RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAB81009.1 cper0 pgk GIB00075CH01 "phosphoglycerate kinase"
         (397 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

13pkA [c.86.1.1] 3-PHOSPHOGLYCERATE KINASE                            529   e-153
1k8tA [e.41.1.1] CALMODULIN-SENSITIVE ADENYLATE CYCLASE               248   8e-69
1zczA2 [c.97.1.4] BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH ...   165   6e-44
1puzA [a.218.1.1] CONSERVED HYPOTHETICAL PROTEIN                       87   3e-20
1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:...    68   2e-14
1ywuA1 [b.45.2.1] HYPOTHETICAL PROTEIN PA4608 A:1 -- 125               48   2e-08
1v8hA1 [b.1.18.19] SULFUR OXIDATION PROTEIN SOXZ A:2 -- 107            40   4e-06
1umgA [d.280.1.1] 385AA LONG CONSERVED HYPOTHETICAL PROTEIN            34   4e-04

>13pkA [c.86.1.1] 3-PHOSPHOGLYCERATE KINASE
          Length = 415

 Score =  529 bits (1365), Expect = e-153
 Identities = 199/418 (47%), Positives = 273/418 (65%), Gaps = 29/418 (6%)

Query: 5   KKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGK 64
           KK+I +  +KGKKVL+R DFNVP+K+G IT++ R+  A+PT+K ++  G   +L SH+G+
Sbjct: 2   KKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGR 61

Query: 65  PKGEA----------------KPEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVA 108
           PKG                  + + +L PVAKRLSE+L + V FA D      NA   V+
Sbjct: 62  PKGIPMAQAGKIRSTGGVPGFQQKATLKPVAKRLSELLLRPVTFAPD----CLNAADVVS 117

Query: 109 EMKDGDVVLLQNTRYRKEET----KNGXXXXXXXXXXXXMFVNDAFGTAHRAHCSTVGVT 164
           +M  GDVVLL+N R+ KEE     K+             ++++DAFGTAHR   +  G+ 
Sbjct: 118 KMSPGDVVLLENVRFYKEEGSKKAKDREAMAKILASYGDVYISDAFGTAHRDSATMTGIP 177

Query: 165 EYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGG 224
           + L     GYL++KE+ +    +  P RP VAI+GGAKVSDKI +++N+L+++D L+IGG
Sbjct: 178 KILGNGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGG 237

Query: 225 GMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDVE-AV 283
            MAYTFLKAQGY++G S  EE K+E+A+ +L KAE++ V+++LP+DH    EFK V+  +
Sbjct: 238 AMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAVDSPL 297

Query: 284 VTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMA 343
           +TEDQNI EG M LDIGPKT   Y + I   K+ IWNGPMGVFE   ++KGT A+AKAM 
Sbjct: 298 ITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMG 357

Query: 344 EA----DATTIIGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK 397
                    +IIGGGDSA+A  + G   +MSH+STGGGASLE LEGK LPG+  L+DK
Sbjct: 358 RGTHEHGLMSIIGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK 415


>1k8tA [e.41.1.1] CALMODULIN-SENSITIVE ADENYLATE CYCLASE
          Length = 498

 Score =  248 bits (634), Expect = 8e-69
 Identities = 43/423 (10%), Positives = 91/423 (21%), Gaps = 70/423 (16%)

Query: 13  VKGKKVLVRCDFNVPLKD--GVITDENRLN----GAMPTIKYLVDNGAKVILCSHMGKPK 66
           +KG+K L          D    I  E                L+ +G      +  GK  
Sbjct: 6   LKGEKALKASGLVPEHADAFKKIARELNTYILFRPVNKLATNLIKSGVATKGLNVHGKSS 65

Query: 67  GEAK--------PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVL- 117
                        + S     +   E    E   +           K   ++    +   
Sbjct: 66  DWGPVAGYIPFDQDLSKKHGQQLAVEKGNLENKKSIT--EHEGEIGKIPLKLDHLRIEEL 123

Query: 118 LQNTRYRKEETKN----GXXXXXXXXXXXXMFVNDAFGTAH--RAHCSTVGVTEYLKPAV 171
            +N    K + +                    ++D                + E      
Sbjct: 124 KENGIILKGKKEIDNGKKYYLLESNNQVYEFRISDENNEVQYKTKEGKITVLGEKF-NWR 182

Query: 172 CGYLIQKELKFLGDAVET-------------------PERPFVAILGGAKVSDKINVINN 212
              ++ K ++ +   +                      +     +     +  +  V N 
Sbjct: 183 NIEVMAKNVEGVLKPLTADYDLFALAPSLTEIKKQIPQKEWDKVVNTPNSLEKQKGVTNL 242

Query: 213 LLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHR 272
           L++    +          L      +   L E  K                         
Sbjct: 243 LIK--YGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGDVVNHGTNEI-------- 292

Query: 273 VAKEFKDVEAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFN 332
                              EG   L    +    + E     K  ++       +    N
Sbjct: 293 --------------FIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYNKIAPGN 338

Query: 333 KGTIAVAKAMAEADATTIIGGGDSAAAVNILGFGDKM-SHISTGGGASLEFLEGKVLPGI 391
           K  I     + +A   TI    +    ++ +     +  +  +G     EF + + +  I
Sbjct: 339 KAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSGDKD--EFAKKESVKKI 396

Query: 392 AAL 394
           A  
Sbjct: 397 AGY 399


>1zczA2 [c.97.1.4] BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
           A:158 -- 452
          Length = 295

 Score =  165 bits (420), Expect = 6e-44
 Identities = 49/275 (17%), Positives = 83/275 (30%), Gaps = 28/275 (10%)

Query: 124 RKEETKNGXXXXXXXXXXXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFL 183
             +                 ++   AF   H     +      +  A   + + K L  +
Sbjct: 4   AFKREDLQLRYGENPHEKAFVYGKPAFEILHEGKTISFN---NILDAENAWFMAKNLPRM 60

Query: 184 GDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLV 243
           G  V   + P  A +G     DK+ ++   +E  D    GG +A  F       V  SL 
Sbjct: 61  GAVVVKHQSPCGAAIG----EDKVEIVKKAIEADDESSFGGILAVNF--EMDEEVAKSLK 114

Query: 244 EEDKVEYAKEMLAKAEE----KGVKLLLPVDHRVAKEFKDVEAVVTEDQNIAEGFMGLDI 299
           +  +V  A     +A E    K V+LL P D+          ++V  ++   EG    + 
Sbjct: 115 KYLEVIVAPSFTQEAIEVLSKKKVRLLKPGDYASWAGKMAFGSLVLSERKYPEG----NF 170

Query: 300 GPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTIIGGGDSAAA 359
                   +E   +     +             +G  + A  +A+   T  IG G  +  
Sbjct: 171 ELVVGEPLSEKELEDLEFAYRVV----------EGAKSNAVLIAKDGVTVGIGSGQPSRK 220

Query: 360 VNILGFGDKMSHISTGGG-ASLEFLEGKVLPGIAA 393
                        + G   AS  F        I A
Sbjct: 221 RAAWIATVMAGEKAKGAVAASDAFFPFPDSLEILA 255


>1puzA [a.218.1.1] CONSERVED HYPOTHETICAL PROTEIN
          Length = 82

 Score = 87.2 bits (216), Expect = 3e-20
 Identities = 14/66 (21%), Positives = 28/66 (42%), Gaps = 1/66 (1%)

Query: 153 AHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVINN 212
             R       +          +L  KEL    + +E  ++  +A++ G   +DK ++I  
Sbjct: 16  TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLI-P 74

Query: 213 LLEKVD 218
           +LEK+ 
Sbjct: 75  MLEKIR 80


>1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:54
           -- 350
          Length = 291

 Score = 68.3 bits (165), Expect = 2e-14
 Identities = 24/192 (12%), Positives = 52/192 (27%), Gaps = 21/192 (10%)

Query: 19  LVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAKPEFSLAPV 78
             +      L   + T +  +   +  ++  +       L  H+  P     P F   P 
Sbjct: 34  NEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVPNFVRKPD 93

Query: 79  AKRLSEMLGKEVVFAADDNVVGENAKKAVAEM-KDGDVVLLQNTRYRKEETKNGXXXXXX 137
           A  +  +     V             + ++++   G VV   ++    +E K        
Sbjct: 94  AALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKA------- 146

Query: 138 XXXXXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFL-----GDAVETPER 192
                  F        H  +          +P + G ++ +   +      G  V+    
Sbjct: 147 ------GFRAGITFATHLYNAMPYI--TGREPGLAGAILDEADIYCGIIADGLHVDYANI 198

Query: 193 PFVAILGGAKVS 204
                L G K+ 
Sbjct: 199 RNAKRLKGDKLC 210


>1ywuA1 [b.45.2.1] HYPOTHETICAL PROTEIN PA4608 A:1 -- 125
          Length = 125

 Score = 47.7 bits (113), Expect = 2e-08
 Identities = 13/87 (14%), Positives = 23/87 (26%), Gaps = 7/87 (8%)

Query: 12 QVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAKP 71
          Q   ++   R  F+   +   I    R       +  +  +G  V               
Sbjct: 4  QHDERRRFHRIAFDADSE---ILQGERRWEV--LLHDVSLHGILVGQPQDWNGDPQRPF- 57

Query: 72 EFSLAPVAKRLSEMLGKEVVFAADDNV 98
          E  L      L  M    + +A D  +
Sbjct: 58 EARLYLGLDVLIRMEI-SLAWARDGLL 83


>1v8hA1 [b.1.18.19] SULFUR OXIDATION PROTEIN SOXZ A:2 -- 107
          Length = 106

 Score = 40.4 bits (94), Expect = 4e-06
 Identities = 7/87 (8%), Positives = 11/87 (12%), Gaps = 15/87 (17%)

Query: 100 GENAKKAVAEMKDGDVVLLQNTRYRKEETKNG---------------XXXXXXXXXXXXM 144
              A+   A+ K G+   LQ       E                                
Sbjct: 3   RTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRRDAEGKLIPAKYINLVEVYFEGEKVAEA 62

Query: 145 FVNDAFGTAHRAHCSTVGVTEYLKPAV 171
               +                      
Sbjct: 63  RPGPSTSANPLYAFKFKAEKAGTFTIK 89


>1umgA [d.280.1.1] 385AA LONG CONSERVED HYPOTHETICAL PROTEIN
          Length = 359

 Score = 33.7 bits (77), Expect = 4e-04
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 238 VGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDH 271
            G  +V  D +  A ++LA A+E+G+ L   + H
Sbjct: 15  AGHHIVHPDTMAAANKVLASAKEQGIILDYYITH 48


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.139    0.394 

Gapped
Lambda     K      H
   0.267   0.0540    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 17,670,907
Number of extensions: 1304804
Number of successful extensions: 6000
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 5741
Number of HSP's successfully gapped: 229
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)