RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAB80503.1 cper0 CPE0797 GIB00075CH01 "conserved hypothetical
protein"
         (193 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ayrA1 [b.1.18.11] ARRESTIN A:1 -- 182                                 53   3e-10
1d2tA [a.111.1.1] ACID PHOSPHATASE                                     50   3e-09

>1ayrA1 [b.1.18.11] ARRESTIN A:1 -- 182
          Length = 182

 Score = 53.1 bits (127), Expect = 3e-10
 Identities = 13/104 (12%), Positives = 26/104 (25%), Gaps = 17/104 (16%)

Query: 102 SSFPSGHSVGSMSIALGL-------NRYNKALGTICVIL----SILMGISRVYVGHHYPQ 150
             F       S++I LG         R     G + V         + +S      +  +
Sbjct: 11  VIFKKISRDKSVTIYLGKRDYIDHVERVEPVDGVVLVDPELVKGKRVYVSLTCAFRYGQE 70

Query: 151 HVVASFLI-VIILNVLYMKFLSKSVQKLYFSIEKHIPILNKLVK 193
            +    L     L    ++           +      +   L+K
Sbjct: 71  DIDVMGLSFRRDLYFSQVQVFP-----PVGASGATTRLQESLIK 109


>1d2tA [a.111.1.1] ACID PHOSPHATASE
          Length = 222

 Score = 49.5 bits (118), Expect = 3e-09
 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 12/89 (13%)

Query: 79  FFYAPRPFV--NDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLN-----RYNKALGTICV 131
            +   RPF                + S+PSGH+    + AL L      R N+ L     
Sbjct: 111 HYMRIRPFAFYGVSTCNTQDKLSKNGSYPSGHTSIGWATALVLAEINPQRQNEILKR--- 167

Query: 132 ILSILMGISRVYVGHHYPQHVVASFLIVI 160
                +G SRV  G+H+   V A+ ++  
Sbjct: 168 --GYELGQSRVICGYHWQSDVDAARVVGS 194


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.140    0.405 

Gapped
Lambda     K      H
   0.267   0.0605    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 14,390,480
Number of extensions: 1105563
Number of successful extensions: 5582
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 5290
Number of HSP's successfully gapped: 238
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)