RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAB81914.1 cper0 ctrA GIB00075CH01 "CTP synthase"
         (535 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF06418 CTP_synth_N "CTP synthase N-terminus"                         373   e-106
PF00117 GATase "Glutamine amidotransferase class-I"                    96   3e-23
PF07722 Peptidase_C26 "Peptidase C26"                                  48   1e-08
PF07685 GATase_3 "CobB/CobQ-like glutamine amidotransferase domain"    37   2e-05

>PF06418 CTP_synth_N "CTP synthase N-terminus"
          Length = 274

 Score =  373 bits (958), Expect = e-106
 Identities = 179/272 (65%), Positives = 214/272 (78%)

Query: 5   TKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFV 64
           TKY+FVTGGVVSSLGKGITAASLG LLK RGL V+  K DPYLN+DPGTMSPYQHGEVFV
Sbjct: 1   TKYIFVTGGVVSSLGKGITAASLGALLKARGLKVTSIKIDPYLNVDPGTMSPYQHGEVFV 60

Query: 65  TDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNA 124
           TDDGAETDLDLGHYERF+D  LT+++N+T+G++Y SVI KER+G+YLG TVQVIPHIT+ 
Sbjct: 61  TDDGAETDLDLGHYERFLDIKLTRDNNITTGKIYSSVIEKERRGDYLGKTVQVIPHITDE 120

Query: 125 IKDRVHRVGKERDXXXXXXXXXXXXXXXXSLPFLEAIRQIKYDVGKENVCFIHVTLVPYL 184
           IK+R+ RV KE +                SLPFLEAIRQ++++VG+EN  FIHVTLVPY+
Sbjct: 121 IKERIERVAKEGEPDVCIIEIGGTVGDIESLPFLEAIRQLRFEVGRENFLFIHVTLVPYI 180

Query: 185 GKAGELKTKPTQHSVKELRSIGIQPDIIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLD 244
             AGE KTKPTQHSVKELRSIGIQPDI+VCRSE+ L E+ K+KI LFCN+    VI   D
Sbjct: 181 AAAGEQKTKPTQHSVKELRSIGIQPDILVCRSERPLPEETKEKIALFCNVPEEAVISAHD 240

Query: 245 AEHLYAVPLMLHKEGLDRLVCEKLGLGCRDID 276
            + +Y VPL+L ++GLD  V E+LGL   + D
Sbjct: 241 VDSIYEVPLLLEEQGLDDYVLERLGLDAPEPD 272


>PF00117 GATase "Glutamine amidotransferase class-I"
          Length = 185

 Score = 95.9 bits (238), Expect = 3e-23
 Identities = 78/225 (34%), Positives = 101/225 (44%), Gaps = 46/225 (20%)

Query: 305 LHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRG-V 363
           L DAY S  E L       +   E+E +  +    + ++ LL   DG+LV GG G  G +
Sbjct: 2   LIDAYDSFTENLARA--LRELGAEVEVVPNDS---DALEILLLNPDGILVSGGPGSPGDI 56

Query: 364 EGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPE 423
           EGKIEAI++AREN  P LGICLGMQ     +   V+  +  H                  
Sbjct: 57  EGKIEAIKYARENGVPVLGICLGMQLLAEAFGGKVVKAKVPHH----------------- 99

Query: 424 QKDVEDLGGTMRLGLYPCKLEDNTFCKDVYA-SDLIYERHRHRYEFNNEYRTQLIESGLT 482
                  GG MRLG     L         Y   ++ Y RHRH YE N       +  GL 
Sbjct: 100 -------GGNMRLGHDGSPL--------FYGLPEVFYVRHRHSYEVNP------LPEGLE 138

Query: 483 IAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGF 527
           +  TS DG  +  +  KD+P+F  VQ+HPE  S P   H LF  F
Sbjct: 139 VLATSEDGGTIMAIVHKDNPFF-GVQFHPESSSTPGGLHLLFNFF 182


>PF07722 Peptidase_C26 "Peptidase C26"
          Length = 214

 Score = 47.7 bits (113), Expect = 1e-08
 Identities = 51/193 (26%), Positives = 90/193 (46%), Gaps = 44/193 (22%)

Query: 339 KENVDELLSGVDGVLVPGG-------FGDR------GVEGKIEA-----IRWARENKKPF 380
           +E+++ELL  +DG+L+ GG       +G+        ++ + +A     IR A E   P 
Sbjct: 47  EEDLEELLELLDGLLLTGGADVDPSLYGEEPHPPSGAIDPERDAFELALIRAALERGIPV 106

Query: 381 LGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYP 440
           LGIC GMQ   +        L G    ++ P+ P     L+  ++  +D G +  + + P
Sbjct: 107 LGICRGMQLLNV-------ALGGTLYQDI-PDQP----GLLDHREHPQD-GPSHEVRIEP 153

Query: 441 CKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKD 500
             L      + + A +++     H+         + +  GL +  T+PDG L+E +E  D
Sbjct: 154 GSL----LARLLGAEEIMVNSLHHQA-------IKRLGPGLRVEATAPDG-LIEAIESPD 201

Query: 501 HPWFV-AVQYHPE 512
            P+F+  VQ+HPE
Sbjct: 202 APYFILGVQWHPE 214


>PF07685 GATase_3 "CobB/CobQ-like glutamine amidotransferase domain"
          Length = 151

 Score = 36.5 bits (84), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 343 DELLSGVDGVLVPGGFG---DRGV---EGKIEAIRWARENKKPFLGICLGMQ 388
           DELL   D V++PGGF    D  +    G +EAIR   E   P LGIC G Q
Sbjct: 2   DELLPDADLVVLPGGFSYLDDLALARNSGLMEAIREFAEKGGPVLGICGGFQ 53


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0524    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 19,295,597
Number of extensions: 1104904
Number of successful extensions: 143749
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2410
Number of HSP's successfully gapped: 212
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)