RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAB82028.1 cper0 thrS GIB00075CH01 "threonine-tRNA ligase"
         (643 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2cimB [x.x.x] SERYL-TRNA SYNTHETASE                                   214   5e-58
2cjaB [x.x.x] SERYL-TRNA SYNTHETASE                                   213   1e-57
1b76A [d.104.1 - c.51.1] PROTEIN (GLYCYL-TRNA SYNTHETASE)             213   1e-57
1atiB [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE                       210   7e-57
2cjaA [x.x.x] SERYL-TRNA SYNTHETASE                                   202   3e-54
2cimA [x.x.x] SERYL-TRNA SYNTHETASE                                   200   1e-53
1atiA [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE                       194   7e-52
2dq0A [x.x.x] SERYL-TRNA SYNTHETASE                                   192   2e-51
2cjbA [x.x.x] SERYL-TRNA SYNTHETASE                                   185   3e-49
2cj9A [x.x.x] SERYL-TRNA SYNTHETASE                                   174   7e-46
2du3A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                          173   1e-45
2du5A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                          172   3e-45
1adjA [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE                     167   6e-44
3bjuD [x.x.x] LYSYL-TRNA SYNTHETASE                                   164   5e-43
1asyA [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE                     163   1e-42
2dq2A [x.x.x] SERYL-TRNA SYNTHETASE                                   157   7e-41
2cjbB [x.x.x] SERYL-TRNA SYNTHETASE                                   155   3e-40
2d32C [x.x.x] GLUTAMATE--CYSTEINE LIGASE                              153   1e-39
1e1tA [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE                        152   2e-39
2cj9B [x.x.x] SERYL-TRNA SYNTHETASE                                   152   4e-39
3bjuC [x.x.x] LYSYL-TRNA SYNTHETASE                                   148   5e-38
2dq3A [x.x.x] SERYL-TRNA SYNTHETASE                                   146   1e-37
3e9hA [x.x.x] LYSYL-TRNA SYNTHETASE                                   133   1e-33
1eiyA [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE                  131   8e-33
3cmqA [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL             127   7e-32
1c0aA [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE            127   7e-32
1bbuA [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)              123   1e-30
1bbwA [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)              116   2e-28
2du3B [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                          110   1e-26
3cw4A [x.x.x] POLYMERASE BASIC PROTEIN 2                              110   1e-26
2du5B [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                          109   2e-26
2bamB [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)                           106   2e-25
2eiuC [x.x.x] HYPOTHETICAL PROTEIN AQ_1627                            104   8e-25
1bhmB [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))                         104   1e-24
3dsqA [x.x.x] PYRROLYSYL-TRNA SYNTHETASE                              103   2e-24
3bamA [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)               101   6e-24
1e1oA [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE                        101   7e-24
1b70A [d.104.1] PHENYLALANYL-TRNA SYNTHETASE                          100   1e-23
2du4A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                           97   1e-22
2eiuD [x.x.x] HYPOTHETICAL PROTEIN AQ_1627                             97   2e-22
2bamA [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)                            96   3e-22
3dsqB [x.x.x] PYRROLYSYL-TRNA SYNTHETASE                               96   3e-22
2du7A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE                           95   6e-22
2eiuE [x.x.x] HYPOTHETICAL PROTEIN AQ_1627                             91   8e-21
2e3cA [x.x.x] PYRROLYSYL-TRNA SYNTHETASE                               91   1e-20
11asA [d.104.1] ASPARAGINE SYNTHETASE                                  90   2e-20
2d6fD [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E            88   9e-20
1bhmA [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))                          82   4e-18
3d1tB [x.x.x] UPF0343 PROTEIN NGO0387                                  76   2e-16
1b8aA [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)            74   1e-15
2e1bA [x.x.x] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE           71   1e-14
3bjuB [x.x.x] LYSYL-TRNA SYNTHETASE                                    66   3e-13
2e7gA [x.x.x] PUTATIVE RIBOSOME-BINDING FACTOR A                       63   2e-12
3c2wC [x.x.x] BACTERIOPHYTOCHROME                                      49   4e-08
2c7fB [x.x.x] ALPHA-L-ARABINOFURANOSIDASE                              36   3e-04
2ddzE [x.x.x] 190AA LONG HYPOTHETICAL PROTEIN                          35   8e-04

>2cimB [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 477

 Score =  214 bits (546), Expect = 5e-58
 Identities = 53/523 (10%), Positives = 129/523 (24%), Gaps = 84/523 (16%)

Query: 74  TASHVLA-AAVKRLFPQDKLAIGPSIDNGFYY-DFDTEKPFSADQLNXXXXXXXXXXXXX 131
           +   +            D      +I   F   +       + +                
Sbjct: 2   SHMKLQFNLKAYFKTSADPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKDRIELT 61

Query: 132 XXXXRFELPRNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIK 191
               R+    +    L K     +           I        + +   P++ +++ I+
Sbjct: 62  LQSGRYVRVHDAIFRLRKQLAEALGKKYI-EVESFIIKVPADHELRMLKVPYIKSMENIE 120

Query: 192 AVKLLRSTGAYWKGDEKNKMLSRVYGTAFP-KKSXXXXXXXXXXXXKKRDHNKLGRELGI 250
               L       +    N++  R+        ++            +  +H         
Sbjct: 121 GGIQLELEVGEAEMK--NRVPDRILTLLEEKIEAAQYEHWNLLWQREPMEHPFKEDPTQA 178

Query: 251 FTTDEN----VGQGLPLLMPKGARIIQTLQRWIEDEEQRR-GYVLTKTPLMAKSDLYKIS 305
              +        +G  +  P+ ARI +T ++ + +E     GY     P +   +++  S
Sbjct: 179 MMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEVWMKS 238

Query: 306 GHWDHYKDGMF----------------------------VLGDEEKDSEVFALRPMTCPF 337
           GH       ++                             L  E+    +  +    CP 
Sbjct: 239 GHAKGVYPEIYYVCPPQTRDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPP 298

Query: 338 QYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDE 397
            +           ++PV+  + S       SG +HG+ RV +F   +   + T E++   
Sbjct: 299 FWMYVAGETLPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKC 358

Query: 398 FKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNID 457
            +   D   ++   +    +            T+     P              +   ++
Sbjct: 359 AEELHDRYMHIFNDILD-IEWRKARVTNTVGTTDYEACLPYRGP----------DGEWLE 407

Query: 458 FTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIH 517
           F         Y    +++                                  +    +  
Sbjct: 408 FQNVSINGDKYPKGFNVKL---------------------------------QSGDELWS 434

Query: 518 RSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY 560
             S    ER  A+ + +       W    + +V  +      +
Sbjct: 435 GCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-GIRF 476


>2cjaB [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 476

 Score =  213 bits (543), Expect = 1e-57
 Identities = 60/509 (11%), Positives = 133/509 (26%), Gaps = 76/509 (14%)

Query: 52  NEDSSLEICTFDSKEGQHAFNHTASHVLAAAVKRLFPQDKLAI----GPSIDNGFYYDFD 107
             +      T                    A+  LF +    +     P        ++ 
Sbjct: 6   QFNLKAYFKTSADP-----------TPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWK 54

Query: 108 TEKPFSADQLNXXXXXXXXXXXXXXXXXRFELPRNEALELMKDEPYKVELINDLPEGEVI 167
             +      L                    E            + YK+ +     E  +I
Sbjct: 55  LGEDRIELTLQSGRYVRVHDAIFRLRKQLAEA---------LGKKYKIGIRGIEVESFII 105

Query: 168 SFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXX 227
                 +       P++ +      ++L    G   K    +++L+ +       +    
Sbjct: 106 KVPADHELRLK--VPYIKSENIEGGIQLELEVGEAEKNRVPDRILTLLEEKIEAAQYGAK 163

Query: 228 XXXXXXXXXKKRDHNKLGRELGIFTTDEN--VGQGLPLLMPKGARIIQTLQRWIEDEEQR 285
                    ++ +H                   +G  +  P+ ARI +T ++ + +E   
Sbjct: 164 AEHWNLLWQREPEHPFKEDPTQAKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLE 223

Query: 286 RGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVL--------------------------- 318
                   P +   +++K SGH       ++ +                           
Sbjct: 224 PLGYREIFPKLVTWEVWK-SGHAKGVYPEIYYVCPPQTRDPDYWEEVADYYKVTHEVPTK 282

Query: 319 GDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAE-TSTLFRNESSGEMHGLIRV 377
             +EK +E        CP  +           ++PV+  + + T  R E SG +HG+ RV
Sbjct: 283 LIKEKIAEPIGGCYAQCPP-FWYVAGETLPNEEIPVKVFDRSGTSHRYE-SGGIHGIERV 340

Query: 378 RQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDP 437
            +F   +   + T E++    +   D      + L I                     D 
Sbjct: 341 DEFHRIEIVWIGTKEEVLKCAEELHDRYHIFNDILDIEWRKARV--------NTVGTTDY 392

Query: 438 EAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAE 497
           EA    +    E      ++F         Y    +++ ++          + ++   A 
Sbjct: 393 EACLPYRGPDGE-----WLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVGLERWAAV 447

Query: 498 RFGMYYIDKDGEKKRPYIIHRSSIGCYER 526
                      +        R+ +G  + 
Sbjct: 448 FLAQKG----LDPANWPEEFRNRVGEPKG 472


>1b76A [d.104.1 - c.51.1] PROTEIN (GLYCYL-TRNA SYNTHETASE)
          Length = 442

 Score =  213 bits (542), Expect = 1e-57
 Identities = 65/452 (14%), Positives = 120/452 (26%), Gaps = 65/452 (14%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQ---GLPLLMPKGARIIQTLQRWIEDEE--QRRGYVLT 291
              +   L +  G       +     G+    P G  +   L++        +R      
Sbjct: 4   SLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGL 63

Query: 292 KTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSE--------------------VFALR 331
              ++    +   SGH   + D M         +                     +  LR
Sbjct: 64  DASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLR 123

Query: 332 PMTCPFQ-YAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCT 390
           P T         N    + R L    A+    FRNE +   + + RVR+F   +      
Sbjct: 124 PETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVR 182

Query: 391 PEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREI 450
           P + E   +  V+      + +G+         +  P ++  Y                 
Sbjct: 183 PGEDEYWHRYWVEERLKWWQEMGL-SRENLVPYQQPPESSAHYAKATVDILY-------- 233

Query: 451 LNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEK 510
                      + E        D+       +    IT ++         + Y D +  K
Sbjct: 234 ----RFPHGSLELEGIAQRTDFDLGSHTKDQEAL-GITARVLRNEHSTQRLAYRDPETGK 288

Query: 511 KRPYIIHRSSIGCYERTLAMLIEKYAGALPT------------WIAPVQAKVLPLSDK-- 556
                +   S G     LA+L E +                   +AP++  V+PL     
Sbjct: 289 WFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRP 348

Query: 557 -YADYANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKE---- 611
              +YA                      IG   R      TP+ + V        +    
Sbjct: 349 EITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTT 408

Query: 612 -----VSVRSRKNGEEGAMPLADFVNRIVLEI 638
                V+VR R   E+  + + +    +   +
Sbjct: 409 RLKDTVTVRDRDTMEQIRLHVDELEGFLRERL 440


>1atiB [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
          Length = 436

 Score =  210 bits (536), Expect = 7e-57
 Identities = 66/446 (14%), Positives = 124/446 (27%), Gaps = 59/446 (13%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQ---GLPLLMPKGARIIQTLQRWIEDEE--QRRGYVLT 291
              +   L +  G       +     G+    P G  +   L++        +R      
Sbjct: 4   SLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGL 63

Query: 292 KTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFA--------------LRPMTCPF 337
              ++    +   SGH   + D M         + +F               LRP T   
Sbjct: 64  DASVLTHRLVLHYSGHEATFADPMVDWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQG 123

Query: 338 QYAIYNSTQ-HSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLED 396
            +  + +    + R L    A+    FRNE +   + + RVR+F   +      P + E 
Sbjct: 124 IFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEY 182

Query: 397 EFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNI 456
             +  V+      + +G+         +  P ++  Y                       
Sbjct: 183 WHRYWVEERLKWWQEMGL-SRENLVPYQQPPESSAHYAKATVDIL------------YRF 229

Query: 457 DFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYII 516
                + E        D+       +E   IT ++         + Y D +  K     +
Sbjct: 230 PHGSLELEGIAQRTDFDLGSHT-KDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYV 288

Query: 517 HRSSIGCYERTLAMLIEKYAGALP------------TWIAPVQAKVLPLSDK---YADYA 561
              S G     LA+L E +                   +AP++  V+PL        +YA
Sbjct: 289 IEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYA 348

Query: 562 NXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKE---------V 612
                                 IG   R      TP+ + V        +         V
Sbjct: 349 KRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTV 408

Query: 613 SVRSRKNGEEGAMPLADFVNRIVLEI 638
           +VR R   E+  + + +    +   +
Sbjct: 409 TVRDRDTMEQIRLHVDELEGFLRERL 434


>2cjaA [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 464

 Score =  202 bits (514), Expect = 3e-54
 Identities = 56/480 (11%), Positives = 132/480 (27%), Gaps = 70/480 (14%)

Query: 95  GPSID-NGFYYDFDTEKPFS-----------ADQLNXXXXXXXXXXXXXXXXXRFELPRN 142
               +   ++        F             +                    R+    +
Sbjct: 3   KLQFNLKAYFKKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLRIELTLQSGRYVRVHD 62

Query: 143 EALELMKD------EPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLL 196
               L K       + YK+ +     E  +I      +       P++ +      ++L 
Sbjct: 63  AIFRLRKQLAEALGKKYKIGIRGIEVESFIIKVPADHELRL--KVPYIKSENIEGGIQLE 120

Query: 197 RSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDEN 256
              G   K    +++L+ +       +             ++ +H               
Sbjct: 121 LEVGEAEKNRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPEHPFKEDPTQAKEGWLK 180

Query: 257 --VGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDG 314
               +G  +  P+ ARI +T ++ + +E           P +   +++K SGH       
Sbjct: 181 RGSSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREIFPKLVTWEVWK-SGHAKGVYPE 239

Query: 315 MFVL---------------------------GDEEKDSEVFALRPMTCPFQYAIYNSTQH 347
           ++ +                             +EK +E        CP  + +   T  
Sbjct: 240 IYYVCPPQTRDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGCYAQCPPFWYVAGET-L 298

Query: 348 SYRDLPVRFAE-TSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVK 406
              ++PV+  + + T  R E SG +HG+ RV +F   +   + T E++    +   D   
Sbjct: 299 PNEEIPVKVFDRSGTSHRYE-SGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYH 357

Query: 407 YVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAA 466
              + L I +    R +     + E  +                     ++F        
Sbjct: 358 IFNDILDI-EWRKARVNTVGTTDYEACLPYRGPDGE------------WLEFQNVSINGD 404

Query: 467 FYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYER 526
            Y    +++ ++          + ++   A            +        R+ +G  + 
Sbjct: 405 KYPKGFNVKLQSGDELWSGCSGVGLERWAAVFLAQKG----LDPANWPEEFRNRVGEPKG 460


>2cimA [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 487

 Score =  200 bits (509), Expect = 1e-53
 Identities = 57/545 (10%), Positives = 135/545 (24%), Gaps = 102/545 (18%)

Query: 54  DSSLEICTFDSKEGQHAFNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFS 113
           +      T                 +AA  +           P        ++   +   
Sbjct: 6   NLKAYFKTSADPTPA-------KDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLGEDRI 58

Query: 114 ADQLNXXXXXXXXXXXXXXXXXRFELPRNEALELMKDEPYKVELINDLPEGEVISFYQIG 173
              L                    E            + YK+ +     E   I      
Sbjct: 59  ELTLQSGRYVRVHDAIFRLRKQLAEAL---------GKKYKIGIRGIEVESF-IIKVPAD 108

Query: 174 DFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKK-----SXXXX 228
             + +   P++ +++ I+    L       + + KN++  R+      K           
Sbjct: 109 HELRMLKVPYIKSMENIEGGIQL--ELEVGEAEMKNRVPDRILTLLEEKIEAAQYGAKAE 166

Query: 229 XXXXXXXXKKRDHNKLGRELGIFTTDENV----GQGLPLLMPKGARIIQTLQRWIEDEE- 283
                   +  +H            +  +     +G  +  P+ ARI +T ++ + +E  
Sbjct: 167 HWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELL 226

Query: 284 QRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMF--------------------------- 316
           +  GY     P +   +++  SGH       ++                           
Sbjct: 227 EPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDPDYWEEVADYYKVTHEVP 286

Query: 317 -VLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLI 375
             L  E+    +  +    CP  +           ++PV+  + S       SG +HG+ 
Sbjct: 287 TKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRSGTSHRYESGGIHGIE 346

Query: 376 RVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYIN 435
           RV +F   +   + T E++    +   D   ++   +                   +  N
Sbjct: 347 RVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILD-----------IEWRKARVTN 395

Query: 436 DPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFAL 495
                +    +     +   ++F         Y    +++ +                  
Sbjct: 396 TVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQ------------------ 437

Query: 496 AERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSD 555
                              +    S    ER  A+ + +       W    + +V  +  
Sbjct: 438 ---------------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK 482

Query: 556 KYADY 560
               +
Sbjct: 483 -GIRF 486


>1atiA [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
          Length = 437

 Score =  194 bits (493), Expect = 7e-52
 Identities = 67/444 (15%), Positives = 120/444 (27%), Gaps = 63/444 (14%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEE--QRRGYVLTKTP 294
           K+R       E+          QG+    P G  +   L++        +R         
Sbjct: 13  KRRGFIFQSSEIY------GGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDAS 66

Query: 295 LMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFA---------------LRPMTCPFQ- 338
           ++    +   SGH   + D M       +   +                 LRP T     
Sbjct: 67  VLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIF 126

Query: 339 YAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEF 398
               N    + R L    A+    FRNE +   + + RVR+F   +      P + E   
Sbjct: 127 VNFKNVLDATSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWH 185

Query: 399 KNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDF 458
           +  V+      + +G+         +  P ++  Y                         
Sbjct: 186 RYWVEERLKWWQEMGL-SRENLVPYQQPPESSAHYAKATVDIL------------YRFPH 232

Query: 459 TEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHR 518
              + E        D+       +   I T ++         + Y D +  K     +  
Sbjct: 233 GSLELEGIAQRTDFDLGSHTKDQEALGI-TARVLRNEHSTQRLAYRDPETGKWFVPYVIE 291

Query: 519 SSIGCYERTLAMLIEKYAGALPTWI------------APVQAKVLPLSDK---YADYANX 563
            S G     LA+L E +                    AP++  V+PL        +YA  
Sbjct: 292 PSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKR 351

Query: 564 XXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKE---------VSV 614
                               IG   R      TP+ + V        +         V+V
Sbjct: 352 LKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTV 411

Query: 615 RSRKNGEEGAMPLADFVNRIVLEI 638
           R R   E+  + + +    +   +
Sbjct: 412 RDRDTMEQIRLHVDELEGFLRERL 435


>2dq0A [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 447

 Score =  192 bits (489), Expect = 2e-51
 Identities = 59/365 (16%), Positives = 111/365 (30%), Gaps = 60/365 (16%)

Query: 205 GDEKNKMLSRVYGTAFPKK--------SXXXXXXXXXXXXKKRDHNKLGRELGIFTTDEN 256
            DE + +  R +G A   K                     K + H  L   LG       
Sbjct: 118 KDENDNVPIRFWGKARVWKGHLERFLEQSQGKMEYEILEWKPKLHVDLLEILGGADFARA 177

Query: 257 V---GQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKD 313
               G     L+ +   +   L R+  D    +G+     P M +  + + S  ++ ++D
Sbjct: 178 AKVSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFED 237

Query: 314 GMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSG---E 370
            ++     + + E   L P        ++ +     +DLP+ +   S  FR E+     +
Sbjct: 238 VIY-----KVEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKD 292

Query: 371 MHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNT 430
             G+ RV QF   +  +   PE+  +  +  +   + + + L I           D    
Sbjct: 293 TKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEI-PYRVVNICTGDLGYV 351

Query: 431 EKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ 490
                D EAW   Q   RE+                                     +  
Sbjct: 352 AAKKYDIEAWMPGQGKFREV----------------------------------VSASNC 377

Query: 491 IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGA-----LPTWIAP 545
            D+  A R  + + D+  EK R      S+     R +  ++E +        +P  +  
Sbjct: 378 TDWQ-ARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVLWK 436

Query: 546 VQAKV 550
                
Sbjct: 437 YTGFK 441


>2cjbA [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 474

 Score =  185 bits (470), Expect = 3e-49
 Identities = 57/506 (11%), Positives = 130/506 (25%), Gaps = 79/506 (15%)

Query: 91  KLAIGPSIDNGFYYDFDTEKPF--------SADQLNXXXXXXXXXXXXXXXXXRFELPRN 142
            + +  ++   F         F        +                      R+    +
Sbjct: 2   HMKLQFNLKAYFKTKDAIAALFEEANSTLLTRGAPEGQGATEWDRIELTLQSGRYVRVHD 61

Query: 143 EALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAY 202
               L K                 I        + +   P++ +++ I+    L      
Sbjct: 62  AIFRLRKQLAEIEV-------ESFIIKVPADHELRMLKVPYIKSMENIEGGIQLELE--V 112

Query: 203 WKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQ--- 259
            + + KN++  R+      K              +  +H            +  + +   
Sbjct: 113 GEAEMKNRVPDRILTLLEEKIEAAQEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSS 172

Query: 260 -GLPLLMPKGARIIQTLQRWIEDEEQRR-GYVLTKTPLMAKSDLYKISGHWDHYKD---- 313
            G  +  P+ ARI +T ++ + +E     GY     P +   +++  SGH          
Sbjct: 173 RGQWIHGPQSARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYY 232

Query: 314 ------------------------GMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSY 349
                                       L  E+    +  +    CP  +          
Sbjct: 233 VCPPQTRDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPN 292

Query: 350 RDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVM 409
            ++PV+  + S       SG +HG+ RV +F   +   + T E++    +   D   ++ 
Sbjct: 293 EEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIF 352

Query: 410 ETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYG 469
             +                  E        W   Q  +  +     +  T+ +    + G
Sbjct: 353 NDILD---------------IEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRG 397

Query: 470 PKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLA 529
           P      +  +                + F +        +    +    S    ER  A
Sbjct: 398 PD-GEWLEFQN-------VSINGDKYPKGFNVKL------QSGDELWSGCSGVGLERWAA 443

Query: 530 MLIEKYAGALPTWIAPVQAKVLPLSD 555
           + + +       W    + +V  +  
Sbjct: 444 VFLAQKGLDPANWPEEFRNRVGEMPK 469


>2cj9A [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 477

 Score =  174 bits (441), Expect = 7e-46
 Identities = 60/505 (11%), Positives = 136/505 (26%), Gaps = 82/505 (16%)

Query: 98  IDNGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELPRNEALEL---------- 147
           +   F         F+ D +                         E   +          
Sbjct: 3   MKLQFNLKA----YFAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWDRIELTLQSGRYV 58

Query: 148 ---MKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWK 204
                    + +L   +     I        + +   P++ +++ I+    L       +
Sbjct: 59  RVHDAIFRLRKQLAEGIEVESFIIKVPADHELRMLKVPYIKSMENIEGGIQLEL--EVGE 116

Query: 205 GDEKNKMLSRVYGTAFPK-KSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENV----GQ 259
            + KN++  R+      K ++            +  +H            +  +     +
Sbjct: 117 AEMKNRVPDRILTLLEEKIEAAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSR 176

Query: 260 GLPLLMPKGARIIQTLQRWIEDEEQRR-GYVLTKTPLMAKSDLYKISGHWDHYKDGMFV- 317
           G  +  P+ ARI +T ++ + +E     GY     P +   +++  SGH       ++  
Sbjct: 177 GQWIHGPQSARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYV 236

Query: 318 ---------------------------LGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR 350
                                      L  E+    +  +    CP  +           
Sbjct: 237 CPPQTRDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE 296

Query: 351 DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVME 410
           ++PV+  + S       SG +HG+ RV +F   +   + T E++    +   D   ++  
Sbjct: 297 EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIF- 355

Query: 411 TLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGP 470
                          D  + E        W   Q  +  +     +  T+ +    + GP
Sbjct: 356 --------------NDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGP 401

Query: 471 KLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAM 530
             +         E   ++I  D                 +    +    S    ER  A+
Sbjct: 402 DGE-------WLEFQNVSINGDK-------YPKGFNVKLQSGDELWSGCSGVGLERWAAV 447

Query: 531 LIEKYAGALPTWIAPVQAKVLPLSD 555
            + +       W    + +V  +  
Sbjct: 448 FLAQKGLDPANWPEEFRNRVGEMPK 472


>2du3A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 534

 Score =  173 bits (439), Expect = 1e-45
 Identities = 41/472 (8%), Positives = 97/472 (20%), Gaps = 36/472 (7%)

Query: 175 FVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXX 234
             ++ A      + P       +    +       +      G +               
Sbjct: 23  GKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLS-IGFSEVVNPLIVEDVHVKK 81

Query: 235 XXKKRDHNKLGRELGIFTTDEN--VGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTK 292
              +     L R   + T  +         +   +     +   + +++   R       
Sbjct: 82  QFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEID 141

Query: 293 TPLMAKSDLYKISGHWDHYKDGMFVLGDEEK----DSEVFALRPMTCPFQYAIYNSTQHS 348
              ++      +          +  +  E K     S    LR       +   +     
Sbjct: 142 GDDLSYLIAEVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIA-D 200

Query: 349 YRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYV 408
              LP++       FR E   +     R+  +  A   +V     ++D       L++  
Sbjct: 201 KLPLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQF 257

Query: 409 METLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFY 468
                           +     EK          T+          +             
Sbjct: 258 GFE------------NFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIAT 305

Query: 469 GPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTL 528
                      +     ++ + +           Y D         +  +         L
Sbjct: 306 FGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVR-----KMVYPQIHGEIKLSDL 360

Query: 529 AMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADHRAEKIGYKI 588
            +  E     +P   A        + +    +A                    E +G  +
Sbjct: 361 DIAREIKVKEVPQT-AVGLKIAQSIVETAEKHA-------SEPSPCSFLAFEGEMMGRNV 412

Query: 589 REARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIAN 640
           R   +E      + G   A    V         +     + F   +   I  
Sbjct: 413 RVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSFFEEGVPTGIRY 464


>2du5A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 534

 Score =  172 bits (436), Expect = 3e-45
 Identities = 40/472 (8%), Positives = 96/472 (20%), Gaps = 36/472 (7%)

Query: 175 FVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXX 234
             ++ A      + P       +    +       +      G +               
Sbjct: 23  GKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLS-IGFSEVVNPLIVEDVHVKK 81

Query: 235 XXKKRDHNKLGRELGIFTTDEN--VGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTK 292
              +     L R   + T  +         +   +     +   + +++   R       
Sbjct: 82  QFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEID 141

Query: 293 TPLMAKSDLYKISGHWDHYKDGMFVLGDEEK----DSEVFALRPMTCPFQYAIYNSTQHS 348
              ++      +          +  +  E K     S    LR       +   +     
Sbjct: 142 GDDLSYLIAEVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIA-D 200

Query: 349 YRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYV 408
              LP++       FR E   +     R+  +  A   +V     ++D       L++  
Sbjct: 201 KLPLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQF 257

Query: 409 METLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFY 468
                           +     EK          T+          +             
Sbjct: 258 GFE------------NFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIAT 305

Query: 469 GPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTL 528
                      +     ++ + +           Y D         +  +         L
Sbjct: 306 FGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVR-----KMVYPQIHGEIKLSDL 360

Query: 529 AMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADHRAEKIGYKI 588
            +  E     +P   A        + +    +A                    E +G  +
Sbjct: 361 DIAREIKVKEVPQT-AVGLKIAQSIVETAEKHA-------SEPSPCSFLAFEGEMMGRNV 412

Query: 589 REARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIAN 640
           R   +       + G   A    V         +     + F   +   I  
Sbjct: 413 RVYVVNENENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSFFEEGVPTGIRY 464


>1adjA [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
          Length = 420

 Score =  167 bits (424), Expect = 6e-44
 Identities = 51/425 (12%), Positives = 109/425 (25%), Gaps = 50/425 (11%)

Query: 257 VGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMF 316
             +G   L  K  R+ Q +        +  G +   TP+  ++ +++             
Sbjct: 4   AVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKE 63

Query: 317 VLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIR 376
           +   +++      LRP         Y          PVR      +FR E   +      
Sbjct: 64  MFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGR---- 119

Query: 377 VRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNT--EKYI 434
            RQF   +   + +           V L+   ++ LG+   +  + S             
Sbjct: 120 YRQFHQVNYEALGSENP--ILDAEAVVLLYECLKELGL-RRLKVKLSSVGDPEDRARYNA 176

Query: 435 NDPEAWENTQNIMREILN-----------HLNIDFTEADDEAAFYGPKLDIQFKNVHGKE 483
              E     +  + E                  +  +A  +     P LD   +      
Sbjct: 177 YLREVLSPHREALSEDSKERLEENPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHL 236

Query: 484 DTIITIQIDFALAERFGMYYIDKD-------GEKKRPYIIHRSSIGCYERTLAMLIEKYA 536
             +       ++        +           E     I  +S++G   R   +      
Sbjct: 237 KEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGG 296

Query: 537 GALPTW----------------------IAPVQAKVLPLSDKYADYANXXXXXXXXXXXX 574
             +P                               ++PL+++    A             
Sbjct: 297 PRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRA 356

Query: 575 XXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRI 634
                   K    + EA      +   +GE E    EV+++    GE+  +   +    +
Sbjct: 357 EY-ALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYL 415

Query: 635 VLEIA 639
           +  + 
Sbjct: 416 LQALG 420


>3bjuD [x.x.x] LYSYL-TRNA SYNTHETASE
          Length = 499

 Score =  164 bits (416), Expect = 5e-43
 Identities = 47/518 (9%), Positives = 110/518 (21%), Gaps = 61/518 (11%)

Query: 136 RFELPRNEALEL--MKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAV 193
            +++      +L    ++PY  +   D+   + I  Y      D      L     I A 
Sbjct: 6   YYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAK 65

Query: 194 KLLRSTGAYWKGDEKNKMLSRV---------------------------YGTAFPKKSXX 226
           +       ++    +   L  +                            G     K   
Sbjct: 66  RASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGE 125

Query: 227 XXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRR 286
                          + L ++         +   L   + +   I   +  +I       
Sbjct: 126 LSIIPYEITLLSPCLHMLPKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDEL 185

Query: 287 GYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQ 346
           G++  +TP+M       ++  +  Y + +              +R     +        +
Sbjct: 186 GFLEIETPMMNIIPGGAVAKPFITYHNELD---------MNLYMRIAPELYH-------K 229

Query: 347 HSYRDLPVRFAETSTLFRNESSG-----EMHGLIRVRQFTLADGHIVCTPEQLEDEFKNT 401
                   R  E    FRNE        E         +      +  T + +    K+ 
Sbjct: 230 MLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHI 289

Query: 402 VDLVKYVMETLGIAD-DITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTE 460
               K      G         F+        + IN  E  E    +     N    + T 
Sbjct: 290 TGSYKVTYHPDGPEGQAYDVDFTP-----PFRRINMVEELEKALGMKLPETNLFETEETR 344

Query: 461 ADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKK-RPYIIHRS 519
              +       ++        +    +  +                        +   + 
Sbjct: 345 KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKE 404

Query: 520 SIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADH 579
            +        M  E             Q ++     K     +                 
Sbjct: 405 GLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYG 464

Query: 580 RAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSR 617
                G+ +   R+     + +      +   +    +
Sbjct: 465 LPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPAMK 498


>1asyA [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
          Length = 490

 Score =  163 bits (413), Expect = 1e-42
 Identities = 41/476 (8%), Positives = 93/476 (19%), Gaps = 50/476 (10%)

Query: 100 NGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELPRN-------EALELMKDEP 152
            G      +       Q                         N        A   ++ + 
Sbjct: 8   YGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTLRQQA 67

Query: 153 YKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKML 212
             ++ +    +   IS   +     L     ++    +K V     +      +     +
Sbjct: 68  SLIQGLVKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKI 127

Query: 213 SRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARII 272
             +  T                  +      +  +  +      V     +      RI 
Sbjct: 128 YTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYR---VIDLRTVTNQAIFRIQ 184

Query: 273 QTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRP 332
             +     +    + +    TP +  +     S  ++                    L  
Sbjct: 185 AGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGK-----------AYLAQ 233

Query: 333 MTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPE 392
                +       Q        R  E   +FR E+S     +       +         E
Sbjct: 234 SPQFNK-------QQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHE 286

Query: 393 QLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTE-------------------KY 433
            L+   +  V +   + +     +    R                               
Sbjct: 287 VLDTLSELFVFIFSELPKRFAH-EIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAA 345

Query: 434 INDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDF 493
             +   +E+      + L  L  D  + D       P     F  +    +   +   DF
Sbjct: 346 GKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDF 405

Query: 494 AL--AERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQ 547
            +   E         D    +  +                     G  P     + 
Sbjct: 406 FMRGEEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIG 461


>2dq2A [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 448

 Score =  157 bits (398), Expect = 7e-41
 Identities = 58/386 (15%), Positives = 115/386 (29%), Gaps = 62/386 (16%)

Query: 190 IKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKK--------SXXXXXXXXXXXXKKRDH 241
           +  +  +         DE + +  R +G A   K                     K + H
Sbjct: 103 LWRLPNITHPSVPVGKDENDNVPIRFWGKARVWKGHLERFLEQSQGKMEYEILEWKPKLH 162

Query: 242 NKLGRELGIFTT---DENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAK 298
             L   LG        +  G     L+ +   +   L R+  D    +G+     P M +
Sbjct: 163 VDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVR 222

Query: 299 SDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAE 358
             + + S  ++ ++D ++ + DE+       L P        ++ +     +DLP+ +  
Sbjct: 223 RFVEEGSTSFEDFEDVIYKVEDED-----LYLIPTAEHPLAGMHANEILDGKDLPLLYVG 277

Query: 359 TSTLFRNESSG---EMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIA 415
            S  FR E+     +  G+ RV QF   +  +   PE+  +  +  +   + + + L I 
Sbjct: 278 VSPCFRKEAGTAGKDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEI- 336

Query: 416 DDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQ 475
                     D         D EAW                                   
Sbjct: 337 PYRVVNICTGDLGYVAAKKYDIEAW----------------------------------- 361

Query: 476 FKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKY 535
                   + +         A R  + + D+  EK R      S+     R +  ++E +
Sbjct: 362 MPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENH 421

Query: 536 AGALPTWIAP-------VQAKVLPLS 554
                T   P          +++P+ 
Sbjct: 422 QEEDGTVRIPKVLWKYTGFKEIVPVE 447


>2cjbB [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 495

 Score =  155 bits (392), Expect = 3e-40
 Identities = 64/538 (11%), Positives = 143/538 (26%), Gaps = 88/538 (16%)

Query: 53  EDSSLEICTF-DSKEGQHAFNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKP 111
              +L+     D    + A         +  + R  P+ + A               E  
Sbjct: 6   LQFNLKAYFKADPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKL-------GEDR 58

Query: 112 FSADQLNXXXXXXXXXXXXXXXXXRFELPRNEALELMKDEPYKVELINDLPEGEVISFYQ 171
                                     +       +L +    K        E  +I    
Sbjct: 59  IELTL------------QSGRYVRVHDAIFRLRKQLAEALGKK--YRGIEVESFIIKVPA 104

Query: 172 IGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFP-KKSXXXXXX 230
             +       P++ +++ I+    L       + + KN++  R+        ++      
Sbjct: 105 DHELRM-LKVPYIKSMENIEGGIQLEL--EVGEAEMKNRVPDRILTLLEEKIEAAQYEHW 161

Query: 231 XXXXXXKKRDHNKLGRELGIFTTDE----NVGQGLPLLMPKGARIIQTLQR-WIEDEEQR 285
                 +  +H            +        +G  +  P+ ARI +T ++  +E+  + 
Sbjct: 162 NLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEP 221

Query: 286 RGYVLTKTPLMAKSDLYKISGHWDHYKDGM---FVLGDEEKDS----------------- 325
            GY     P +   +++  SGH       +         + D                  
Sbjct: 222 LGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDPDYWEEVADYYKVTHEVPTK 281

Query: 326 --------EVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRV 377
                    +  +    CP  +           ++PV+  + S       SG +HG+ RV
Sbjct: 282 LIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRSGTSHRYESGGIHGIERV 341

Query: 378 RQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDP 437
            +F   +   + T E++    +   D   ++                 D  + E      
Sbjct: 342 DEFHRIEIVWIGTKEEVLKCAEELHDRYMHIF---------------NDILDIEWRKARV 386

Query: 438 EAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAE 497
             W   Q  +  +     +  T+ +    + GP            E   ++I  D    +
Sbjct: 387 TPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDG-------EWLEFQNVSINGDKY-PK 438

Query: 498 RFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSD 555
            F +        +    +    S    ER  A+ + +       W    + +V  +  
Sbjct: 439 GFNVKL------QSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK 490


>2d32C [x.x.x] GLUTAMATE--CYSTEINE LIGASE
          Length = 499

 Score =  153 bits (388), Expect = 1e-39
 Identities = 34/310 (10%), Positives = 72/310 (23%), Gaps = 20/310 (6%)

Query: 339 YAIYNSTQHSYRDLPVRFAETSTLFRNES-----SGEMHGLIRVRQFTLADGHIVCTPEQ 393
               +         P            E+      G +           A  H   T + 
Sbjct: 2   IPDVSQALAWLEKHPQALKGIQRGLERETLRVNADGTLATTGHPEALGSALTHKWITTDF 61

Query: 394 LEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNH 453
            E   +    +   +   L    D+           T + + D   W  +       +  
Sbjct: 62  AEALLEFITPVDGDIEHMLTFMRDLHRY--------TARNMGDERMWPLSMPSYIADIEL 113

Query: 454 LNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRP 513
                +        Y   L  ++        TI  +  +F+L   F    I     K++ 
Sbjct: 114 AQYGTSNTGRFKTLYREGLKNRYG---ALMQTISGVHYNFSLPMAFWQAKISGADAKEKI 170

Query: 514 YIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKY---ADYANXXXXXXXX 570
              +   I  Y R   ++   + GA P   +                             
Sbjct: 171 SAGYFRVIRNYYRFGWVIPYLF-GASPAISSSFSLPFEKTMYYLPYATSLRLSDLGYTNQ 229

Query: 571 XXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF 630
                  +   E +    +  +     Y  +  EK+ +  +++    +   E   P+   
Sbjct: 230 SNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAPIRPK 289

Query: 631 VNRIVLEIAN 640
                 E  +
Sbjct: 290 RVTRSGESPS 299


>1e1tA [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
          Length = 485

 Score =  152 bits (385), Expect = 2e-39
 Identities = 51/479 (10%), Positives = 109/479 (22%), Gaps = 54/479 (11%)

Query: 80  AAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFEL 139
           A          +  +      G  +  D  +  ++DQL+                  F+ 
Sbjct: 1   AIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLH----------------EEFDA 44

Query: 140 PRNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRST 199
             N+ LE       +V +   +             FV L      + +   +   L    
Sbjct: 45  KDNQELE---SLNIEVSVAGRM---MTRRIMGKASFVTLQDVGGRIQLYVAR-DSLPEGV 97

Query: 200 GAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQ 259
                       +    GT F  ++              +    L  +   +     +  
Sbjct: 98  YNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYRQRY-LDL 156

Query: 260 GLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLG 319
                  +   +   +   I      RG++  +TP+M        +  +  + + +    
Sbjct: 157 IANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALD--- 213

Query: 320 DEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQ 379
                     LR     +                 R  E +  FRNE     H      +
Sbjct: 214 ------LDMYLRIAPELYLK-------RLVVGGFERVFEINRNFRNEGISVRH----NPE 256

Query: 380 FTLADGHIV-CTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPE 438
           FT+ + ++       L +  +    L + + + +     +TY    +D     + +   E
Sbjct: 257 FTMMELYMAYADYHDLIELTE---SLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMRE 313

Query: 439 AWE-----NTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDF 493
           A +          +        +  +        +G    +        E  +I      
Sbjct: 314 AIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFIT 373

Query: 494 ALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLP 552
                        D             IG  E          A                
Sbjct: 374 EYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAA 431


>2cj9B [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 493

 Score =  152 bits (383), Expect = 4e-39
 Identities = 52/515 (10%), Positives = 128/515 (24%), Gaps = 89/515 (17%)

Query: 100 NGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELPRNEALELMKDEPYKVELIN 159
               ++       ++                                 + +     + I 
Sbjct: 4   MKLQFNLKAY-FKTSADPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLGEDRIE 62

Query: 160 --------------------------DLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAV 193
                                      +     I        + +   P++ +++ I+  
Sbjct: 63  LTLQSGRYVRVHDAIFRLRKQLAEALGIEVESFIIKVPADHELRMLKVPYIKSMENIEGG 122

Query: 194 KLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTT 253
             L       +   +             + +            +  +H            
Sbjct: 123 IQLELEVGEAEMKNRVPDRILTLLEEKIEAAQYAEHWNLLWQREPMEHPFKEDPTQAMMK 182

Query: 254 DENV----GQGLPLLMPKGARIIQTLQRWIEDEE-QRRGYVLTKTPLMAKSDLYKISGHW 308
           +  +     +G  +  P+ ARI +T ++ + +E  +  GY     P +   +++  SGH 
Sbjct: 183 EGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEVWMKSGHA 242

Query: 309 DHYKDGMF----------------------------VLGDEEKDSEVFALRPMTCPFQYA 340
                 ++                             L  E+    +  +    CP  + 
Sbjct: 243 KGVYPEIYYVCPPQTRDPDYWEEVADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWM 302

Query: 341 IYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKN 400
                     ++PV+  + S       SG +HG+ RV +F   +   + T E++    + 
Sbjct: 303 YVAGETLPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEE 362

Query: 401 TVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTE 460
             D   ++   +                  E        W   Q  +  +     +  T+
Sbjct: 363 LHDRYMHIFNDILD---------------IEWRKARVTPWFMAQEGLLGLAEENTVGTTD 407

Query: 461 ADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSS 520
            +    + GP  +         E   ++I  D    + F +             +    S
Sbjct: 408 YEACLPYRGPDGE-------WLEFQNVSINGDKY-PKGFNVKLQS------GDELWSGCS 453

Query: 521 IGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSD 555
               ER  A+ + +       W    + +V  +  
Sbjct: 454 GVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK 488


>3bjuC [x.x.x] LYSYL-TRNA SYNTHETASE
          Length = 501

 Score =  148 bits (373), Expect = 5e-38
 Identities = 44/503 (8%), Positives = 107/503 (21%), Gaps = 48/503 (9%)

Query: 136 RFELPRNEALELMKDEPYKVELINDLPEGEVISFY-QIG---------DFVDLCAGPHL- 184
             +   + +L     + Y      D      +    +I           F DL       
Sbjct: 25  PHKFHVDISLTDFIQK-YSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKL 83

Query: 185 ---MAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDH 241
                 +  K+ +         +  +   +      T   + S                 
Sbjct: 84  QVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLP 143

Query: 242 NKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDL 301
           + L  +   +     +   L   + +   I   +  +I       G++  +TP+M     
Sbjct: 144 HGLKDKETRYRQRY-LDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPG 202

Query: 302 YKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETST 361
             ++  +  Y + +              +R     +        +        R  E   
Sbjct: 203 GAVAKPFITYHNELD---------MNLYMRIAPELYH-------KMLVVGGIDRVYEIGR 246

Query: 362 LFRNESSG-----EMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIAD 416
            FRNE        E         +      +  T + +    K+     K      G   
Sbjct: 247 QFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEG 306

Query: 417 -DITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQ 475
                 F+        + IN  E  E    +     N    + T    +       ++  
Sbjct: 307 QAYDVDFTP-----PFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECP 361

Query: 476 FKNVHGKEDTIITIQIDFALAERFGMYY-IDKDGEKKRPYIIHRSSIGCYERTLAMLIEK 534
                 +    +  +                +       +   +  +        M  E 
Sbjct: 362 PPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEI 421

Query: 535 YAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADHRAEKIGYKIREARLE 594
                       Q ++     K     +                      G+ +   R+ 
Sbjct: 422 CNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV- 480

Query: 595 RTPYILVVGEKEAENKEVSVRSR 617
               + +      +   +    +
Sbjct: 481 ---AMFLTDSNNIKEVLLFPAMK 500


>2dq3A [x.x.x] SERYL-TRNA SYNTHETASE
          Length = 422

 Score =  146 bits (370), Expect = 1e-37
 Identities = 58/320 (18%), Positives = 110/320 (34%), Gaps = 29/320 (9%)

Query: 205 GDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENV---GQGL 261
            DEK+ +  R +G                   + + H ++G  LGI          G   
Sbjct: 116 EDEKDNVEVRRWGEPRKFD------------FEPKPHWEIGERLGILDFKRGAKLSGSRF 163

Query: 262 PLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDE 321
            ++   GAR+ + L     D   ++GY     P + K ++   +G    +++ ++    +
Sbjct: 164 TVIAGWGARLERALIN-FLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERD 222

Query: 322 EKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSG---EMHGLIRVR 378
                   L P        +Y        +LP+     +  +R E+     ++ G+IR  
Sbjct: 223 N-----LYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQH 277

Query: 379 QFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPE 438
           QF   +   +  P+   DE +  V   + V++ LG+           D   +     D E
Sbjct: 278 QFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGL-PYRVVELCTGDLGFSAAKTYDIE 336

Query: 439 AWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAER 498
            W  +QN  REI +  N +  +A     F   K              +   +   A+ E 
Sbjct: 337 VWFPSQNKYREISSCSNCEDFQARRNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILEN 396

Query: 499 FGMYYIDKDGEKKRPYIIHR 518
           +      +DG    P ++  
Sbjct: 397 YQ----QEDGSVVVPEVLRD 412


>3e9hA [x.x.x] LYSYL-TRNA SYNTHETASE
          Length = 484

 Score =  133 bits (335), Expect = 1e-33
 Identities = 37/443 (8%), Positives = 99/443 (22%), Gaps = 39/443 (8%)

Query: 136 RFELPRNEALELMKDEPYKVELINDLPE-------GEVISFYQIGDFVDLCAGPHLMAVK 188
                R    E + +    +       +       G +++   +G             ++
Sbjct: 25  GKRFERTHKAEELFELYGDLSKEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQ 84

Query: 189 PIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFP-KKSXXXXXXXXXXXXKKRDHNKLGRE 247
                  +               +  V GT F  K               K       ++
Sbjct: 85  IYVRQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKD 144

Query: 248 LGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGH 307
           +        +   +     K       + + +       GY+  +TP+M        +  
Sbjct: 145 IEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARP 204

Query: 308 WDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNES 367
           +  + + +              +R              +        +  E   +FRNE 
Sbjct: 205 FITHHNALD---------MTLYMRIAIELHL-------KRLIVGGLEKVYEIGRVFRNEG 248

Query: 368 SGEMHGLIRVRQFTLADGHIV-CTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWD 426
                      +FT+ + +        +    +   +L+ ++   +     I Y     D
Sbjct: 249 I----STRHNPEFTMLELYEAYADFRDIMKLTE---NLIAHIATEVLGTTKIQYGEHLVD 301

Query: 427 PNNTEKYINDPEAWENTQNI------MREILNHLNIDFTEADDEAAFYGPKLDIQFKNVH 480
                + ++  +A +    +        E    L  +          +G  ++  F+   
Sbjct: 302 LTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHMTFGHIVNEFFEQKV 361

Query: 481 GKEDTIITIQIDFALAERFGMYYIDKDGEKKRPY-IIHRSSIGCYERTLAMLIEKYAGAL 539
             +    T      +           D      + +           T            
Sbjct: 362 EDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRF 421

Query: 540 PTWIAPVQAKVLPLSDKYADYAN 562
              +   +       +   D+  
Sbjct: 422 EEQLKEREQGNDEAHEMDEDFLE 444


>1eiyA [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE
          Length = 345

 Score =  131 bits (329), Expect = 8e-33
 Identities = 44/353 (12%), Positives = 76/353 (21%), Gaps = 57/353 (16%)

Query: 204 KGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDEN------- 256
           +     + L  +      KK                +  K G+EL               
Sbjct: 5   QNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEARE 64

Query: 257 ------------------VGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAK 298
                             V      L   G   I  ++R + +  +  GY   + P +  
Sbjct: 65  KALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVES 124

Query: 299 SDLYKISG-----HWDHYKDGMFVLGDE---------EKDSEVFALRPMTCPFQYAIYNS 344
                 +      H        F L  E         E+      LR  T P Q      
Sbjct: 125 EFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSPMQVRYM-- 182

Query: 345 TQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDL 404
                   P R      +FR E +           F   +G +V     +        +L
Sbjct: 183 ---VAHTPPFRIVVPGRVFRFEQT----DATHEAVFHQLEGLVVGEGIAMAHLKGAIYEL 235

Query: 405 VKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDE 464
            + +        D   RF        E        W      +      +         +
Sbjct: 236 AQALFG-----PDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVD 290

Query: 465 AAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIH 517
           A      L   ++ V G    +   ++              +     R   + 
Sbjct: 291 AYRERLGLPPAYRGVTGFAFGLGVERLAMLRYGIPD----IRYFFGGRLKFLE 339


>3cmqA [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL
          Length = 405

 Score =  127 bits (320), Expect = 7e-32
 Identities = 31/409 (7%), Positives = 81/409 (19%), Gaps = 40/409 (9%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLM 296
             +D +       +        +    L  +    +  ++  +++   ++      TPL 
Sbjct: 12  YPQDDHSNLTRKVLT-------RVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLF 64

Query: 297 AKSDLYKISGHWDHYKDGMFVLGDEE-KDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVR 355
           +  D            D + +  D   +          T   +                 
Sbjct: 65  SVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDA 124

Query: 356 FAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIA 415
           F     ++R +     H       F   +   + +  +L             + E    +
Sbjct: 125 FLVVGDVYRRDQIDSQH----YPIFHQLEAVRLFSKHELFAGI--KDGESLQLFEQSSRS 178

Query: 416 DDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQ 475
                          E         + T   +   L    ++    D    F  P  +++
Sbjct: 179 AHKQETH------TMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEME 232

Query: 476 FKNVH---GKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLI 532
                         +  Q     A              +R  +I                
Sbjct: 233 INFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDER 292

Query: 533 EKYAGALPTWIAPVQAKVL-----------------PLSDKYADYANXXXXXXXXXXXXX 575
                 +      V+ + L                   ++                    
Sbjct: 293 FLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDL 352

Query: 576 XADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGA 624
                  K        R+        + ++E  +   +++       G 
Sbjct: 353 IDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGV 401


>1c0aA [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
          Length = 585

 Score =  127 bits (320), Expect = 7e-32
 Identities = 37/401 (9%), Positives = 85/401 (21%), Gaps = 41/401 (10%)

Query: 149 KDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPH-LMAVKPIKAVKLLRSTGAYWKGDE 207
           + +   +  I+      ++  +   D  D       L     I+    +R+        +
Sbjct: 27  RRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRD 86

Query: 208 KNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPK 267
                  V  ++    +               +     R L +              M +
Sbjct: 87  MATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRP----------EMAQ 136

Query: 268 GARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEV 327
             +    +   +       G++  +TP         ++           V     K    
Sbjct: 137 RLKTRAKITSLVRRFMDDHGFLDIETP--------MLTKATPEGARDYLVPSRVHKG--- 185

Query: 328 FALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHI 387
              +    P   +     Q        R+ +    FR+E         R  +FT  D   
Sbjct: 186 ---KFYALP--QSPQLFKQLLMMSGFDRYYQIVKCFRDEDL----RADRQPEFTQIDVET 236

Query: 388 V-CTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNI 446
              T  Q+ +  +  V  +   ++ + +  D                  D        ++
Sbjct: 237 SFMTAPQVREVMEALVRHLWLEVKGVDL-GDFPVMTFAEAERRYGSDKPDLRNPMELTDV 295

Query: 447 MREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDK 506
              + +     F                               +        F   Y  K
Sbjct: 296 ADLLKSVEFAVF--------AGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAK 347

Query: 507 DGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQ 547
                +     +   G        L  +    +    A   
Sbjct: 348 GLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQD 388


>1bbuA [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
          Length = 486

 Score =  123 bits (309), Expect = 1e-30
 Identities = 44/423 (10%), Positives = 99/423 (23%), Gaps = 36/423 (8%)

Query: 138 ELPRNEALELMKD--EPYKVELINDLPE-----GEVISFYQIGDFVDL-CAGPHLMAVKP 189
           +  R+   + +    +  + E +  L       G +++   +G    +            
Sbjct: 28  DFRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLY 87

Query: 190 IKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELG 249
           +    L                +    G  F  K+              +    L  +  
Sbjct: 88  VARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDDQE 147

Query: 250 IFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWD 309
                  +            ++   +   I      RG++  +TP+M        +  + 
Sbjct: 148 ARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFI 207

Query: 310 HYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSG 369
            + + +              LR     +   +             R  E +  FRNE   
Sbjct: 208 THHNALD---------LDMYLRIAPELYLKRLVV-------GGFERVFEINRNFRNEGIS 251

Query: 370 EMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNN 429
             H      +FT+ + ++       +D  + T  L + + + +    ++TY     D   
Sbjct: 252 VRH----NPEFTMMELYMAYADY--KDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGK 305

Query: 430 TEKYINDPEAWE-----NTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKED 484
             + +   EA +          +    +   I  +        +G    +        E 
Sbjct: 306 PFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEA 365

Query: 485 TIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIA 544
            +I                   D             IG  E          A        
Sbjct: 366 HLIQPTFITEYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFL 424

Query: 545 PVQ 547
              
Sbjct: 425 DQV 427


>1bbwA [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
          Length = 469

 Score =  116 bits (291), Expect = 2e-28
 Identities = 36/408 (8%), Positives = 90/408 (22%), Gaps = 34/408 (8%)

Query: 138 ELPRNEALELMKD--EPYKVELINDLPEGEVISFYQI-------GDFVDLCAGPHLMAVK 188
           +  R+   + +    +  + E +  L     ++   +         FV L      + + 
Sbjct: 28  DFRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLY 87

Query: 189 PIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGREL 248
            +    L                +    G  F  K+              +    L  + 
Sbjct: 88  -VARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDQE 146

Query: 249 GIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHW 308
             +     +            ++   +   I      RG++  +TP+M      +     
Sbjct: 147 ARYRQRY-LDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPAARPFITH 205

Query: 309 DHYKDGMFVLGDEEKDSEVFALRPMTCP-FQYAIYNSTQHSYRDLPVRFAETSTLFRNES 367
            +  D    L    +      L+ +    F+     +       + V   E + +    +
Sbjct: 206 HNALDLDMYLRIAPE----LYLKRLVVGGFERVFEINRNFRNEGISVHNPEFTMMELYMA 261

Query: 368 SGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDP 427
             +   LI +            T        ++ +   +     + +       F K   
Sbjct: 262 YADYKDLIEL------------TESLFRTLAQDILGKTEVTYGDVTL------DFGKPFE 303

Query: 428 NNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTII 487
             T +        E     +    +   I  +        +G    +        E  +I
Sbjct: 304 KLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLI 363

Query: 488 TIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKY 535
                              D   +          G         +   
Sbjct: 364 QPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA 411


>2du3B [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 465

 Score =  110 bits (276), Expect = 1e-26
 Identities = 38/418 (9%), Positives = 91/418 (21%), Gaps = 53/418 (12%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLM 296
             +   ++  E             +          +    + + +     G+     PL+
Sbjct: 19  AWKAGKEILAERSPNEL----YPRVGFSFG-KEHPLFATIQRLREAYLSIGFSEVVNPLI 73

Query: 297 AKSDLYKISGHWDHYKDGMF-------VLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSY 349
            +    K     +                 + +  S    LR       +   +      
Sbjct: 74  VEDVHVKKQFGREALAVLDRCFYLATLPKPNLKPISSTLTLRSHMTTGWFITLS-HIADK 132

Query: 350 RDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVM 409
             LP++       FR E         R+  +  A   +V     ++D       L++   
Sbjct: 133 LPLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQ-- 187

Query: 410 ETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYG 469
              G  +    +  K           +  A+           +   I       E A +G
Sbjct: 188 --FGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWI-------EIATFG 238

Query: 470 PKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLA 529
                     +     ++ + +                   +R  +I        +    
Sbjct: 239 -IYSPTALAEYDIPYPVMNLGLGV-----------------ERLAMILYGYDDVRKMVYP 280

Query: 530 MLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXAD----HRAEKIG 585
            +  +   +       ++ K +P +      A                        E +G
Sbjct: 281 QIHGEIKLSDLDIAREIKVKEVPQTAVGLKIAQSIVETAEKHASEPSPCSFLAFEGEMMG 340

Query: 586 YKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIANREN 643
             +R   +E      + G   A    V          G      + +     +     
Sbjct: 341 RNVRVYVVEEEENTKLCGPAYANEVVVYKG----DIYGIPKTKKWRSFFEEGVPTGIR 394


>3cw4A [x.x.x] POLYMERASE BASIC PROTEIN 2
          Length = 208

 Score =  110 bits (275), Expect = 1e-26
 Identities = 15/219 (6%), Positives = 41/219 (18%), Gaps = 21/219 (9%)

Query: 301 LYKISGHWD-HYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIY-NSTQHSYRDLPVRFAE 358
           +++I+G          +++ + E           +            +     +P     
Sbjct: 2   MWEINGPESVLVNTYQWIIRNWE-----TVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRG 56

Query: 359 TSTLFRNESSGEMH---GLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIA 415
             + F      +M    G     Q           P+Q   +F +    V+     + + 
Sbjct: 57  QYSGFVRTLFQQMRDVLGTFDTAQIIKLLPFAAAPPKQSRMQFSSFTVNVRGSGMRILV- 115

Query: 416 DDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQ 475
                  S     N           +              ++                  
Sbjct: 116 ----RGNSPVFNYNKATKRLTVLGKDAGTLTEDPDEGTAGVESAVLRGFLILGKEDKRY- 170

Query: 476 FKNVHGKEDTIITIQIDFALAERFGMY-YIDKDGEKKRP 513
                          +         +         K++ 
Sbjct: 171 ----GPALSINELSNLAKGEKANVLIGQGDVVLVMKRKR 205


>2du5B [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 465

 Score =  109 bits (273), Expect = 2e-26
 Identities = 37/418 (8%), Positives = 90/418 (21%), Gaps = 53/418 (12%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLM 296
             +   ++  E             +          +    + + +     G+     PL+
Sbjct: 19  AWKAGKEILAERSPNEL----YPRVGFSFG-KEHPLFATIQRLREAYLSIGFSEVVNPLI 73

Query: 297 AKSDLYKISGHWDHYKDGMF-------VLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSY 349
            +    K     +                 + +  S    LR       +   +      
Sbjct: 74  VEDVHVKKQFGREALAVLDRCFYLATLPKPNLKPISSTLTLRSHMTTGWFITLS-HIADK 132

Query: 350 RDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVM 409
             LP++       FR E         R+  +  A   +V     ++D       L++   
Sbjct: 133 LPLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQ-- 187

Query: 410 ETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYG 469
              G  +    +  K           +  A+           +   I       E A +G
Sbjct: 188 --FGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWI-------EIATFG 238

Query: 470 PKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLA 529
                     +     ++ + +                   +R  +I        +    
Sbjct: 239 -IYSPTALAEYDIPYPVMNLGLGV-----------------ERLAMILYGYDDVRKMVYP 280

Query: 530 MLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXAD----HRAEKIG 585
            +  +   +       ++ K +P +      A                        E +G
Sbjct: 281 QIHGEIKLSDLDIAREIKVKEVPQTAVGLKIAQSIVETAEKHASEPSPCSFLAFEGEMMG 340

Query: 586 YKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIANREN 643
             +R   +       + G   A    V          G      + +     +     
Sbjct: 341 RNVRVYVVNENENTKLCGPAYANEVVVYKG----DIYGIPKTKKWRSFFEEGVPTGIR 394


>2bamB [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
          Length = 210

 Score =  106 bits (265), Expect = 2e-25
 Identities = 17/175 (9%), Positives = 40/175 (22%), Gaps = 10/175 (5%)

Query: 240 DHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKS 299
                  E               LL        +     ++ E+++ G +      +  S
Sbjct: 44  TFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENS 103

Query: 300 DLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAET 359
           +L ++   ++            +       L         AI        + L     + 
Sbjct: 104 ELKRVGMEFETGNISSAHRSMNK-----LLLGLKHGEIDLAII---LMPIKQLAYYLTDR 155

Query: 360 STLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGI 414
            T F          L   + F     +       +    K +  + K  ++    
Sbjct: 156 VTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKWKD 208


>2eiuC [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
          Length = 120

 Score =  104 bits (261), Expect = 8e-25
 Identities = 7/102 (6%), Positives = 21/102 (20%), Gaps = 8/102 (7%)

Query: 464 EAAFYGPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGC 523
           E    G   +          + +  I +             +          +  +    
Sbjct: 6   EGKVEGVPGNYPLT-----AENLFRIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVG 60

Query: 524 YERTLAMLIEKYAGALPTWIAPVQAKVLPL---SDKYADYAN 562
           +      +     G +  ++   +  VL     S+       
Sbjct: 61  FMNAGGSVNVGKGGDIKLFLQKGEIYVLEFQPLSETDIKKLE 102


>1bhmB [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
          Length = 208

 Score =  104 bits (259), Expect = 1e-24
 Identities = 17/174 (9%), Positives = 40/174 (22%), Gaps = 10/174 (5%)

Query: 239 RDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAK 298
           +       E               LL        +     ++ E+++ G +      +  
Sbjct: 43  KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIEN 102

Query: 299 SDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAE 358
           S+L ++   ++                    L         AI        + L     +
Sbjct: 103 SELKRVGMEFETGNISSAHRSM-----NKLLLGLKHGEIDLAII---LMPIKQLAYYLTD 154

Query: 359 TSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETL 412
             T F          L   + F     +       +    K +  + K  ++  
Sbjct: 155 RVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKW 206


>3dsqA [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
          Length = 278

 Score =  103 bits (257), Expect = 2e-24
 Identities = 39/271 (14%), Positives = 78/271 (28%), Gaps = 30/271 (11%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQR--WIEDEEQ------RRGY 288
              D     R            Q +        ++     R   +E EE+      ++G+
Sbjct: 28  GFSDALSRDRAFQGIEH-----QLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGF 82

Query: 289 VLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHS 348
           V   TP +            +                    LRPM  P  Y ++      
Sbjct: 83  VQVVTPTIITKSALAKMTIGEPLFS------QVFWLDGKKCLRPMLAPNLYTLWR-ELER 135

Query: 349 YRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYV 408
             D P+R  E  T +R ES G  H    + +FT+ +   + TP +  +  +   D+ ++V
Sbjct: 136 LWDKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTPLE--ERHQRLEDMARWV 189

Query: 409 METLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFY 468
           +E  GI +      S          ++  +      +                      +
Sbjct: 190 LEAAGIREFELVTESSVVY---GDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGF 246

Query: 469 GPKLDIQFKNVHGKEDTIITIQIDFALAERF 499
           G +  +  +       ++    + +    R 
Sbjct: 247 GLERLLMIREGTQHVQSMAR-SLSYLDGVRL 276


>3bamA [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)
          Length = 206

 Score =  101 bits (252), Expect = 6e-24
 Identities = 17/173 (9%), Positives = 41/173 (23%), Gaps = 10/173 (5%)

Query: 239 RDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAK 298
           +       E               LL        +     ++ E+++ G +      +  
Sbjct: 43  KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIEN 102

Query: 299 SDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAE 358
           S+L ++   ++            +       L         AI        + L     +
Sbjct: 103 SELKRVGMEFETGNISSAHRSMNK-----LLLGLKHGEIDLAII---LMPIKQLAYYLTD 154

Query: 359 TSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMET 411
             T F          L   + F     +       +    K +  + K  ++ 
Sbjct: 155 RVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKK 205


>1e1oA [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
          Length = 484

 Score =  101 bits (251), Expect = 7e-24
 Identities = 39/401 (9%), Positives = 104/401 (25%), Gaps = 26/401 (6%)

Query: 136 RFELPRNEALELMKD--EPYKVELINDLPE-----GEVISFYQIGD--FVDLCAGPHLMA 186
             +  R+   + + +  +    + +  L       G +++   +G   FV L      + 
Sbjct: 26  PNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQ 85

Query: 187 VKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGR 246
           +   +   L                +    GT F  ++              +    L  
Sbjct: 86  LYVARD-SLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPD 144

Query: 247 ELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISG 306
           +   +     +         +   +   +   I      RG++  +TP+M        + 
Sbjct: 145 QEVRYR-QRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASAR 203

Query: 307 HWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNE 366
            +  + + + +        E++  R +   F+     +       + V   E + +    
Sbjct: 204 PFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVHNPEFTMMELYM 263

Query: 367 SSGEMHGLIR-VRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKW 425
           +  + H LI             V    ++               +     + +T R +  
Sbjct: 264 AYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHV--------FDFGKPFEKLTMREAI- 314

Query: 426 DPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDT 485
                +KY  + +  +       + L        E          ++  +    H  + T
Sbjct: 315 -----KKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPT 369

Query: 486 IITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYER 526
            IT                 +  ++   +I  R     +  
Sbjct: 370 FITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSE 410


>1b70A [d.104.1] PHENYLALANYL-TRNA SYNTHETASE
          Length = 265

 Score =  100 bits (249), Expect = 1e-23
 Identities = 38/277 (13%), Positives = 68/277 (24%), Gaps = 33/277 (11%)

Query: 260 GLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSD-----LYKISGHWDHYKDG 314
           G  L        I  ++R + +  +  GY   + P +         L     H       
Sbjct: 7   GASLFSGGL-HPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWD 65

Query: 315 MFVLGDE---------EKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRN 365
            F L  E         E+      LR  T P Q              P R      +FR 
Sbjct: 66  TFWLTGEGFRLEGPLGEEVEGRLLLRTHTSPMQVRY-----MVAHTPPFRIVVPGRVFRF 120

Query: 366 ESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKW 425
           E +           F   +G +V     +        +L + +             F   
Sbjct: 121 EQT----DATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYF--- 173

Query: 426 DPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDT 485
                E        W      +      +         +A      L   ++ V G    
Sbjct: 174 --PFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFG 231

Query: 486 IITIQIDFALAERFGMYYI-DKDGEKKRPYIIHRSSI 521
           +   ++      R+G+  I    G + +     +  +
Sbjct: 232 LGVERLA---MLRYGIPDIRYFFGGRLKFLEQFKGVL 265


>2du4A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 466

 Score = 97.4 bits (241), Expect = 1e-22
 Identities = 35/405 (8%), Positives = 82/405 (20%), Gaps = 52/405 (12%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLM 296
             +   ++  E             +     K    +    + + +     G+     PL+
Sbjct: 19  AWKAGKEILAERSPNEL----YPRVGFSFGKE-HPLFATIQRLREAYLSIGFSEVVNPLI 73

Query: 297 AKSDLYKISGHWDHYKDGMFVLGDEEKD--------SEVFALRPMTCPFQYAIYNSTQHS 348
            +    K     +                       S    LR         I  S    
Sbjct: 74  VEDVHVKKQFGREALAVLDRCFYLATLPKFKELKPISSTLTLRSHMTTGW-FITLSHIAD 132

Query: 349 YRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYV 408
              LP++       FR E         R+  +  A   +V     ++D       L++  
Sbjct: 133 KLPLPIKLFSIDRCFRREQGE---DATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQF 189

Query: 409 METLGIADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFY 468
                  ++  +R  +                 + + +                      
Sbjct: 190 GF-----ENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSST-------KYSDGWIEIAT 237

Query: 469 GPKLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTL 528
                      +     ++ + +                   +R  +I        +   
Sbjct: 238 FGIYSPTALAEYDIPYPVMNLGLGV-----------------ERLAMILYGYDDVRKMVY 280

Query: 529 AMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXAD----HRAEKI 584
             +  +   +       ++ K +P +      A                        E +
Sbjct: 281 PQIHGEIKLSDLDIAREIKVKEVPQTAVGLKIAQSIVETAEKHASEPSPCSFLAFEGEMM 340

Query: 585 GYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLAD 629
           G  +R   +E      +     A   EV V               
Sbjct: 341 GRNVRVYVVEEEENTKLC--GPAYANEVVVYKGDIYGIPKTKKWR 383


>2eiuD [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
          Length = 124

 Score = 96.8 bits (241), Expect = 2e-22
 Identities = 10/120 (8%), Positives = 24/120 (20%), Gaps = 7/120 (5%)

Query: 473 DIQFKNVHGKEDTII----TIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTL 528
           + + + V G           I +             +          +  +    +    
Sbjct: 6   EGKVEGVPGNYPLTAENLFRIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAG 65

Query: 529 AMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADHRAEKIG-YK 587
             +     G +  ++   +  VL                              E IG +K
Sbjct: 66  GSVNVGKGGDIKLFLQKGEIYVLEFQPLSETDIK--KLESILFGRAPIPKKTGEDIGSFK 123


>2bamA [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
          Length = 207

 Score = 95.8 bits (238), Expect = 3e-22
 Identities = 14/153 (9%), Positives = 40/153 (26%), Gaps = 13/153 (8%)

Query: 256 NVGQGLPLLMPKG-ARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDG 314
            + +    L+        +     ++ E+++ G +      +  S+L ++   ++     
Sbjct: 59  PIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETG--N 116

Query: 315 MFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGL 374
           +       +      L         AI        + L     +  T F          L
Sbjct: 117 ISS---AHRSMNKLLLGLKHGEIDLAIIL---MPIKQLAYYLTDRVTNFEELEPY--FEL 168

Query: 375 IRVRQFT--LADGHIVCTPEQLEDEFKNTVDLV 405
              + F     +     +   L  +  + +   
Sbjct: 169 TEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKR 201


>3dsqB [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
          Length = 282

 Score = 95.7 bits (237), Expect = 3e-22
 Identities = 39/268 (14%), Positives = 72/268 (26%), Gaps = 23/268 (8%)

Query: 205 GDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLL 264
                K+  +                       +       + +              L 
Sbjct: 11  SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGK-----RHLEQLR 65

Query: 265 MPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKD 324
             K    +  L+  +     ++G+V   TP +          H    +            
Sbjct: 66  TVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTHPLFSQVFWLD------- 118

Query: 325 SEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLAD 384
                LRPM  P  Y ++        D P+R  E  T +R ES     G   + +FT+ +
Sbjct: 119 -GKKCLRPMLAPNLYTLWRE-LERLWDKPIRIFEIGTCYRKESQ----GAQHLNEFTMLN 172

Query: 385 GHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAWENTQ 444
              + TP   E+  +   D+ ++V+E  GI +      S       +         E   
Sbjct: 173 LTELGTPL--EERHQRLEDMARWVLEAAGIREFELVTESSVVG---DTVDVMKGDLELAS 227

Query: 445 NIMREILNHLNIDFTEADDEAAFYGPKL 472
             M         +  +      F   +L
Sbjct: 228 GAMGPHFLDEKWEIFDPWVGLGFGLERL 255


>2du7A [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
          Length = 539

 Score = 94.9 bits (235), Expect = 6e-22
 Identities = 23/441 (5%), Positives = 76/441 (17%), Gaps = 55/441 (12%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLM 296
            +    +    +     D      L  +  K   +++T++R  +    R G+     P++
Sbjct: 16  FETAWRETRALIKDKHIDNK-YPRLKPVYGKPHPVMETIERLRQ-AYLRMGFEEMINPVI 73

Query: 297 AKSDLYKISGHWDHYKDGMFVLGDEEKD--------SEVFALRPMTCPFQYAIYNSTQHS 348
                       +                        +V  ++ +            +  
Sbjct: 74  VDEMEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREV 133

Query: 349 YRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYV 408
                    +   L    +           +            +           +    
Sbjct: 134 LHLYKKGAIDGDDLVFEIAKALNVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSGW 193

Query: 409 METLG-IADDITYRFSKWDPNNTEKYINDPEAWENTQNIMREI----------------- 450
             TL  +          +  +   +     +                             
Sbjct: 194 FITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVVVGEDVSVDDGKVVAE 253

Query: 451 -----LNHLNIDFTEADDEAAFYGPKLDIQ---FKNVHGKEDTIITI-QIDFALAERFGM 501
                       F   + ++ +Y P+   +   +    G+   + T          ++ +
Sbjct: 254 GLLAQFGFTKFKFKPDEKKSKYYTPETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNI 313

Query: 502 YYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADYA 561
                +       +            +    E     +       +     ++       
Sbjct: 314 DVPVMNLGLGVERLAM----------IIYGYEDVRAMVYPQFYEYRLSDRDIAGMIRVDK 363

Query: 562 NXXXXXXXXXXXXXXAD--------HRAEKIGYKIREARLERTPYILVVGEKEAENKEVS 613
                                            +      ER    + + E E   K + 
Sbjct: 364 VPILDEFYNFANELIDICIANKDKESPCSVEVKREFNFNGERRVIKVEIFENEPNKKLLG 423

Query: 614 VRSRKNGEEGAMPLADFVNRI 634
                        +       
Sbjct: 424 PSVLNEVYVYDGNIYGIPPTF 444


>2eiuE [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
          Length = 125

 Score = 91.0 bits (226), Expect = 8e-21
 Identities = 11/126 (8%), Positives = 25/126 (19%), Gaps = 10/126 (7%)

Query: 470 PKLDI---QFKNVHGKEDTII----TIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIG 522
           P +     + + V G           I +             +          +  +   
Sbjct: 1   PAIFTHEGKVEGVPGNYPLTAENLFRIGLALCTLWILDKEIEEPTLSIPETNFVTLALSV 60

Query: 523 CYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADYANXXXXXXXXXXXXXXADHRAE 582
            +      +     G +  ++   +  VL                              E
Sbjct: 61  GFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFQPLSETDIK--KLESILFGRAPIPKKTGE 118

Query: 583 KIG-YK 587
            IG +K
Sbjct: 119 DIGSFK 124


>2e3cA [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
          Length = 260

 Score = 90.7 bits (224), Expect = 1e-20
 Identities = 32/253 (12%), Positives = 75/253 (29%), Gaps = 27/253 (10%)

Query: 237 KKRDHNKLGRELGIFTTDENVGQGLPL-LMPKGARIIQTLQRWIEDEEQRRGYVLTKTPL 295
            +        E  + +  +     L      +    +  L+R I      RG++  K+P+
Sbjct: 20  DESGKPFRELESELLSRRKK---DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPI 76

Query: 296 MAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVR 355
           +   +  +  G  +  +          +  + F LRPM  P  Y        +    P++
Sbjct: 77  LIPLEYIERMGIDNDTELSKQ----IFRVDKNFCLRPMLAPNLYNYLRKLDRAL-PDPIK 131

Query: 356 FAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIA 415
             E    +R ES G+ H    + +FT+ +   + +    E+      D + ++     I 
Sbjct: 132 IFEIGPCYRKESDGKEH----LEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIV 187

Query: 416 DDITYRFSKW------------DPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADD 463
                                       ++  D         + R +    +    +   
Sbjct: 188 GVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAA 247

Query: 464 --EAAFYGPKLDI 474
              + + G   ++
Sbjct: 248 RSGSYYNGISTNL 260


>11asA [d.104.1] ASPARAGINE SYNTHETASE
          Length = 327

 Score = 90.1 bits (222), Expect = 2e-20
 Identities = 14/174 (8%), Positives = 37/174 (21%), Gaps = 12/174 (6%)

Query: 269 ARIIQTLQRWIEDEE-QRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEV 327
            R I  ++     +  +R G +  + P++++             K        +      
Sbjct: 6   QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQV--KVKALPDAQ 63

Query: 328 FALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHI 387
           F +      ++                         R +        +        D   
Sbjct: 64  FEVVHSLAKWKRQTLG---QHDFSAGEGLYTHMKALRPDEDR--LSPLHSVYVDQWDWER 118

Query: 388 V-CTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEAW 440
           V    E+     K     V+ +   +   +          P   ++        
Sbjct: 119 VMGDGERQFSTLK---STVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQE 169


>2d6fD [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
          Length = 522

 Score = 87.7 bits (216), Expect = 9e-20
 Identities = 24/331 (7%), Positives = 68/331 (20%), Gaps = 36/331 (10%)

Query: 175 FVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXX 234
             +L           I                + +      +      +           
Sbjct: 29  RTELTDSEPDH---DIVRNLRPTRAAFEEAMRKLHFHYENYHEETCLVE-----ADEEPP 80

Query: 235 XXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTP 294
                +  ++   + +      V +   +   +      T            G++ T   
Sbjct: 81  HPLNPEALEIAVTIALLLNMRVVDEFHTM-RKQVIDGSNTGGFQRTGLVATDGHLETPQG 139

Query: 295 LMAKSD--LYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDL 352
            +   +  L + +           V   +     +  +   T P             + L
Sbjct: 140 TVKIENLCLEEDAARRIRETGDGVVFRLDRLG--IPLVEITTDPS--------MSDPQQL 189

Query: 353 PVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHI-VCTPEQLEDEFKNTVDLVKYVMET 411
                +   + R+        + R       D +I +    ++E +    V  +  + E 
Sbjct: 190 REVAYQIGQILRST------RVKRGLGTIRQDLNISIRDGARVEVK---GVQDLDLIPEI 240

Query: 412 LGIAD-DITYRFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGP 470
           +              D       + + + ++              I  +     A     
Sbjct: 241 VEREVKRQLSLVEIRDTLQERGAVVEDKIFD---VSEVFADTESRIISSAESVLAVKLRG 297

Query: 471 KLDIQFKNVHGKEDTIITIQIDFALAERFGM 501
              +           + T   D+A       
Sbjct: 298 FDGL-IGVEIQPGRRLGTEMADYAKKRGVSG 327


>1bhmA [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
          Length = 198

 Score = 82.1 bits (201), Expect = 4e-18
 Identities = 17/195 (8%), Positives = 41/195 (21%), Gaps = 10/195 (5%)

Query: 203 WKGDEKNKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLP 262
           +  DE  ++LS+                        +       E               
Sbjct: 7   FITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYT 66

Query: 263 LLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEE 322
           LL        +     ++ E+++ G +      +  S+L ++   ++            +
Sbjct: 67  LLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNK 126

Query: 323 KDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMHGLIRVRQFTL 382
                  L                   + L     +  T F          L   + F  
Sbjct: 127 -----LLLGLKHGE---IDLAIILMPIKQLAYYLTDRVTNFEELEPY--FELTEGQPFIF 176

Query: 383 ADGHIVCTPEQLEDE 397
              +       +   
Sbjct: 177 IGFNAEAYNSNVPLI 191


>3d1tB [x.x.x] UPF0343 PROTEIN NGO0387
          Length = 235

 Score = 76.3 bits (187), Expect = 2e-16
 Identities = 29/251 (11%), Positives = 58/251 (23%), Gaps = 38/251 (15%)

Query: 209 NKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENV---GQGLPLLM 265
           N  +++V                                L                  L 
Sbjct: 1   NLPINQVGIKDLRFP---------ITLKTAEGTQSTVARLTTVYLPAEQKGTHSRFVALE 51

Query: 266 PKGA----RIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDE 321
                     +  L   +   + R G +    P   K      SG        + + G++
Sbjct: 52  QHTEVLDFAQLHRLTAEVALLDSRAGKISVSFPFFRKKTAPV-SGIRSLLDYDVSLTGEK 110

Query: 322 EKDSEVFALRPMT--CPFQYAIYNSTQHSYR---DLPVRFAETST------LFRNESSGE 370
           +       + P+T  CP    I     H+ R    + +                 ++S +
Sbjct: 111 DGAYGHSKVIPVTSLCPCSKEISQYGAHNQRSHVTVSLTSDAEVGIEEVIDYVETQASCQ 170

Query: 371 MHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNT 430
           ++GL++       D   V        +F    D+       +      ++        N 
Sbjct: 171 LYGLLK-----RPDEKYVTEKAYENPKFV--EDVRDVATSLIADKRIKSFVVES---ENF 220

Query: 431 EKYINDPEAWE 441
           E   N      
Sbjct: 221 ESIHNHSAYAY 231


>1b8aA [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
          Length = 438

 Score = 74.2 bits (180), Expect = 1e-15
 Identities = 26/271 (9%), Positives = 53/271 (19%), Gaps = 20/271 (7%)

Query: 307 HWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNE 366
              H    +    +   +               +     +        R  E + +FR E
Sbjct: 157 IEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAE 216

Query: 367 SSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWD 426
                  L            I       E+       LV + +  +   +        ++
Sbjct: 217 EHNTTRHLNEAWSIDSEMAFIED----EEEVMSFLERLVAHAINYVREHNAKELDILNFE 272

Query: 427 PNNT-------------EKYINDPEAWENTQNIMREILNHLNIDFTEADDEA---AFYGP 470
                            E   +  +     ++I  E    L     E ++      +  P
Sbjct: 273 LEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYP 332

Query: 471 KLDIQFKNVHGKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAM 530
                F  +       I    D             ++          +      E     
Sbjct: 333 SEAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFY 392

Query: 531 LIEKYAGALPTWIAPVQAKVLPLSDKYADYA 561
           L     G  P     + A+ L          
Sbjct: 393 LKAFRYGMPPHGGFGLGAERLIKQMLDLPNI 423


>2e1bA [x.x.x] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
          Length = 216

 Score = 70.8 bits (173), Expect = 1e-14
 Identities = 22/208 (10%), Positives = 46/208 (22%), Gaps = 40/208 (19%)

Query: 4   ITLKDGSIKEVEAG-LSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTF 62
           I    G  +  + G ++  E+                    V            +E+   
Sbjct: 36  IFYPTGGGQPHDRGTINGVEVLDVYKDE-------EGNVWHVVKEPEKFKVGDEVELKID 88

Query: 63  DSKEGQHAFNHTASHVLAAAVKRLFPQD--KLAIGPSIDNGFYYDFDTEKPFSADQLNXX 120
                +    HT  H+L   +  +  +   +L           YD    +  +       
Sbjct: 89  WDYRYKLMRIHTGLHLLEHVLNEVLGEGNWQLVGSGMSVEKGRYDIAYPENLN------- 141

Query: 121 XXXXXXXXXXXXXXXRFELPRNEALELMK-DEPYKVELINDLPEGEVISFYQIGDFVDLC 179
                            E   +   + +      K+       +            V  C
Sbjct: 142 --------------KYKEQIISLFNKYVDEGGEVKIWWE---GDRRYTQIRD--FEVIPC 182

Query: 180 AGPHLMA---VKPIKAVKLLRSTGAYWK 204
            G H+     +  IK +K         +
Sbjct: 183 GGTHVKDIKEIGHIKKLKRSSIGRGKQR 210


>3bjuB [x.x.x] LYSYL-TRNA SYNTHETASE
          Length = 495

 Score = 66.0 bits (159), Expect = 3e-13
 Identities = 33/359 (9%), Positives = 80/359 (22%), Gaps = 30/359 (8%)

Query: 265 MPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKD 324
           + +   I   +  +I       G++  +TP+M       ++  +  Y + +         
Sbjct: 161 VRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD-------- 212

Query: 325 SEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETSTLFRNESSGEMH-----GLIRVRQ 379
                   M    + A     +        R  E    FRNE     H            
Sbjct: 213 --------MNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMA 264

Query: 380 FTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPNNTEKYINDPEA 439
           +      +  T + +    K+     K      G            D     + IN  E 
Sbjct: 265 YADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAY----DVDFTPPFRRINMVEE 320

Query: 440 WENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDT-IITIQIDFALAER 498
            E    +     N    + T    +       ++        +    ++   ++      
Sbjct: 321 LEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINP 380

Query: 499 FGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYA 558
             +    +       +   +  +        M  E             Q ++     K  
Sbjct: 381 TFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAK 440

Query: 559 DYANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSR 617
              +                      G+ +   R+     + +      +   +    +
Sbjct: 441 AAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPAMK 495


>2e7gA [x.x.x] PUTATIVE RIBOSOME-BINDING FACTOR A
          Length = 129

 Score = 63.2 bits (154), Expect = 2e-12
 Identities = 12/140 (8%), Positives = 30/140 (21%), Gaps = 20/140 (14%)

Query: 149 KDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEK 208
           K++  ++  +N L    +         V        + +     V L             
Sbjct: 9   KEDHARLRALNGLLYKALTDLLC-TPEVSQELYDLNVELS---KVSL-----------TP 53

Query: 209 NKMLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKG 268
           +    R Y                         + L  +  +          +  +  KG
Sbjct: 54  DFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNV-----PPIVFVQDKG 108

Query: 269 ARIIQTLQRWIEDEEQRRGY 288
              +  L + +   +     
Sbjct: 109 NAALAELDQLLAVADSGPSS 128


>3c2wC [x.x.x] BACTERIOPHYTOCHROME
          Length = 482

 Score = 49.0 bits (115), Expect = 4e-08
 Identities = 10/86 (11%), Positives = 23/86 (26%), Gaps = 10/86 (11%)

Query: 324 DSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFA----------ETSTLFRNESSGEMHG 373
             +      + C     +      S R    R A              ++  ++ G+  G
Sbjct: 337 HPDDGIAALIPCDGALVMLGGRTLSIRGDFERQAGNVLQRLQRDPERDIYHTDNWGDCCG 396

Query: 374 LIRVRQFTLADGHIVCTPEQLEDEFK 399
           ++ +R      G I     +     +
Sbjct: 397 VLAIRFHRQESGWIFWFRHEEVHRIR 422


>2c7fB [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
          Length = 497

 Score = 36.1 bits (81), Expect = 3e-04
 Identities = 10/162 (6%), Positives = 29/162 (17%), Gaps = 2/162 (1%)

Query: 369 GEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITYRFSKWDPN 428
            E +                                   ++  + I         K    
Sbjct: 289 DEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACL 348

Query: 429 NTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIIT 488
                +  P   E                            P ++    +    ED    
Sbjct: 349 AQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDI 408

Query: 489 IQIDFALA--ERFGMYYIDKDGEKKRPYIIHRSSIGCYERTL 528
             +       E   ++ ++++  +    +     +   E  +
Sbjct: 409 ESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMRLLEHIV 450


>2ddzE [x.x.x] 190AA LONG HYPOTHETICAL PROTEIN
          Length = 190

 Score = 34.6 bits (79), Expect = 8e-04
 Identities = 13/123 (10%), Positives = 29/123 (23%), Gaps = 14/123 (11%)

Query: 427 PNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKL------DIQFKNVH 480
                  +      +     + E+L +  I+ +   D+    G KL              
Sbjct: 75  LFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLSISIATVSPVSIKI 134

Query: 481 GKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALP 540
                 I + +        G+  I  +     P      S       +  + +       
Sbjct: 135 H-----IGLNVKTVG-VPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKD--SLKV 186

Query: 541 TWI 543
            W+
Sbjct: 187 RWV 189


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.139    0.394 

Gapped
Lambda     K      H
   0.267   0.0470    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 27,693,608
Number of extensions: 1795429
Number of successful extensions: 21044
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 10214
Number of HSP's successfully gapped: 508
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)