RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= BAB81914.1 cper0 ctrA GIB00075CH01 "CTP synthase"
         (535 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1s1mA1 [c.23.16.1] CTP SYNTHASE A:287 -- 544                          370   e-105
1s1mA2 [c.37.1.10] CTP SYNTHASE A:1 -- 266                            288   1e-80
1j5sA [c.1.9.8] URONATE ISOMERASE                                     225   9e-62
1fp4B [c.92.2.3] NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN       166   5e-44
2oynA1 [b.43.5.2] HYPOTHETICAL PROTEIN MJ0056 A:1 -- 136              130   4e-33
1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:...   121   2e-30
1l9xA [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE                            119   9e-30
1fy2A [c.23.16.4] ASPARTYL DIPEPTIDASE                                113   4e-28
1i1qB [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II                  110   4e-27
1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT ...   107   4e-26
1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207                          106   8e-26
1aa7A [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN                       100   4e-24
1gpwB [c.23.16.1] AMIDOTRANSFERASE HISH                               100   4e-24
1o1yA [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158                97   4e-23
1q7rA [c.23.16.1] PREDICTED AMIDOTRANSFERASE                           96   7e-23
1qdlB [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))       93   6e-22
1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A...    87   3e-20
1ei5A2 [b.61.3.1] D-AMINOPEPTIDASE A:418 -- 520                        83   8e-19
1ka9H [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE               75   2e-16
2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297        71   3e-15
1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736                             70   5e-15
1j42A [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT               68   3e-14
1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN) ...    50   5e-09
1suwA [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE       43   8e-07
1q32A2 [d.136.1.3] TYROSYL-DNA PHOSPHODIESTERASE A:302 -- 538          36   1e-04
2fexA1 [c.23.16.2] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 188           35   2e-04
1g8mA2 [c.97.1.4] AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE A:201 ...    34   4e-04
1g2iA [c.23.16.2] PROTEASE I                                           33   0.001

>1s1mA1 [c.23.16.1] CTP SYNTHASE A:287 -- 544
          Length = 248

 Score =  370 bits (951), Expect = e-105
 Identities = 126/241 (52%), Positives = 165/241 (68%), Gaps = 1/241 (0%)

Query: 295 KIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLV 354
            I +VGKY+EL DAY SV+EAL HGGL N  +V I+ I+++DV    V E+L G+D +LV
Sbjct: 5   TIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGV-EILKGLDAILV 63

Query: 355 PGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETP 414
           PGGFG RGVEG I   R+AREN  P+LGICLGMQ A+I+YAR+V  +E A+S+E  P+  
Sbjct: 64  PGGFGYRGVEGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCK 123

Query: 415 FPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRT 474
           +PV+ L+ E +D      TMRLG   C+L D++  + +Y +  I ERHRHRYE NN    
Sbjct: 124 YPVVALITEWRDENGNVETMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLK 183

Query: 475 QLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNN 534
           Q+ ++GL +AG S D +LVE +EV +HPWFVA Q+HPE  S P   HPLF GFV AA   
Sbjct: 184 QIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEF 243

Query: 535 K 535
           +
Sbjct: 244 Q 244


>1s1mA2 [c.37.1.10] CTP SYNTHASE A:1 -- 266
          Length = 266

 Score =  288 bits (737), Expect = 1e-80
 Identities = 153/266 (57%), Positives = 198/266 (74%), Gaps = 2/266 (0%)

Query: 5   TKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFV 64
           T Y+FVTGGVVSSLGKGI AASL  +L+ RGL+V+I K DPY+N+DPGTMSP QHGEVFV
Sbjct: 3   TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFV 62

Query: 65  TDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNA 124
           T+DGAETDLDLGHYERFI   +++ +N T+GR+Y  V+ KER+G+YLG TVQVIPHITNA
Sbjct: 63  TEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNA 122

Query: 125 IKDRVHRVGKERDXXXXXXXXXXXXXXXXSLPFLEAIRQIKYDVGKENVCFIHVTLVPYL 184
           IK+RV   G+  D                SLPFLEAIRQ+  ++G+E+  F+H+TLVPY+
Sbjct: 123 IKERVLEGGEGHD--VVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYM 180

Query: 185 GKAGELKTKPTQHSVKELRSIGIQPDIIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLD 244
             +GE+KTKPTQHSVKEL SIGIQPDI++CRS++ +  + + KI LFCN+    VI   D
Sbjct: 181 AASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKD 240

Query: 245 AEHLYAVPLMLHKEGLDRLVCEKLGL 270
            + +Y +P +L  +GLD  +C++  L
Sbjct: 241 VDSIYKIPGLLKSQGLDDYICKRFSL 266


>1j5sA [c.1.9.8] URONATE ISOMERASE
          Length = 451

 Score =  225 bits (574), Expect = 9e-62
 Identities = 38/397 (9%), Positives = 80/397 (20%), Gaps = 37/397 (9%)

Query: 161 IRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQ----PDIIVCRS 216
                      +  +I  +           K  P          I +      +I    S
Sbjct: 58  YVWELMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIKKVIS 117

Query: 217 EK---ELSEDIKKK------IGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEK 267
           E+   E+ E+ KKK        L  ++    +    D            +      +   
Sbjct: 118 EETAEEIWEETKKKLPEMTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPT 177

Query: 268 LGL-GCRDIDNAEWIDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTN 326
                  ++D   W + V ++                   +A     E     G    ++
Sbjct: 178 WRPDRAMNVDKEGWREYVEKMGERY----GEDTSTLDGFLNALWKSHEHFKEHGC-VASD 232

Query: 327 VEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRGVEGKIE---AIRWARENKKPFLGI 383
             +   +   V +     +                  +  +           N    L I
Sbjct: 233 HALLEPSVYYVDENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHI 292

Query: 384 CLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTM------RLG 437
                     +        G   S         +   + E      +   +         
Sbjct: 293 GALRDYRDSLFKTLGPDS-GGDISTNFLRIAEGLRYFLNEFDGKLKIVLYVLDPTHLPTI 351

Query: 438 LYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVE 497
               +   N +      +   +       E + +Y   +        G   D R +    
Sbjct: 352 STIARAFPNVY----VGAPWWFNDSPFGMEMHLKYLASVDLLYNLA-GMVTDSRKLL-SF 405

Query: 498 VKDHPWF--VAVQYHPELKSRPNRPHPLFVGFVGAAL 532
                 F  V      E+  +   P       V    
Sbjct: 406 GSRTEMFRRVLSNVVGEMVEKGQIPIKEARELVKHVS 442


>1fp4B [c.92.2.3] NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
          Length = 522

 Score =  166 bits (421), Expect = 5e-44
 Identities = 41/457 (8%), Positives = 104/457 (22%), Gaps = 48/457 (10%)

Query: 19  GKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHY 78
                 A L  L   + +                    ++     V+D   E     G  
Sbjct: 68  ACQPLGAVLCALGFEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDAAVFGGQ 127

Query: 79  ERFIDENLTQ--------------NSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNA 124
           +   D                         G    + I+  +K  ++     V    T +
Sbjct: 128 QNMKDGLQNCKATYKPDMIAVSTTCMAEVIGDDLNAFINNSKKEGFIPDEFPVPFAHTPS 187

Query: 125 IKDRVHRV---------------GKERDXXXXXXXXXXXXXXXXSLPFLEAIRQIKYDVG 169
                                    +                   L     I+++  ++G
Sbjct: 188 FVGSHVTGWDNMFEGIARYFTLKSMDDKVVGSNKKINIVPGFETYLGNFRVIKRMLSEMG 247

Query: 170 KENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPDII-VCRSEKELSEDIKKKI 228
                      V      G+ +      + +E++      + + +     E ++   +  
Sbjct: 248 VGYSLLSDPEEVLDTPADGQFRMYAGGTTQEEMKDAPNALNTVLLQPWHLEKTKKFVEGT 307

Query: 229 GLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEWIDMVHRIT 288
                   +  +     +        +  + +   + ++ G     +   +    +H   
Sbjct: 308 WKHEVPKLNIPMGLDWTDEFLMKVSEISGQPIPASLTKERGRLVDMMT--DSHTWLHGKR 365

Query: 289 HLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINA----------EDVT 338
                    ++G    L +     V  L H G           + A              
Sbjct: 366 FALWGDPDFVMGLVKFLLELGCEPVHILCHNGNKRWKKAVDAILAASPYGKNATVYIGKD 425

Query: 339 KENVDELLSGVDGVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNV 398
             ++  L+       + G    + ++         +E + P + I   +      +    
Sbjct: 426 LWHLRSLVFTDKPDFMIGNSYGKFIQRDTLH--KGKEFEVPLIRIGFPIFDRHHLHRSTT 483

Query: 399 LGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMR 435
           LG EGA            +++ + E+        T  
Sbjct: 484 LGYEGAMQILTTLVN--SILERLDEETRGM--QATDY 516


>2oynA1 [b.43.5.2] HYPOTHETICAL PROTEIN MJ0056 A:1 -- 136
          Length = 136

 Score =  130 bits (328), Expect = 4e-33
 Identities = 20/134 (14%), Positives = 46/134 (34%), Gaps = 22/134 (16%)

Query: 5   TKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPY---LNIDPGTMSPYQ--- 58
            K + + G VVS LG+G    SL      + +   I  F+PY   LN+            
Sbjct: 2   VKLMIIEGEVVSGLGEGRYFLSLPPY---KEIFKKILGFEPYEGTLNLKLDREFDINKFK 58

Query: 59  --HGEVFVTDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQ 116
               E F  +      + +          L     + + ++  +++  ++   +    ++
Sbjct: 59  YIETEDFEFNGKRFFGVKV----------LPIKILIGNKKIDGAIVVPKKTY-HSSEIIE 107

Query: 117 VIPHITNAIKDRVH 130
           +I  +    +  + 
Sbjct: 108 IIAPMKLREQFNLK 121


>1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
           A:1034 -- 1295
          Length = 262

 Score =  121 bits (303), Expect = 2e-30
 Identities = 27/256 (10%), Positives = 61/256 (23%), Gaps = 26/256 (10%)

Query: 291 THTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD 350
               K+A++ +     ++++ +  A +  G       +   ++  D+        L    
Sbjct: 4   GARPKVAVLREQGV--NSHVEMAAAFHRAG------FDAIDVHMSDLLGG--RIGLGNFH 53

Query: 351 GVLVPGGFGDRGVEGKIEA---------------IRWARENKKPFLGICLGMQCAVIEYA 395
            ++  GGF    V G  E                  +    +   LG+  G Q       
Sbjct: 54  ALVACGGFSYGDVLGAGEGWAKSILFNHRVRDEFETFFHRPQTLALGVXNGCQMMSNLRE 113

Query: 396 RNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYAS 455
                         + +       L+   +    L   M     P  +       +V   
Sbjct: 114 LIPGSELWPRFVRNHSDRFEARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDD 173

Query: 456 DLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKS 515
             +                    +    A  +     +  V  ++      +  HPE   
Sbjct: 174 AHLAALESKGLVALRYVDNFGKVTETYPANPNGSPNGITAVTTENGRVT-IMMPHPERVF 232

Query: 516 RPNRPHPLFVGFVGAA 531
           R          +   +
Sbjct: 233 RTVANSWHPENWGEDS 248


>1l9xA [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
          Length = 288

 Score =  119 bits (298), Expect = 9e-30
 Identities = 42/256 (16%), Positives = 79/256 (30%), Gaps = 37/256 (14%)

Query: 286 RITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDEL 345
            I  L    +  ++  Y   + A  S V+ L   G      V    +   D+T+++ + L
Sbjct: 5   IIGILMQKCRNKVMKNYGRYYIAA-SYVKYLESAGA----RVVPVRL---DLTEKDYEIL 56

Query: 346 LSGVDGVLVPGGFGD---------RGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYAR 396
              ++G+L PGG  D           +   +    +   +  P  G CLG +   +  + 
Sbjct: 57  FKSINGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISG 116

Query: 397 NVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASD 456
                               V   MP       L   M       +         +    
Sbjct: 117 EC-----------LLTATDTVDVAMPLNFTGGQLHSRM------FQNFPTELLLSLAVEP 159

Query: 457 LIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRL--VECVEVKDHPWFVAVQYHPELK 514
           L    H+      N    + ++    +  T+ DG++  +  +E   +P +  VQ+HPE  
Sbjct: 160 LTANFHKWSLSVKNFTMNEKLKKFFNVLTTNTDGKIEFISTMEGYKYPVY-GVQWHPEKA 218

Query: 515 SRPNRPHPLFVGFVGA 530
               +          A
Sbjct: 219 PYEWKNLDGISHAPNA 234


>1fy2A [c.23.16.4] ASPARTYL DIPEPTIDASE
          Length = 220

 Score =  113 bits (284), Expect = 4e-28
 Identities = 26/264 (9%), Positives = 54/264 (20%), Gaps = 56/264 (21%)

Query: 266 EKLGLGCRDIDNAEWID-----MVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGG 320
           E L L    +    W++     + +++        I   G      +      E L   G
Sbjct: 2   ELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLG 61

Query: 321 LSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRGVE-----GKIEAIRWARE 375
           +    NV      A+          +   + ++V GG   + ++     G +  +    +
Sbjct: 62  V----NVTGIHRVADP------LAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVK 111

Query: 376 NKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMR 435
               ++G   G   A              +   +     F  +DL P             
Sbjct: 112 RGALYIGWSAGANLACPTIR-------TTNDMPIVDPNGFDALDLFP------------- 151

Query: 436 LGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVEC 495
                         +      L+                                     
Sbjct: 152 ---LQINPHFTNTREQRIRELLVVAPELTVIGLPE------------GNWIQVSNGQAVL 196

Query: 496 VEVKDHPWFVAVQYHPELKSRPNR 519
                   F             +R
Sbjct: 197 GGPNTTWVF-KAGEEAVALEAGHR 219


>1i1qB [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
          Length = 186

 Score =  110 bits (275), Expect = 4e-27
 Identities = 34/229 (14%), Positives = 54/229 (23%), Gaps = 48/229 (20%)

Query: 303 VELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRG 362
           + L D   S    L     +N  NV I   +    T  +          +++  G G   
Sbjct: 3   ILLLDNIDSFTWNLADQLRTNGHNVVIYRNHIPAQTLID-RLATMKNPVLMLSPGPGVPS 61

Query: 363 VEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMP 422
             G +  +      K P +GICLG Q  V  Y   V  +    ++ +  +       L  
Sbjct: 62  EAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQILHGKATSIEHDGQAMFAGLAN 121

Query: 423 EQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLT 482
                                              +     H              +G  
Sbjct: 122 P----------------------------------LPVARYHSSNVPAGLTINAHFNG-- 145

Query: 483 IAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
                    +V  V           Q+HPE          L    +  A
Sbjct: 146 ---------MVMAVRHDADRVC-GFQFHPESILTTQG-ARLLEQTLAWA 183


>1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
           A:1 -- 188
          Length = 187

 Score =  107 bits (267), Expect = 4e-26
 Identities = 31/229 (13%), Positives = 59/229 (25%), Gaps = 46/229 (20%)

Query: 303 VELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRG 362
           + + D     V  +           +I          + ++       G++  GG     
Sbjct: 3   IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMN-----PKGIIFSGGPSLEN 57

Query: 363 VEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMP 422
                + +    E   P LGICLG Q     +   V                        
Sbjct: 58  TGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKV------------------------ 93

Query: 423 EQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLT 482
                   G      L   ++ D    K +     ++E H    +        L      
Sbjct: 94  ------GRGEKAEYSLVEIEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKIL------ 141

Query: 483 IAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
                 +   +E ++ ++ P +  VQ+HPE+         +   F    
Sbjct: 142 ---ARSETXPIEAMKHEELPIY-GVQFHPEVAHTEKG-EEILRNFAKLC 185


>1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
          Length = 205

 Score =  106 bits (264), Expect = 8e-26
 Identities = 30/244 (12%), Positives = 68/244 (27%), Gaps = 44/244 (18%)

Query: 292 HTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDG 351
           H  +I ++       D      + +           E+   +  +              G
Sbjct: 4   HKHRILIL-------DFGSQYTQLVARRVRELGVYCELWAWDVTEAQIR-----DFNPSG 51

Query: 352 VLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNP 411
           +++ GG      E    A ++  E   P  G+C GMQ   ++   +V             
Sbjct: 52  IILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASN-------ER 104

Query: 412 ETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNE 471
           E  +  ++++ +   V  +   +     P                 +     H  +    
Sbjct: 105 EFGYAQVEVVNDSALVRGIEDALTADGKPL----------------LDVWMSHGDKVTA- 147

Query: 472 YRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
                I S      ++        +  ++  ++  VQ+HPE+         +   FV   
Sbjct: 148 -----IPSDFITVASTESCP-FAIMANEEKRFY-GVQFHPEVTHTRQG-MRMLERFVRDI 199

Query: 532 LNNK 535
              +
Sbjct: 200 CQCE 203


>1aa7A [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
          Length = 158

 Score =  100 bits (250), Expect = 4e-24
 Identities = 11/140 (7%), Positives = 26/140 (18%), Gaps = 12/140 (8%)

Query: 273 RDIDNAEWIDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWI 332
            +      I        +    +    GK  +L      V+              +    
Sbjct: 7   VETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDL-----EVLMEWLKTRPILSPLTKGILG 61

Query: 333 NAEDVTKENVDELLSGVDGVLVPGGFG-----DRGVEGKIEAIRWARENKKPFLGICLGM 387
               +T  +   L       +     G     +     K+               I L  
Sbjct: 62  FVFTLTVPSERGLQR--RRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSY 119

Query: 388 QCAVIEYARNVLGLEGAHSS 407
               +     ++       +
Sbjct: 120 SAGALASCMGLIYNRMGAVT 139


>1gpwB [c.23.16.1] AMIDOTRANSFERASE HISH
          Length = 200

 Score =  100 bits (249), Expect = 4e-24
 Identities = 33/245 (13%), Positives = 66/245 (26%), Gaps = 53/245 (21%)

Query: 295 KIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLV 354
           +I ++          +++   +         N E   I   +             D + +
Sbjct: 2   RIGIISVGP---GNIMNLYRGVKRASE----NFEDVSIELVE------SPRNDLYDLLFI 48

Query: 355 PGGFGD------RGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSE 408
           PG                I+ +R   E+++  +G+CLGMQ    E               
Sbjct: 49  PGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAP---------- 98

Query: 409 LNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEF 468
                                + G   +     KL         +   +  +   + Y +
Sbjct: 99  --------------------GVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYY 138

Query: 469 NNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFV 528
                  + E    +  T  DG  +    V+        Q+HPE  S+      L    +
Sbjct: 139 FVHTYRAVCEEEHVLGTTEYDGE-IFPSAVRKGRIL-GFQFHPEKSSKI--GRKLLEKVI 194

Query: 529 GAALN 533
             +L+
Sbjct: 195 ECSLS 199


>1o1yA [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
          Length = 230

 Score = 97.1 bits (241), Expect = 4e-23
 Identities = 29/250 (11%), Positives = 63/250 (25%), Gaps = 58/250 (23%)

Query: 292 HTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDE-----LL 346
           H  ++  +       +      +           + +       +  +  ++E     LL
Sbjct: 2   HHVRVLAIRHVEI--EDLGXXEDIFREKNW----SFDYLDTPKGEKLERPLEEYSLVVLL 55

Query: 347 SGVDGVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHS 406
            G  G           ++ + + I    + + PFLGI LG Q        +         
Sbjct: 56  GGYXGAYEEEK--YPFLKYEFQLIEEILKKEIPFLGIXLGSQXLAKVLGAS--------- 104

Query: 407 SELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCK-LEDNTFCKDVYASDLIYERHRHR 465
                               V        +G Y  + + DN F ++      +++ H   
Sbjct: 105 --------------------VYRGKNGEEIGWYFVEKVSDNKFFREFPDRLRVFQWHGDT 144

Query: 466 YEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFV 525
           ++                 G               +   V +Q+H E+ +R         
Sbjct: 145 FDLPRRATRVFTSEKYENQGF-------------VYGKAVGLQFHIEVGART--XKRWIE 189

Query: 526 GFVGAALNNK 535
            +       K
Sbjct: 190 AYKDELEKKK 199


>1q7rA [c.23.16.1] PREDICTED AMIDOTRANSFERASE
          Length = 202

 Score = 96.5 bits (239), Expect = 7e-23
 Identities = 40/248 (16%), Positives = 62/248 (25%), Gaps = 59/248 (23%)

Query: 289 HLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSG 348
           +     KI ++G    L  A    V A+   G       E   +           E L G
Sbjct: 2   YFQSNXKIGVLG----LQGAVREHVRAIEACG------AEAVIVKK--------SEQLEG 43

Query: 349 VDGVLVPGGFGD-----RGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEG 403
           +DG+++PGG            G  E ++      KP  G C G+                
Sbjct: 44  LDGLVLPGGESTTXRRLIDRYGLXEPLKQFAAAGKPXFGTCAGLILLAKRIVGYD----- 98

Query: 404 AHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHR 463
                       P + L     +    G           ++                   
Sbjct: 99  -----------EPHLGLXDITVERNSFGRQRESFEAELSIKGVGDGFVGV---------- 137

Query: 464 HRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPL 523
               F           G+ +  T  D      V  +   +     +HPEL     R    
Sbjct: 138 ----FIRAPHIVEAGDGVDVLATYNDR----IVAARQGQFL-GCSFHPELTDDH-RLXQY 187

Query: 524 FVGFVGAA 531
           F+  V  A
Sbjct: 188 FLNXVKEA 195


>1qdlB [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
          Length = 195

 Score = 93.4 bits (231), Expect = 6e-22
 Identities = 28/231 (12%), Positives = 66/231 (28%), Gaps = 43/231 (18%)

Query: 301 KYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGG--- 357
               + D Y S V  +               I  ++++ + ++ +    D +++  G   
Sbjct: 2   DLTLIIDNYDSFVYNIAQIVGEL--GSYPIVIRNDEISIKGIERI--DPDRLIISPGPGT 57

Query: 358 FGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPV 417
              R   G    +      + P LG+CLG Q     +   +         +++       
Sbjct: 58  PEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNI----- 112

Query: 418 IDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLI 477
                    V +   ++  G+                         H    +        
Sbjct: 113 -------ILVNNSPLSLYYGIAKE----------------FKATRYHSLVVDEV------ 143

Query: 478 ESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFV 528
              L +   S +   +  +  +++P +  VQ+HPE        + +   F+
Sbjct: 144 HRPLIVDAISAEDNEIMAIHHEEYPIY-GVQFHPESVGTSL-GYKILYNFL 192


>1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
           -- 229
          Length = 232

 Score = 87.5 bits (216), Expect = 3e-20
 Identities = 43/232 (18%), Positives = 77/232 (33%), Gaps = 43/232 (18%)

Query: 291 THTTKIALV---GKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLS 347
           +H   + ++      ++      S+  A+ H G       E++ + +        D  +S
Sbjct: 2   SHMPVVHVIDVESGNLQ------SLTNAIEHLG------YEVQLVKSPK------DFNIS 43

Query: 348 GVDGVLVPGGFGDRGV------EGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGL 401
           G   +++PG              G  + IR   E+ KP +GI +G+Q            +
Sbjct: 44  GTSRLILPGVGNYGHFVDNLFNRGFEKPIREYIESGKPIMGIXVGLQALFAG------SV 97

Query: 402 EGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYER 461
           E   S+ LN    F +      +K V ++G           +        +      Y  
Sbjct: 98  ESPKSTGLN-YIDFKLSRFDDSEKPVPEIGWNSC-------IPSENLFFGLDPYKRYYFV 149

Query: 462 HRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPEL 513
           H      N+E +  L   G  IA              K++    A Q+HPE 
Sbjct: 150 HSFAAILNSEKKKNLENDGWKIAKAKYGSEEFIAAVNKNN--IFATQFHPEK 199


>1ei5A2 [b.61.3.1] D-AMINOPEPTIDASE A:418 -- 520
          Length = 103

 Score = 83.0 bits (205), Expect = 8e-19
 Identities = 9/88 (10%), Positives = 19/88 (21%), Gaps = 5/88 (5%)

Query: 2   SKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGE 61
                 +   GG +    +G    S    L + G  V +      ++            +
Sbjct: 18  LDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMD-----APSPGEWK 72

Query: 62  VFVTDDGAETDLDLGHYERFIDENLTQN 89
           +    D       L            + 
Sbjct: 73  LVFRRDDKGEITGLSVGCWLARGVEYRR 100


>1ka9H [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
          Length = 195

 Score = 75.0 bits (183), Expect = 2e-16
 Identities = 33/217 (15%), Positives = 53/217 (24%), Gaps = 41/217 (18%)

Query: 320 GLSNDTNVE--IEWINAEDVTKENVDELLSGVDGVLVPGGFGDRGV------EGKIEAIR 371
           G  N  +    +E         ++        D +++PG      V       G +E +R
Sbjct: 9   GSGNLRSAAKALEAAGFSVAVAQDPKAHE-EADLLVLPGQGHFGQVMRAFQESGFVERVR 67

Query: 372 WARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLG 431
              E   PFLGIC+GMQ  + E +    G+ G            P          V  +G
Sbjct: 68  RHLERGLPFLGICVGMQ-VLYEGSEEAPGVRGLG--------LVPGEVRRFRAGRVPQMG 118

Query: 432 GTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGR 491
                                      Y  + +          +    G           
Sbjct: 119 WNALEFGGAFAPLTGRHF---------YFANSYYGPLTPYSLGKGEYEGTPFTALLAKEN 169

Query: 492 LVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFV 528
                        +A Q+HPE   +            
Sbjct: 170 ------------LLAPQFHPEKSGKAG--LAFLALAR 192


>2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
          Length = 269

 Score = 71.2 bits (174), Expect = 3e-15
 Identities = 28/226 (12%), Positives = 67/226 (29%), Gaps = 45/226 (19%)

Query: 295 KIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLS-GVDGVL 353
           KIA++       +    ++  + +  L     +++  ++ E    +   ++ +   DG++
Sbjct: 21  KIAILNLXPTKQETEAQLLRLIGNTPL----QLDVHLLHXESSFYKTFRDIENEKFDGLI 76

Query: 354 VPGG------FGDRGVEGKIEAI-RWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHS 406
           + G       F +     +++ I  +++ N    L IC G Q  +  +            
Sbjct: 77  ITGAPVETLSFEEVDYWEELKRIXEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKX 136

Query: 407 SELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRY 466
             +     F         K ++                           +L +  H    
Sbjct: 137 FGV-----FEHEVREQHVKLLQGFD------------------------ELFFAPHSRHT 167

Query: 467 EFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPE 512
           E       ++    LT+   S +   V  V  ++         H E
Sbjct: 168 EVRESDIREV--KELTLLANSEEAG-VHLVIGQEGRQV-FALGHSE 209


>1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
          Length = 184

 Score = 70.3 bits (171), Expect = 5e-15
 Identities = 14/159 (8%), Positives = 32/159 (20%), Gaps = 20/159 (12%)

Query: 315 ALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGD----RGVEGKIEAI 370
                 ++      ++  +  +          + VD + +PGG             +  I
Sbjct: 37  GPRRSKVTAANGSTVQPHHHLE------GFRSTMVDAIFIPGGAKAAETLSKNGRALHWI 90

Query: 371 RWARENKKPFLGICLGMQCAVIEYARNV---LGLEGAHSSELNPETPFPVIDLMPEQKDV 427
           R A  + K        +       A            H S           +   +   +
Sbjct: 91  REAFGHLKAIGATGEAVDLVAKAIALPQVTVSSEAEVHESYGVVTLKKVKPESFTDAVKI 150

Query: 428 E--DLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRH 464
                G          +  +     D            +
Sbjct: 151 AKGAAGFLGEFFYAIAQHRNWDRELDGLH-----SMIAY 184


>1j42A [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
          Length = 185

 Score = 67.9 bits (165), Expect = 3e-14
 Identities = 14/139 (10%), Positives = 37/139 (26%), Gaps = 14/139 (10%)

Query: 293 TTKIA-LVGKYVELHDAYISVVEALNHGGLSNDT------NVEIEWINAEDVTKENVDEL 345
           + +   ++ K  E  +  +  V+ +   G+          +      +       ++++ 
Sbjct: 1   SKRALVILAKGAEEME-TVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDA 59

Query: 346 L--SGVDGVLVPGGFGD----RGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVL 399
                 D V++PGG              E ++     K     IC G    +        
Sbjct: 60  KKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGCGS 119

Query: 400 GLEGAHSSELNPETPFPVI 418
            +     ++          
Sbjct: 120 KVTTHPLAKDKMMNGGHYT 138


>1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
           B:1653 -- 1880
          Length = 228

 Score = 50.3 bits (120), Expect = 5e-09
 Identities = 39/198 (19%), Positives = 63/198 (31%), Gaps = 50/198 (25%)

Query: 332 INAEDVTKENVDELLSGVDGVLVPGGFGDRGVEGK-IEAIRWARENKKPFLGICLGMQCA 390
            +AEDV K N D       G+ +  G GD       I AI+   E   P  GI LG Q  
Sbjct: 71  TSAEDVLKMNPD-------GIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGIXLGHQLL 123

Query: 391 VIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCK 450
            +      + ++  H    +P               V+D+             ++     
Sbjct: 124 ALASGAKTVKMKFGHHGGNHP---------------VKDVE------------KNVVMIT 156

Query: 451 DVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYH 510
                  + E                + + L +   S     ++ +   D P F + Q +
Sbjct: 157 AQNHGFAVDEAT--------------LPANLRVTHKSLFDGTLQGIHRTDKPAF-SFQGN 201

Query: 511 PELKSRPNRPHPLFVGFV 528
           PE    P+   PLF  F+
Sbjct: 202 PEASPGPHDAAPLFDHFI 219


>1suwA [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
          Length = 249

 Score = 43.0 bits (101), Expect = 8e-07
 Identities = 18/95 (18%), Positives = 30/95 (31%), Gaps = 24/95 (25%)

Query: 295 KIALVGKYVELHDAYI-SVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVL 353
           + A+V K     D ++  + EAL               +  E        E L   D ++
Sbjct: 2   RAAVVYKT----DGHVKRIEEALKR-------------LEVEVELFNQPSEELENFDFIV 44

Query: 354 VPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQ 388
             GG G       +  ++  +    P  GI  G  
Sbjct: 45  SVGGDG-----TILRILQKLK-RCPPIFGINTGRV 73


>1q32A2 [d.136.1.3] TYROSYL-DNA PHOSPHODIESTERASE A:302 -- 538
          Length = 209

 Score = 36.1 bits (83), Expect = 1e-04
 Identities = 13/60 (21%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 156 PFLEAIRQIKYDVGK---ENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPDII 212
            +L     I   + +   EN+ + H+ ++P           PT   + E     I+P II
Sbjct: 4   HYLCQTSSIGTSLSRARDENL-WTHL-MIPLFTGIMSPPILPTNSLINEYSQRKIKPYII 61


>2fexA1 [c.23.16.2] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 188
          Length = 188

 Score = 34.9 bits (80), Expect = 2e-04
 Identities = 12/72 (16%), Positives = 24/72 (33%), Gaps = 14/72 (19%)

Query: 319 GGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFG--DRGVEGKIEAIRWAREN 376
           GGL    +   + ++  D+            D +++PGG              ++  R+ 
Sbjct: 46  GGLKVTPDTSYDALDPVDI------------DALVIPGGLSWEKGTAADLGGLVKRFRDR 93

Query: 377 KKPFLGICLGMQ 388
            +   GIC    
Sbjct: 94  DRLVAGICAAAS 105


>1g8mA2 [c.97.1.4] AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE A:201 --
           593
          Length = 393

 Score = 34.0 bits (77), Expect = 4e-04
 Identities = 17/124 (13%), Positives = 28/124 (22%), Gaps = 16/124 (12%)

Query: 259 GLDRLVCEKLGLGCRDIDNAEWIDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNH 318
                   K       ID      +      +        V    +L +A      A   
Sbjct: 276 SXKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAXFEEVPA--QLTEAEKKQWIAKLT 333

Query: 319 GGLSNDTNVEIEWINAEDVTKENVDELL-SGVDGVLVPGGFGDRGVEGKIEAIRWARENK 377
                   V +         ++NVD     GV  ++ P G        +   I    E  
Sbjct: 334 A-------VSLSSDA-FFPFRDNVDRAKRIGVQFIVAPSG----SAADE-VVIEACNELG 380

Query: 378 KPFL 381
              +
Sbjct: 381 ITLI 384


>1g2iA [c.23.16.2] PROTEASE I
          Length = 166

 Score = 32.8 bits (75), Expect = 0.001
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 5/56 (8%)

Query: 336 DVTKENVDELLSGVDGVLVPGGFG---DRGVEGKIEAIRWARENKKPFLGICLGMQ 388
           D+T + V+      D +++PGG      R  E  +   R      KP   IC G Q
Sbjct: 51  DLTFDKVN--PEEFDALVLPGGRAPERVRLNEKAVSIARKXFSEGKPVASICHGPQ 104


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0636    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 19,070,555
Number of extensions: 1434059
Number of successful extensions: 5542
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5392
Number of HSP's successfully gapped: 176
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)