RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAB80017.1 cper0 etfB.1 GIB00075CH01 "electron transfer
flavoprotein beta-subunit"
         (262 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01012 ETF "Electron transfer flavoprotein domain"                    76   6e-17

>PF01012 ETF "Electron transfer flavoprotein domain"
          Length = 157

 Score = 76.0 bits (186), Expect = 6e-17
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 6/145 (4%)

Query: 34  MNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVIKEAYSMGADEGTLVSDRKFAGAD 93
           +NP DL ALE A R+ EK GG +  +  GP +A A  + A +MGAD   LV D   AG D
Sbjct: 12  LNPVDLEALEEARRLAEKLGGEVTAVVAGPAEA-AEARTALAMGADRVVLVEDPALAGYD 70

Query: 94  VLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPHVANVRRILDVNDD 153
             A +  L+  +KK    D++L G      D   +GP +A  LG+P   +V + L+++D 
Sbjct: 71  PEAYAKALAALIKK-EKPDLVLLGATAIGRD---LGPRLAARLGVPQATDVTK-LEIDDG 125

Query: 154 FIKVEMDMPNTIEVLEVKYPCLLTV 178
            + V   +    E   VK P ++TV
Sbjct: 126 KLTVTRPIYGGNETATVKLPAVITV 150


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.329    0.144    0.401 

Gapped
Lambda     K      H
   0.267   0.0551    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,428,836
Number of extensions: 937114
Number of successful extensions: 127373
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2899
Number of HSP's successfully gapped: 239
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)