RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAB81731.1 cper0 CPE2025 GIB00075CH01 "conserved hypothetical
protein"
         (434 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00919 UPF0004 "Uncharacterized protein family UPF0004"               61   3e-12
PF04055 Radical_SAM "Radical SAM superfamily"                          53   7e-10

>PF00919 UPF0004 "Uncharacterized protein family UPF0004"
          Length = 97

 Score = 60.9 bits (147), Expect = 3e-12
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 3  VAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGR 62
          + F T GC +N+ +SE M       GY+ V   E AD+ +VNTC+V N  ++K + IIG 
Sbjct: 2  IYFKTFGCAMNSSDSEFMMGLLSNYGYQFVKNIEDADIVIVNTCTVRNPAEEKMKTIIGY 61

Query: 63 ARRQN-PEAIIAVVGCYAQIAPTEVSGIEGVDVV 95
              N P   I V GC AQ    E+     VD+V
Sbjct: 62 VNNLNKPRIKIIVCGCVAQAEGDEILKRAPVDLV 95


>PF04055 Radical_SAM "Radical SAM superfamily"
          Length = 164

 Score = 53.1 bits (127), Expect = 7e-10
 Identities = 56/169 (33%), Positives = 80/169 (47%), Gaps = 26/169 (15%)

Query: 146 LKIQDGCNRFCAYCLIPYT--RGSVCSKDPKKVLDEIRSL-AEHGFKEIILSGIHTASYG 202
           L +  GCN  C +C  P T  RG   S   +++L+E+  L AE G KE+IL G     Y 
Sbjct: 1   LVVTRGCNLRCTFCDNPETELRGFGRSLSVEEILEELEELGAELGVKEVILGGGEPLLYP 60

Query: 203 VDLDEKVTLVDLLEEIEKIDGIERVRI-----GSI-DPTFFTEDVVRRILALKKLCPHFH 256
                    V+LL  + K D +  +RI     G++ DP    E      L L +L     
Sbjct: 61  -------DFVELLLRLAKED-LPGIRITLETNGTLPDPELLDELAE---LGLDRLA---- 105

Query: 257 LSLQSGCDATLKRMNRRYTAKEYEDIVNLLRDKIEDVSITTDVIVGFPG 305
           + LQS  D  LK +NR +T +E  + + LLR+      + T +IVG PG
Sbjct: 106 IGLQSLDDEVLKAINRGHTLEEILEAIELLRE--AGFKVVTHLIVGLPG 152


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0559    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 10,747,144
Number of extensions: 564088
Number of successful extensions: 83090
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1808
Number of HSP's successfully gapped: 242
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)