 409

Query: 363 ----------------IDIKYVIVNGKLVH 376
                            +I+ V V GK V 
Sbjct: 410 DISEAVIQKFLYLGDDRNIEEVYVGGKQVV 439


>3e74B [x.x.x] ALLANTOINASE
          Length = 420

 Score =  133 bits (334), Expect = 8e-34
 Identities = 46/410 (11%), Positives = 91/410 (22%), Gaps = 43/410 (10%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAG 60
           ++IKN  ++  ++    +I ++ GKI AI    +            +    +D H H + 
Sbjct: 4   LIIKNGTVILENEARVVDIAVKGGKIAAIGQ--DLGDAKEVDASGLVVSPGVDAHTHISH 61

Query: 61  GHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVL 120
                 GT  A                     TV    +    +A     T        L
Sbjct: 62  WEGYETGTRAAAKGGI-----TTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGL 116

Query: 121 GAHLEGPFISTSAIGAQ-NPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKF 179
            ++          +G             + F       E     +          EL + 
Sbjct: 117 VSYNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEE 176

Query: 180 LSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSEITTE 239
              +G V +  +  +              +   +        H                 
Sbjct: 177 AKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEG 236

Query: 240 TISDGIHIAYPSLRV--AYKQKGTDKVLLI-----TDAMMACCMPDGMYSLGGQDVEVKN 292
                    +  +     +++ GT            +      + +G       D     
Sbjct: 237 QDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGWEKLFNGEIDCLVSDHSP-- 294

Query: 293 GAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGY 352
                     A   +    +     +      +        N A    +  K G I  G 
Sbjct: 295 CPPEKAGNIKAWGGIAGLQSCDVFDEAVQKRGSLPFGKLATNAADIFGLQQK-GRIAPGK 353

Query: 353 DADLILFDDN-------------------------IDIKYVIVNGKLVHK 377
           DAD +    N                           I   I+ G +++ 
Sbjct: 354 DADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYD 403


>3e74A [x.x.x] ALLANTOINASE
          Length = 416

 Score =  130 bits (326), Expect = 7e-33
 Identities = 47/409 (11%), Positives = 96/409 (23%), Gaps = 45/409 (11%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAG 60
           ++IKN  ++  ++    +I ++ GKI AI   +  D + +D  GL +SPG          
Sbjct: 4   LIIKNGTVILENEARVVDIAVKGGKIAAIGQ-DLGDAKEVDASGLVVSPGVDAHT----- 57

Query: 61  GHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVL 120
            H   +    A  +     ++                       A  K   +      ++
Sbjct: 58  -HIGYETGTRAAAKGGITTIEPLNQLPATVDRASIELKF---DAAKGKLTIDAAQLGGLV 113

Query: 121 GAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFL 180
             +++                      + F       E     +          EL +  
Sbjct: 114 SYNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEA 173

Query: 181 SEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSE----- 235
             +G V +  +  +              +   +        H                  
Sbjct: 174 KREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQ 233

Query: 236 -ITTETISDGIHIAYPSLRV-AYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNG 293
            IT E+      +            K +  +  + +      + +G       D      
Sbjct: 234 DITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGWEKLFNGEIDCLVSDHSPCPP 293

Query: 294 AARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEGYD 353
                  +  G             +      +        N A    +   KG I  G D
Sbjct: 294 EKAGNIKAWGGIAGLQSCD--VFDEAVQKRGSLPFGKLATNAADIFGLQQ-KGRIAPGKD 350

Query: 354 ADLILFDDN-------------------------IDIKYVIVNGKLVHK 377
           AD +    N                           I   I+ G +++ 
Sbjct: 351 ADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYD 399


>1e9zB [b.92.1 - c.1.9] UREASE BETA SUBUNIT
          Length = 568

 Score =  127 bits (320), Expect = 4e-32
 Identities = 61/413 (14%), Positives = 105/413 (25%), Gaps = 48/413 (11%)

Query: 3   IKNCNIVYLDKIEK----------------GNILIENGKIKAINPKEECDCEVIDGEGLF 46
           I N  IV    I K                GN  +++G    ++       E + GEGL 
Sbjct: 70  ITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGP--ATEALAGEGLI 127

Query: 47  LSPGFIDVHIHGAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAI 106
           ++ G ID HIH              +  +              TT+T    ++   + A 
Sbjct: 128 VTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGT-GPADGTNATTITPGRRNLKWMLRAA 186

Query: 107 HKAKTEG--TDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSI 164
            +           N          I   AIG  + D+   P+  N    V +  D  V+I
Sbjct: 187 EEYSMNLGFLAKGNASNDASLADQIEAGAIGFIHEDWGTTPSAINHALDVADKYDVQVAI 246

Query: 165 TLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHRE 224
                 E         +  G  +   HT+         I         L  +  P     
Sbjct: 247 HTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFT 306

Query: 225 PGVVGA-VFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSL 283
                  +    +              +      Q    +  L      +    D     
Sbjct: 307 VNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSITSSDSQAMG 366

Query: 284 GGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDD 343
              +V            +   +        +    N N+ +   +   T N A    + +
Sbjct: 367 RVGEV------ITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISE 420

Query: 344 KKGLIKEGYDADLILFDDNI--------------------DIKYVIVNGKLVH 376
             G ++ G  ADL+L+                        D    I   + V+
Sbjct: 421 YVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVY 473


>1a5mC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
          Length = 566

 Score =  122 bits (305), Expect = 2e-30
 Identities = 54/412 (13%), Positives = 101/412 (24%), Gaps = 52/412 (12%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEE------------CDCEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI                    EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAINEI-----SKVIVKHGTTSFL-PTTMTVAAEDVCKS 102
            G ID HIH        +     +  +           H TT    P  ++   +     
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSL 186

Query: 103 MEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPT----KENFYKLVGEHE 158
              I           + L   +    I  +                   +     V  H 
Sbjct: 187 PVNIGLLGKGNVSQPDALREQVAAGVIGLAIHEDWGATPAAIDCALTVADEMDIQVALHS 246

Query: 159 DDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMT 218
           D +       +   A       +        GH                S    L   + 
Sbjct: 247 DTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPYTLN 306

Query: 219 PFTHREPGVVGAVFD-SEITTETISDGIHIAY--PSLRVAYKQKGTDKVLLITDAMMACC 275
                   ++       +I  +       I     +        G    L  +D+     
Sbjct: 307 TIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGA-FSLTSSDSQAMGR 365

Query: 276 MPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNG 335
           + + +                          +      +    N N+ +   I   T N 
Sbjct: 366 VGEVILRTWQ---------------VAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINP 410

Query: 336 AKHCKVDDKKGLIKEGYDADLILFDDN-----------IDIKYVIVNGKLVH 376
           A    +  + G I+ G  ADL+++                +  +   G +  
Sbjct: 411 ALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINA 462


>3e74C [x.x.x] ALLANTOINASE
          Length = 415

 Score =  119 bits (297), Expect = 2e-29
 Identities = 46/412 (11%), Positives = 90/412 (21%), Gaps = 52/412 (12%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAG 60
           ++IKN  ++  ++    +I ++ GKI AI    +            +    +D H H   
Sbjct: 4   LIIKNGTVILENEARVVDIAVKGGKIAAIGQ--DLGDAKEVDASGLVVSPGVDAHTHIYE 61

Query: 61  GHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVL 120
                              +              AA+       A               
Sbjct: 62  TGTRAAAKGGITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVS-------- 113

Query: 121 GAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGE-HEDDVVSITLAPEVEGAKELTKF 179
             +          +G     F+       F+K   +  E     +          EL + 
Sbjct: 114 --YNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEE 171

Query: 180 LSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGA------VFD 233
              +G V +  +  +              +   +        H                 
Sbjct: 172 AKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEG 231

Query: 234 SEITTETISDGIH---IAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEV 290
            +IT E+           +  +    K     + L          + +G       D   
Sbjct: 232 QDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGWEK--LFNGEIDCLVSDHSP 289

Query: 291 KNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE 350
                     +  G       +     +      +        N A    +   KG I  
Sbjct: 290 CPPEKAGNIKAWGGIAGLQ--SCDVFDEAVQKRGSLPFGKLATNAADIFGLQQ-KGRIAP 346

Query: 351 GYDADLILFDDN-------------------------IDIKYVIVNGKLVHK 377
           G DAD +    N                           I   I+ G +++ 
Sbjct: 347 GKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYD 398


>3d6nA [x.x.x] DIHYDROOROTASE
          Length = 422

 Score =  118 bits (296), Expect = 2e-29
 Identities = 74/423 (17%), Positives = 137/423 (32%), Gaps = 51/423 (12%)

Query: 1   MLIKNCNIVYLD--KIEKGNILIENGKIKAINPKEE-CDCEVIDGEGLFLSPGFIDVHIH 57
           +++KN  ++        + +IL+ENGKIK I+      + E+ID +GL + PGFID+H+H
Sbjct: 4   LIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVH 63

Query: 58  GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKS-MEAIHKAKTEGTDG 116
                 T     E I   S+  V  G T+ +    T    D        + K+K+ G   
Sbjct: 64  LRDPGQTY---KEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCR 120

Query: 117 ANVLGAHLEG------PFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEV 170
               G   +G          +                 +   +    E          + 
Sbjct: 121 VLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDH 180

Query: 171 EGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVGA 230
               +L   +  +G V ++    +   EA E                    H    +   
Sbjct: 181 CEDDKLAYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVSTKLSLE 240

Query: 231 V------FDSEITTETISDGIHIA---YPSLRVAYKQKGTDKVLLITDAMMACCMPDGMY 281
           +         +IT E   + +        +     +     +      A++       + 
Sbjct: 241 IIEFFKEKGVKITCEVNPNHLLFTEREVLNSGANARVNPPLRKKEDRLALIEGVKRGIID 300

Query: 282 SLGGQDVEVKNGAARLLSGSLAGS--ILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHC 339
                    +     L+  ++ G   + T   +   +++     L ++I+M T N A+  
Sbjct: 301 CFATDHAPHQTFEKELVEFAMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARII 360

Query: 340 KVDDKKGLIKEGYDADLILFDDN-------------------------IDIKYVIVNGKL 374
            VD   G +K G  AD+ +FD N                           + Y I +GK+
Sbjct: 361 GVD--LGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKM 418

Query: 375 VHK 377
           V+K
Sbjct: 419 VYK 421


>2amxB [x.x.x] ADENOSINE DEAMINASE
          Length = 356

 Score = 90.7 bits (223), Expect = 6e-21
 Identities = 31/359 (8%), Positives = 87/359 (24%), Gaps = 31/359 (8%)

Query: 14  IEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYEAIN 73
                  ++   ++ I+       +    E     P  +++H H      + +   +   
Sbjct: 5   RGSEIKFLKKEDVQNIDL--NGMSKKERYEIWRRIPK-VELHCHL-DLTFSAEFFLKWAR 60

Query: 74  EISKVIVKHGTTSFLPTTMTVAAEDVCKSME----AIHKAKTEGTDGANVL--------- 120
           + +                T   + + + +          +                   
Sbjct: 61  KYNLQPNMSDDEILDHYLFTKEGKSLAEFIRKAISVSDLYRDYDFIEDLAKWAVIEKYKE 120

Query: 121 GAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFL 180
           G  L     S + + +     +    K     +    E     I +A      K    F 
Sbjct: 121 GVVLMEFRYSPTFVSSSYGLDVELIHKAFIKGIKNATELLNNKIHVALICISDKHSGDFA 180

Query: 181 SEKGIVVSMGHTKATYEEAMEGIKC--------GCSHATHLFNAMTPFTHREPGVVGAVF 232
            +      +G      E  ++  K         G     H     T            + 
Sbjct: 181 IK-HKHDFVGFDHGGREIDLKDHKDVYHSVRDHGLHLTVHAGEDATLPNLNTLYTAINIL 239

Query: 233 DSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKN 292
           + E         +  +   + +  K+    +V  I++ ++        + +    +    
Sbjct: 240 NVE--RIGHGIRVSESDELIELVKKKDILLEVCPISNLLLNNVKSMDTHPIR--KLYDAG 295

Query: 293 GAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEG 351
               + S      +  ++   + ++ + N+ L E   +      +   V D      + 
Sbjct: 296 VKVSVNSDDPGMFLSNINDNYEKLYIHLNFTL-EEFMIMNNWAFEKSFVSDDVKSELKA 353


>1cr5C [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
          Length = 175

 Score = 83.2 bits (205), Expect = 1e-18
 Identities = 20/156 (12%), Positives = 34/156 (21%), Gaps = 18/156 (11%)

Query: 3   IKNCNIV-YLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGG 61
           + N   V   D      I+I+N  +       +             + GF        G 
Sbjct: 16  LANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPP---------GTIGFNGNQRTWGGW 66

Query: 62  HDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKT----EGTDGA 117
               D       +   +    G  S+L +     +  V    E   +       +     
Sbjct: 67  SLNQDVQ----AKAFDLFKYSGKQSYLGSIDIDISFRVFDQDELAKQFVRCYESQIFSPT 122

Query: 118 NVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKL 153
             L    +G F        Q  D             
Sbjct: 123 QYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATG 158


>1cr5A [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
          Length = 178

 Score = 82.5 bits (203), Expect = 2e-18
 Identities = 20/177 (11%), Positives = 36/177 (20%), Gaps = 21/177 (11%)

Query: 1   MLIKNCNIVYLDKIEKGN-ILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGA 59
             + N   V  +       I+I+N  +                +    + GF        
Sbjct: 14  YALANVAAVSPNDFPNNIYIIIDNLFVFTTRH---------SNDIPPGTIGFNGNQRTWG 64

Query: 60  GGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTD---- 115
           G     D   +A      +    G  S+L +     +       + + K      +    
Sbjct: 65  GWSLNQDVQAKAF----DLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIF 120

Query: 116 -GANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKL--VGEHEDDVVSITLAPE 169
                L    +G F        Q  D                         I     
Sbjct: 121 SPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKG 177


>1cr5B [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
          Length = 176

 Score = 79.4 bits (195), Expect = 2e-17
 Identities = 17/149 (11%), Positives = 37/149 (24%), Gaps = 17/149 (11%)

Query: 1   MLIKNCNIVY-LDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGA 59
             + N   V   D      I+I+N  +       +              PG I  + +  
Sbjct: 17  YALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIP------------PGTIGFNGNQR 64

Query: 60  GGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAE---DVCKSMEAIHKAKTEGTDG 116
                     +   +   +    G  S+L +     +        + + +   +++    
Sbjct: 65  TWGGWSLNQ-DVQAKAFDLFKYSGKQSYLGSIDIDISFRADQDELAKQFVRCYESQIFSP 123

Query: 117 ANVLGAHLEGPFISTSAIGAQNPDFLIPP 145
              L    +G F        Q  D     
Sbjct: 124 TQYLIMEFQGHFFDLKIRNVQAIDLGDIE 152


>3c86A [x.x.x] PHOSPHOTRIESTERASE
          Length = 327

 Score = 69.6 bits (168), Expect = 1e-14
 Identities = 37/323 (11%), Positives = 71/323 (21%), Gaps = 28/323 (8%)

Query: 38  EVIDGEGLFLSPGFIDVHIH-----------GAGGHDTMDGTYEAINEISKVIVKHGTTS 86
             + G       GF   H H                 +     E      +     G  +
Sbjct: 5   NTVRGPIPVSEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRHARAAGVQT 64

Query: 87  FLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPT 146
            +  +      DV    E    A           G   + P         +   F +   
Sbjct: 65  IVDVSTFDIGRDVRLLAEVSRAA---DVHIVAATGLWFDPPLSMRMRSVEELTQFFLRE- 120

Query: 147 KENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLS---EKGIVVSMGHTKATYE------ 197
            ++  +  G     +V+ T          L          G+ V+   + +  +      
Sbjct: 121 IQHGIEDTGIRAGIIVATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAA 180

Query: 198 -EAMEGIKCGCSHATHLFNAMTPFTHREPGVVG--AVFDSEITTETISDGIHIAYPSLRV 254
               EG+        H  +             G     D    +    +G   A      
Sbjct: 181 IFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGLEGNASALALFGT 240

Query: 255 AYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVK 314
              Q     +  + D      +      L G    V N     +       +  + + V 
Sbjct: 241 RSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDV-MDRINPDGMAFVPLRVI 299

Query: 315 NIFKNTNYPLNEVIKMATYNGAK 337
              +    P   +  +   N A+
Sbjct: 300 PFLREKGVPPETLAGVTVANPAR 322


>2d2gA [x.x.x] PHOSPHOTRIESTERASE
          Length = 329

 Score = 69.0 bits (166), Expect = 2e-14
 Identities = 34/335 (10%), Positives = 66/335 (19%), Gaps = 51/335 (15%)

Query: 38  EVIDGEGLFLSPGFIDVHIHGAGG-----------HDTMDGTYEAINEISKVIVKHGTTS 86
             + G       GF   H H  G              +     E      +     G  +
Sbjct: 6   NTVRGPIPVSEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRHARAAGVQT 65

Query: 87  FLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPT 146
            +  +      DV    E    A           G   + P         +   F +   
Sbjct: 66  IVDVSTFDIGRDVRLLAEVSRAA---DVHIVAATGLWFDPPLSMRMRSVEELTQFFLREI 122

Query: 147 KENFYKLVGEHEDDVVSITLAPEVEGAKELTKF--LSEKGIVVSMGHTKATYEEAMEGIK 204
           +              V+ T          L      S    V    HT A+  +  +   
Sbjct: 123 QHGIEDTGIRAGIIKVATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAA 182

Query: 205 C--------GCSHATHLFNAMTPFTHREPGVVGA-VFDSEITTETISDGIHIAY------ 249
                          H  +             G  V    +    I    + +       
Sbjct: 183 IFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGLEGNASALALFGT 242

Query: 250 -------PSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSL 302
                    ++    +   D++L+  D +                               
Sbjct: 243 RSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDVMDR-------------IN 289

Query: 303 AGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAK 337
              +  + + V    +    P   +  +   N A+
Sbjct: 290 PDGMAFVPLRVIPFLREKGVPPETLAGVTVANPAR 324


>1a4mA [c.1.9] ADENOSINE DEAMINASE
          Length = 349

 Score = 66.1 bits (159), Expect = 2e-13
 Identities = 51/366 (13%), Positives = 93/366 (25%), Gaps = 37/366 (10%)

Query: 2   LIKNCNIVYLD-----KIEKGNILIENGKIKAINPKEEC--DCEVIDGEGLFLSPGFIDV 54
              N   V L       I+   IL    K     P +       +I  +     PGF+  
Sbjct: 2   PAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLAK 61

Query: 55  HIH-GAGGHDTMDGTYEAINEISKVIVKHGTTSFL--PTTMTVAAEDVCKSMEAIHKAKT 111
             +         +       E  ++  K G        +   +A   V        +   
Sbjct: 62  FDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGDV 121

Query: 112 EGTDGANVLGAHLEGP---FISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAP 168
              D  +++   L+     F                 + E        ++  VV++ LA 
Sbjct: 122 TPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLA- 180

Query: 169 EVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVV 228
                            +          E     +K G     H     +P   RE    
Sbjct: 181 -------------GDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPEVVRE---- 223

Query: 229 GAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDV 288
            AV   +                     K+    +V   +  +     P   +++     
Sbjct: 224 -AVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAV--VRF 280

Query: 289 EVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKV--DDKKG 346
           +       L +        TLD   +   K+  +   E  K    N AK   +  ++KK 
Sbjct: 281 KNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTE-EEFKRLNINAAKSSFLPEEEKKE 339

Query: 347 LIKEGY 352
           L++  Y
Sbjct: 340 LLERLY 345


>3e3hA [x.x.x] PARATHION HYDROLASE
          Length = 335

 Score = 65.6 bits (158), Expect = 2e-13
 Identities = 31/338 (9%), Positives = 71/338 (21%), Gaps = 44/338 (13%)

Query: 38  EVIDGEGLFLSPGFIDVHIHGAGGHDTMD-------GTYEAINEISKVIVKHGTTSFLPT 90
             + G       GF   H H  G             G+ +A+ E +   ++    + + T
Sbjct: 9   NTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRRARAAGVRT 68

Query: 91  -TMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFL------- 142
                  +           ++          G   + P         +   F        
Sbjct: 69  IVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREIQYG 128

Query: 143 IPPTKENFYKLVGEHEDD--VVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAM 200
           I  T      +V           + L      +      ++           +       
Sbjct: 129 IEDTGIRAGIIVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFES 188

Query: 201 EGIKCGCSHATHLFNAMTPFTHREPGVVGAVFDSE-ITTETISDGIHIAY---------- 249
           EG+        H  +             G +   + I    I    + +           
Sbjct: 189 EGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDRIPFSAIGLEDNASASALLGIRSWQ 248

Query: 250 ---PSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSI 306
                ++    Q    ++L+  D +                V                 +
Sbjct: 249 TRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDG-------------M 295

Query: 307 LTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDK 344
             + + V    +    P   +  +   N A+      +
Sbjct: 296 AFIPLRVIPFLREKGVPQETLAGITVTNPARFLSPTLR 333


>1a5lC [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
          Length = 536

 Score = 63.8 bits (154), Expect = 8e-13
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 12/84 (14%)

Query: 1   MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEE------------CDCEVIDGEGLFLS 48
           +++ N  IV    I K +I +++G+I AI                    EVI  EG  ++
Sbjct: 67  LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVT 126

Query: 49  PGFIDVHIHGAGGHDTMDGTYEAI 72
            G ID HIH        +     +
Sbjct: 127 AGGIDTHIHWICPQQAEEALVSGV 150


>2a3lA [x.x.x] AMP DEAMINASE
          Length = 616

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 10/194 (5%), Positives = 35/194 (18%), Gaps = 29/194 (14%)

Query: 204 KCGCSHATHLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDK 263
               +   H   A          +          +      +  +     + Y  +    
Sbjct: 428 MTTITLRPHSGEAGDIDHLAATFLTCH-------SIAHGINLRKSPVLQYLYYLAQIGLA 480

Query: 264 VLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYP 323
           +  +++  +        + +      +    +      +  +   L              
Sbjct: 481 MSPLSNNSLFLDYHRNPFPVFFLRG-LNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLS 539

Query: 324 LNEVIKMATYNGAKHCKVDDKKGLIKEGYDADLILFDDN--------------------I 363
               +     N                G D      D N                     
Sbjct: 540 AC-DLCEIARNSVYQSGFSHALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKE 598

Query: 364 DIKYVIVNGKLVHK 377
           +++ V +   ++  
Sbjct: 599 EMQQVYLGKAVISD 612


>2amxA [x.x.x] ADENOSINE DEAMINASE
          Length = 364

 Score = 60.6 bits (145), Expect = 7e-12
 Identities = 32/358 (8%), Positives = 83/358 (23%), Gaps = 28/358 (7%)

Query: 19  ILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYEAINEISKV 78
             I+  K + +   +       +   ++     +++H H             A  + +  
Sbjct: 7   SEIKFLKKEDVQNIDLNGMSKKERYEIWRRIPKVELHCHLDLTFSAEFFLKWA-RKYNLQ 65

Query: 79  IVKHGTTSFLPTTMTV-------------AAEDVCKSMEAIHKAKTEGTDGANVLGAHLE 125
                         T              +  D+ +  + I              G  L 
Sbjct: 66  PNMSDDEILDHYLFTKEGKSLAEFIRKAISVSDLYRDYDFIEDLAKWAVIEKYKEGVVLM 125

Query: 126 GPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTK------- 178
               S + + +     +    K     +    E     I +A                  
Sbjct: 126 EFRYSPTFVSSSYGLDVELIHKAFIKGIKNATELLNNKIHVALICISDTGHAAASIKHSG 185

Query: 179 FLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHREPGVVG----AVFDS 234
             + K     +G      E  ++  K            +T     +  +          +
Sbjct: 186 DFAIKHKHDFVGFDHGGREIDLKDHKDVYHSVRDHGLHLTVHAGEDATLPNLNTLYTAIN 245

Query: 235 EITTETISDG-IHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNG 293
            +  E I  G        L    K+K     +     ++   +         +  +    
Sbjct: 246 ILNVERIGHGIRVSESDELIELVKKKDILLEVCPISNLLLNNVKSMDTHPIRKLYDAGVK 305

Query: 294 AARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKEG 351
            + + S      +  ++   + ++ + N+ L E   +      +   V D      + 
Sbjct: 306 VS-VNSDDPGMFLSNINDNYEKLYIHLNFTLEEF-MIMNNWAFEKSFVSDDVKSELKA 361


>3e2vB [x.x.x] 3'-5'-EXONUCLEASE
          Length = 362

 Score = 59.0 bits (141), Expect = 2e-11
 Identities = 26/337 (7%), Positives = 80/337 (23%), Gaps = 13/337 (3%)

Query: 51  FIDVHIH-----GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEA 105
           + D+ ++       G ++          ++ +   +    + L      +  +   ++E 
Sbjct: 4   YYDIGLNLTDPMFHGIYNGKQYHPADYVKLLERAAQRHVKNAL--VTGSSIAESQSAIEL 61

Query: 106 IHKAKTEGTDGANV-LGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSI 164
           +   K          +G H         A        +I        KL   ++      
Sbjct: 62  VSSVKDLSPLKLYHTIGVHPCCVNEFAEAYNESLYAKVISNPSFAQGKLKELYDLMNQQA 121

Query: 165 TLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHRE 224
                   +        ++    S    K  +EE ++        +++           +
Sbjct: 122 KPHDTSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKISCLNDKLSSYPLFLHMRSACDD 181

Query: 225 PGVVGA--VFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGMYS 282
              +    V       +T       +       +  +          A+    + +   +
Sbjct: 182 FVQILERFVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNLSPN 241

Query: 283 LGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTN-YPLNEVIKMATYNGAKHCKV 341
           +              L+  +   I T  + ++           +   +            
Sbjct: 242 IFIGVNGCSLRTEENLA--VVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVRDFE 299

Query: 342 DDKKGLIKEGYDADLILFDDNIDIKYVIVNGKLVHKA 378
                 +K+   AD +  ++   +K       +   A
Sbjct: 300 YPAFKSVKKNKLADKLNAEELYMVKGRNEPCNMEQVA 336


>2eg6B [x.x.x] DIHYDROOROTASE
          Length = 336

 Score = 55.1 bits (131), Expect = 3e-10
 Identities = 34/327 (10%), Positives = 71/327 (21%), Gaps = 22/327 (6%)

Query: 44  GLFLSPGFIDVHIHGAGGHDTMDGTYEAINE-ISKVIVKHGTTSFLPTTMTVAAEDVCKS 102
            +       D H+H     D +       +E   + IV        P T   AA    + 
Sbjct: 2   QVLKIRRPDDWHLH-LRDGDMLKTVVPYTSEIYGRAIVMPNLAP--PVTTVEAAVAYRQR 58

Query: 103 MEAIHKAKTE------GTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKL--V 154
           +     A  +           ++    LE  F       A  P      + +    +   
Sbjct: 59  ILDAVPAGHDFTPLMTCYLTDSLDPNELERGFNEGVFTAALYPANHGVTSVDAIMPVLER 118

Query: 155 GEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLF 214
            E     + +             +       V+     + T    +         A    
Sbjct: 119 MEKIGMPLLVHGEVTHADIDIFDREARFIESVMEPLRQRLT-ALKVVFEHITTKDAADYV 177

Query: 215 NAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMAC 274
                           +F+                P L+    Q+   +++      +  
Sbjct: 178 RDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALRELVASGFNRVFL 237

Query: 275 CMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYN 334
                 ++      E   G A   +   A       V  +         L       + N
Sbjct: 238 GTDSAPHARH--RKESSCGCAGCFNAPTALGSY-ATVFEEMN------ALQHFEAFCSVN 288

Query: 335 GAKHCKVDDKKGLIKEGYDADLILFDD 361
           G +   +      I+   +   +    
Sbjct: 289 GPQFYGLPVNDTFIELVREEQQVAESI 315


>3e2vA [x.x.x] 3'-5'-EXONUCLEASE
          Length = 363

 Score = 52.5 bits (124), Expect = 2e-09
 Identities = 23/340 (6%), Positives = 74/340 (21%), Gaps = 19/340 (5%)

Query: 51  FIDVHIH-----GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEA 105
           + D+ ++       G ++          ++ +   +    + L      +  +   ++E 
Sbjct: 4   YYDIGLNLTDPMFHGIYNGKQYHPADYVKLLERAAQRHVKNAL--VTGSSIAESQSAIEL 61

Query: 106 IHK-AKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDVVSI 164
           +            + +G H         A        +I        KL   ++      
Sbjct: 62  VSSVKDLSPLKLYHTIGVHPCCVNEFAEAYNESLYAKVISNPSFAQGKLKELYDLMNQQA 121

Query: 165 TLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHATHLFNAMTPFTHRE 224
                   +        ++    S    K  +EE ++     C +       +       
Sbjct: 122 KPHDTSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKIS---CLNDKLSSYPLFLHMRSA 178

Query: 225 PGVVGAVFDSE-----ITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPD- 278
                 + +          +T       +       +  +          A+    + + 
Sbjct: 179 CDDFVQILERFVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNL 238

Query: 279 GMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKH 338
                 G +              +        +   +         +   +         
Sbjct: 239 SPNIFIGVNGCSLR--TEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVR 296

Query: 339 CKVDDKKGLIKEGYDADLILFDDNIDIKYVIVNGKLVHKA 378
                    +K+   AD +  ++   +K       +   A
Sbjct: 297 DFEYPAFKSVKKNKLADKLNAEELYMVKGRNEPCNMEQVA 336


>1bf6A [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
          Length = 291

 Score = 47.1 bits (110), Expect = 8e-08
 Identities = 28/311 (9%), Positives = 67/311 (21%), Gaps = 41/311 (13%)

Query: 47  LSPGFIDVHIH-----GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPTTMTVAAEDVCK 101
                   H+H          D     Y  I +    ++  G  + +  T      +   
Sbjct: 5   TGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQF 64

Query: 102 SMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENFYKLVGEHEDDV 161
            ++ + +                       +    Q     +    E            +
Sbjct: 65  MLDVMRETGINVVACTGYYQDA--FFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGII 122

Query: 162 VSITLAP------EVEGAKELTKFLSEKGIVVSMGHTKATYEEAM------EGIKCGCSH 209
             I  +       E +         ++ G  +S   + +T            G+      
Sbjct: 123 AEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVT 182

Query: 210 ATHLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITD 269
             H           +   +GA    +   +            L     +   ++V+L  D
Sbjct: 183 VGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMD 242

Query: 270 AMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIK 329
                 +       GG   +                   L        + + +   +V  
Sbjct: 243 ITRRSHLKAN----GGYGYD------------------YLLTTFIPQLRQSGFSQADVDV 280

Query: 330 MATYNGAKHCK 340
           M   N ++  +
Sbjct: 281 MLRENPSQFFQ 291


>1dpmA [c.1.9] PHOSPHOTRIESTERASE
          Length = 329

 Score = 39.0 bits (89), Expect = 2e-05
 Identities = 28/332 (8%), Positives = 72/332 (21%), Gaps = 45/332 (13%)

Query: 38  EVIDGEGLFLSPGFIDVHIH-------GAGGHDTMDGTYEAINEISKVIVKHGTTSFLPT 90
             + G       GF   H H                G+ +A+ E +   ++    + + T
Sbjct: 4   NTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRRARAAGVRT 63

Query: 91  TMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPDFLIPPTKENF 150
            + V+  D+ + +  + +                  P +S      +          +  
Sbjct: 64  IVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREIQYG 123

Query: 151 YKLVG-----------EHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEA 199
            +  G                   + L      +      ++           +      
Sbjct: 124 IEDTGIRAGIIKVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFE 183

Query: 200 MEGIKCGCSHATHLFNAMTPFTHREPGVVGAV--FDSEITTETISDGIHIAYPS------ 251
            EG+        H  +             G +   D    +    +    A         
Sbjct: 184 SEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPHSAIGLEDNASASALLGIRSW 243

Query: 252 ------LRVAYKQKGTDKVLLITDAMMACCMPDGMYSLGGQDVEVKNGAARLLSGSLAGS 305
                 ++    Q    ++L+  D +                   +              
Sbjct: 244 QTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMD----RVNPD---------G 290

Query: 306 ILTLDVAVKNIFKNTNYPLNEVIKMATYNGAK 337
           +  + + V    +    P   +  +   N A+
Sbjct: 291 MAFIPLRVIPFLREKGVPQETLAGITVTNPAR 322


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0562    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 20,445,607
Number of extensions: 1243472
Number of successful extensions: 15413
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6956
Number of HSP's successfully gapped: 481
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)