RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= BAB81922.1 cper0 CPE2216 GIB00075CH01 "conserved hypothetical
protein"
         (78 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF06257 DUF1021 "Protein of unknown function (DUF1021)"                67   1e-14

>PF06257 DUF1021 "Protein of unknown function (DUF1021)"
          Length = 76

 Score = 67.4 bits (164), Expect = 1e-14
 Identities = 39/72 (54%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 7  LNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRL--QKDTQRKVTYSY 64
          L  I+K ++ HVG++V+L+ANGGRKK +E EG+L   +PS+FVV L  ++D   +V+YSY
Sbjct: 5  LKEIKKDLDAHVGQRVELKANGGRKKTVEREGVLIETYPSVFVVELDDEEDNFYRVSYSY 64

Query: 65 SDVLTKTVQLDF 76
          SDVLT+TV+L F
Sbjct: 65 SDVLTETVELTF 76


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.316    0.133    0.354 

Gapped
Lambda     K      H
   0.267   0.0537    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 12,875,864
Number of extensions: 720452
Number of successful extensions: 88177
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1981
Number of HSP's successfully gapped: 238
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)